F421132
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 358 | 229 | 351 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10006879|Ga0075370_100068792 |
| Length | 143 |
| Sequence | VFVSPGKHLHIGPETSTAFTCWMASIYEQIGGHEALEAVVADFYDRVLADDELATFFSGTNMARLRGKQVEFFAAALGGPEPYTGAPMRKVHQGRGITTHHFTLVAVHLADALATAGVADGVIEQILGAISPLRDDIATASPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 3 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 4 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 5 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 6 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 7 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 96 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 148 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 149 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 150 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 151 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 152 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 153 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 154 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 161 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 162 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 163 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 164 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 219 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 220 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 222 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 223 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 224 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 227 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 228 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.04 |
| Metatranscriptomes | 0 |
| Isolates | 1.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.06 |
| Nodule | 0.28 |
| Rhizoplane | 10.61 |
| Rhizosphere | 69.27 |
| Stem | 0 |
| Stem Tuber | 0.28 |
| Unclassified | 9.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1005224 | 3300002074 | Bacteria | 1502 |
| 2 | JGI24744J21845_10001644 | 3300002077 | Bacteria | 4473 |
| 3 | JGI24034J26672_10019064 | 3300002239 | Bacteria | 1068 |
| 4 | Ga0070676_10079965 | 3300005328 | Bacteria | 1980 |
| 5 | Ga0070666_10014399 | 3300005335 | Bacteria | 5035 |
| 6 | Ga0070666_10260472 | 3300005335 | Bacteria | 1229 |
| 7 | Ga0070682_100018531 | 3300005337 | Bacteria | 4073 |
| 8 | Ga0068868_100008196 | 3300005338 | Bacteria | 7474 |
| 9 | Ga0070689_100006258 | 3300005340 | Bacteria | 8218 |
| 10 | Ga0070691_10032458 | 3300005341 | Bacteria | 2454 |
| 11 | Ga0070668_100016209 | 3300005347 | Bacteria | 5575 |
| 12 | Ga0070668_100116210 | 3300005347 | Bacteria | 2133 |
| 13 | Ga0070669_100003711 | 3300005353 | Bacteria | 11019 |
| 14 | Ga0070671_100001317 | 3300005355 | Bacteria | 18655 |
| 15 | Ga0070671_100030612 | 3300005355 | Bacteria | 4442 |
| 16 | Ga0070671_100136301 | 3300005355 | Bacteria | 2070 |
| 17 | Ga0070674_100004354 | 3300005356 | Bacteria | 8074 |
| 18 | Ga0070688_100025338 | 3300005365 | Bacteria | 3511 |
| 19 | Ga0070688_100923401 | 3300005365 | Bacteria | 689 |
| 20 | Ga0070667_100001916 | 3300005367 | Bacteria | 18463 |
| 21 | Ga0070667_100016338 | 3300005367 | Bacteria | 6140 |
| 22 | Ga0070667_100019388 | 3300005367 | Bacteria | 5643 |
| 23 | Ga0070667_100256470 | 3300005367 | Bacteria | 1565 |
| 24 | Ga0070709_10179968 | 3300005434 | Bacteria | 1484 |
| 25 | Ga0070714_101939161 | 3300005435 | Bacteria | 575 |
| 26 | Ga0070713_100015149 | 3300005436 | Bacteria | 5749 |
| 27 | Ga0070713_100491839 | 3300005436 | Bacteria | 1157 |
| 28 | Ga0070710_10002834 | 3300005437 | Bacteria | 8267 |
| 29 | Ga0070710_10226009 | 3300005437 | Bacteria | 1193 |
| 30 | Ga0070701_10002730 | 3300005438 | Bacteria | 6848 |
| 31 | Ga0070701_10473991 | 3300005438 | Bacteria | 808 |
| 32 | Ga0070711_100008229 | 3300005439 | Bacteria | 6379 |
| 33 | Ga0070711_101661250 | 3300005439 | Bacteria | 559 |
| 34 | Ga0070705_100012785 | 3300005440 | Bacteria | 4278 |
| 35 | Ga0070700_100006496 | 3300005441 | Bacteria | 6256 |
| 36 | Ga0070694_100006976 | 3300005444 | Bacteria | 6865 |
| 37 | Ga0070694_101909287 | 3300005444 | Bacteria | 507 |
| 38 | Ga0070708_100485833 | 3300005445 | Bacteria | 1165 |
| 39 | Ga0070678_100003516 | 3300005456 | Bacteria | 8738 |
| 40 | Ga0068867_100008165 | 3300005459 | Bacteria | 7394 |
| 41 | Ga0070685_10385748 | 3300005466 | Bacteria | 966 |
| 42 | Ga0070699_100724957 | 3300005518 | Bacteria | 909 |
| 43 | Ga0068853_100006315 | 3300005539 | Bacteria | 9404 |
| 44 | Ga0070672_100146268 | 3300005543 | Bacteria | 1953 |
| 45 | Ga0070686_100201307 | 3300005544 | Bacteria | 1428 |
| 46 | Ga0070686_100264897 | 3300005544 | Bacteria | 1261 |
| 47 | Ga0070695_100009055 | 3300005545 | Bacteria | 5918 |
| 48 | Ga0070696_100004409 | 3300005546 | Bacteria | 9395 |
| 49 | Ga0070693_100026206 | 3300005547 | Bacteria | 3146 |
| 50 | Ga0070665_100004853 | 3300005548 | Bacteria | 13971 |
| 51 | Ga0070665_100096029 | 3300005548 | Bacteria | 2969 |
| 52 | Ga0070704_100003494 | 3300005549 | Bacteria | 9026 |
| 53 | Ga0068855_100063501 | 3300005563 | Bacteria | 4310 |
| 54 | Ga0068854_100022009 | 3300005578 | Bacteria | 4334 |
| 55 | Ga0070702_100004707 | 3300005615 | Bacteria | 6262 |
| 56 | Ga0068852_100043506 | 3300005616 | Bacteria | 3810 |
| 57 | Ga0068859_100010827 | 3300005617 | Bacteria | 9178 |
| 58 | Ga0068859_100101964 | 3300005617 | Bacteria | 2927 |
| 59 | Ga0068866_10001362 | 3300005718 | Bacteria | 10579 |
| 60 | Ga0068861_100006975 | 3300005719 | Bacteria | 7718 |
| 61 | Ga0068861_100231660 | 3300005719 | Bacteria | 1567 |
| 62 | Ga0068861_101624769 | 3300005719 | Bacteria | 637 |
| 63 | Ga0068863_100133769 | 3300005841 | Bacteria | 2368 |
| 64 | Ga0068863_100176357 | 3300005841 | Bacteria | 2051 |
| 65 | Ga0068858_100008703 | 3300005842 | Bacteria | 9745 |
| 66 | Ga0068858_101763990 | 3300005842 | Bacteria | 611 |
| 67 | Ga0068860_100008854 | 3300005843 | Bacteria | 10027 |
| 68 | Ga0068860_100746207 | 3300005843 | Bacteria | 990 |
| 69 | Ga0068862_100011712 | 3300005844 | Bacteria | 7238 |
| 70 | Ga0068862_100258862 | 3300005844 | Bacteria | 1588 |
| 71 | Ga0081455_10017789 | 3300005937 | Bacteria | 6797 |
| 72 | Ga0070717_10068227 | 3300006028 | Bacteria | 2960 |
| 73 | Ga0075365_10081509 | 3300006038 | Bacteria | 2192 |
| 74 | Ga0075368_10555142 | 3300006042 | Bacteria | 517 |
| 75 | Ga0075363_100062579 | 3300006048 | Bacteria | 2007 |
| 76 | Ga0075363_100067752 | 3300006048 | Bacteria | 1934 |
| 77 | Ga0075364_10030215 | 3300006051 | Bacteria | 3476 |
| 78 | Ga0075364_10157275 | 3300006051 | Bacteria | 1533 |
| 79 | Ga0070715_10003280 | 3300006163 | Bacteria | 5113 |
| 80 | Ga0070715_10659287 | 3300006163 | Bacteria | 620 |
| 81 | Ga0070715_11087379 | 3300006163 | Unclassified | 503 |
| 82 | Ga0070716_100269520 | 3300006173 | Bacteria | 1169 |
| 83 | Ga0070712_100003259 | 3300006175 | Bacteria | 9994 |
| 84 | Ga0070712_100116404 | 3300006175 | Unclassified | 2005 |
| 85 | Ga0070712_100272697 | 3300006175 | Bacteria | 1360 |
| 86 | Ga0070712_101033970 | 3300006175 | Bacteria | 712 |
| 87 | Ga0075362_10127009 | 3300006177 | Bacteria | 1210 |
| 88 | Ga0075367_10011975 | 3300006178 | Bacteria | 4607 |
| 89 | Ga0075369_10020128 | 3300006186 | Bacteria | 2731 |
| 90 | Ga0075369_10053890 | 3300006186 | Bacteria | 1746 |
| 91 | Ga0075369_10177113 | 3300006186 | Bacteria | 980 |
| 92 | Ga0075370_10002002 | 3300006353 | Bacteria | 9241 |
| 93 | Ga0075370_10006879 | 3300006353 | Bacteria | 5754 |
| 94 | Ga0075370_10304289 | 3300006353 | Bacteria | 948 |
| 95 | Ga0075430_100016862 | 3300006846 | Bacteria | 6222 |
| 96 | Ga0068865_100004752 | 3300006881 | Bacteria | 8210 |
| 97 | Ga0097620_100010827 | 3300006931 | Bacteria | 9178 |
| 98 | Ga0097620_100101961 | 3300006931 | Bacteria | 2927 |
| 99 | Ga0105245_10017554 | 3300009098 | Bacteria | 6245 |
| 100 | Ga0105247_10002819 | 3300009101 | Bacteria | 11598 |
| 101 | Ga0114129_13113439 | 3300009147 | Bacteria | 542 |
| 102 | Ga0105243_10011074 | 3300009148 | Bacteria | 6823 |
| 103 | Ga0105242_10006080 | 3300009176 | Bacteria | 9309 |
| 104 | Ga0105248_10012094 | 3300009177 | Bacteria | 9521 |
| 105 | Ga0105248_11436054 | 3300009177 | Bacteria | 781 |
| 106 | Ga0105237_10008274 | 3300009545 | Bacteria | 11297 |
| 107 | Ga0105237_10059924 | 3300009545 | Bacteria | 3808 |
| 108 | Ga0105249_10005486 | 3300009553 | Bacteria | 10957 |
| 109 | Ga0105249_10009141 | 3300009553 | Bacteria | 8666 |
| 110 | Ga0105249_11466838 | 3300009553 | Bacteria | 754 |
| 111 | Ga0105033_105790 | 3300009986 | Bacteria | 1065 |
| 112 | Ga0105239_10013252 | 3300010375 | Bacteria | 9164 |
| 113 | Ga0105239_10014172 | 3300010375 | Bacteria | 8846 |
| 114 | Ga0105239_11417968 | 3300010375 | Bacteria | 802 |
| 115 | Ga0157369_10994670 | 3300013105 | Bacteria | 859 |
| 116 | Ga0157374_10070436 | 3300013296 | Bacteria | 3295 |
| 117 | Ga0157378_10019714 | 3300013297 | Bacteria | 5930 |
| 118 | Ga0163162_10031827 | 3300013306 | Bacteria | 5234 |
| 119 | Ga0163162_10220271 | 3300013306 | Bacteria | 2027 |
| 120 | Ga0163162_10726208 | 3300013306 | Bacteria | 1114 |
| 121 | Ga0157372_10049810 | 3300013307 | Bacteria | 4659 |
| 122 | Ga0157375_10019823 | 3300013308 | Bacteria | 6129 |
| 123 | Ga0163163_11879629 | 3300014325 | Bacteria | 659 |
| 124 | Ga0157380_10004949 | 3300014326 | Bacteria | 9286 |
| 125 | Ga0157379_10012584 | 3300014968 | Bacteria | 7391 |
| 126 | Ga0157376_10191048 | 3300014969 | Bacteria | 1878 |
| 127 | Ga0163161_10006553 | 3300017792 | Bacteria | 8058 |
| 128 | Ga0213876_10000658 | 3300021384 | Bacteria | 24793 |
| 129 | Ga0213876_10006077 | 3300021384 | Bacteria | 6599 |
| 130 | Ga0213875_10039175 | 3300021388 | Bacteria | 2233 |
| 131 | Ga0213875_10043393 | 3300021388 | Bacteria | 2112 |
| 132 | Ga0224572_1040979 | 3300024225 | Bacteria | 872 |
| 133 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 134 | Ga0207692_10030329 | 3300025898 | Bacteria | 2578 |
| 135 | Ga0207680_10027412 | 3300025903 | Bacteria | 3172 |
| 136 | Ga0207680_10283131 | 3300025903 | Bacteria | 1152 |
| 137 | Ga0207699_10010450 | 3300025906 | Bacteria | 4659 |
| 138 | Ga0207645_10019473 | 3300025907 | Bacteria | 4449 |
| 139 | Ga0207671_10021347 | 3300025914 | Bacteria | 4914 |
| 140 | Ga0207671_10030211 | 3300025914 | Bacteria | 4042 |
| 141 | Ga0207693_10008781 | 3300025915 | Bacteria | 8259 |
| 142 | Ga0207693_10073718 | 3300025915 | Bacteria | 2672 |
| 143 | Ga0207693_10089246 | 3300025915 | Bacteria | 2416 |
| 144 | Ga0207663_10004075 | 3300025916 | Bacteria | 7247 |
| 145 | Ga0207663_10207440 | 3300025916 | Bacteria | 1418 |
| 146 | Ga0207681_10010429 | 3300025923 | Bacteria | 5687 |
| 147 | Ga0207664_10027041 | 3300025929 | Bacteria | 4345 |
| 148 | Ga0207664_10552148 | 3300025929 | Bacteria | 1033 |
| 149 | Ga0207644_10032209 | 3300025931 | Bacteria | 3655 |
| 150 | Ga0207644_10094888 | 3300025931 | Bacteria | 2230 |
| 151 | Ga0207706_10024647 | 3300025933 | Bacteria | 5392 |
| 152 | Ga0207686_10026334 | 3300025934 | Bacteria | 3391 |
| 153 | Ga0207670_10013510 | 3300025936 | Bacteria | 4819 |
| 154 | Ga0207669_10000690 | 3300025937 | Bacteria | 14571 |
| 155 | Ga0207704_10002853 | 3300025938 | Bacteria | 7809 |
| 156 | Ga0207691_10193375 | 3300025940 | Bacteria | 1774 |
| 157 | Ga0207711_10005751 | 3300025941 | Bacteria | 10466 |
| 158 | Ga0207711_11390957 | 3300025941 | Bacteria | 644 |
| 159 | Ga0207689_10057725 | 3300025942 | Bacteria | 3192 |
| 160 | Ga0207667_10136321 | 3300025949 | Bacteria | 2527 |
| 161 | Ga0207712_10261378 | 3300025961 | Bacteria | 1404 |
| 162 | Ga0207668_10014713 | 3300025972 | Bacteria | 4847 |
| 163 | Ga0207640_10015915 | 3300025981 | Bacteria | 4364 |
| 164 | Ga0207658_10015913 | 3300025986 | Bacteria | 5165 |
| 165 | Ga0207658_10017018 | 3300025986 | Bacteria | 5005 |
| 166 | Ga0207658_10030437 | 3300025986 | Bacteria | 3821 |
| 167 | Ga0207658_10206774 | 3300025986 | Bacteria | 1642 |
| 168 | Ga0207677_10030550 | 3300026023 | Bacteria | 3440 |
| 169 | Ga0207703_11680053 | 3300026035 | Bacteria | 611 |
| 170 | Ga0207639_10023292 | 3300026041 | Bacteria | 4470 |
| 171 | Ga0207678_10013460 | 3300026067 | Bacteria | 7182 |
| 172 | Ga0207708_10004990 | 3300026075 | Bacteria | 9774 |
| 173 | Ga0207702_10687912 | 3300026078 | Bacteria | 1007 |
| 174 | Ga0207641_10035470 | 3300026088 | Bacteria | 4155 |
| 175 | Ga0207641_10782505 | 3300026088 | Bacteria | 943 |
| 176 | Ga0207648_10001850 | 3300026089 | Bacteria | 23152 |
| 177 | Ga0207675_100009645 | 3300026118 | Bacteria | 9035 |
| 178 | Ga0207675_100298553 | 3300026118 | Bacteria | 1568 |
| 179 | Ga0207675_101126153 | 3300026118 | Bacteria | 805 |
| 180 | Ga0207683_10006176 | 3300026121 | Bacteria | 10266 |
| 181 | Ga0268266_10002346 | 3300028379 | Bacteria | 20467 |
| 182 | Ga0268266_10244570 | 3300028379 | Bacteria | 1657 |
| 183 | Ga0268265_10280644 | 3300028380 | Bacteria | 1490 |
| 184 | Ga0268265_11456154 | 3300028380 | Bacteria | 688 |
| 185 | Ga0268264_10006389 | 3300028381 | Bacteria | 9930 |
| 186 | Ga0268264_10738837 | 3300028381 | Bacteria | 980 |
| 187 | Ga0265327_10007636 | 3300031251 | Bacteria | 8288 |
| 188 | Ga0307413_10034705 | 3300031824 | Bacteria | 2886 |
| 189 | Ga0307406_10082556 | 3300031901 | Bacteria | 2141 |
| 190 | Ga0307409_100012864 | 3300031995 | Bacteria | 5354 |
| 191 | Ga0307416_100578117 | 3300032002 | Bacteria | 1200 |
| 192 | Ga0307415_100010253 | 3300032126 | Bacteria | 5298 |
| 193 | Ga0307415_100478309 | 3300032126 | Bacteria | 1084 |
| 194 | Ga0373959_0092351 | 3300034820 | Bacteria | 711 |
| 195 | Ga0373943_0206721 | 3300035170 | Bacteria | 1089 |
| 196 | Ga0373931_0002301 | 3300035691 | Bacteria | 8444 |
| 197 | Ga0373947_0316320 | 3300035725 | Bacteria | 1043 |
| 198 | Ga0373937_1019552 | 3300036401 | Bacteria | 776 |
| 199 | Ga0373925_0001327 | 3300037068 | Bacteria | 21637 |
| 200 | Ga0436364_0207895 | 3300037853 | Bacteria | 5819 |
| 201 | Ga0436364_0468501 | 3300037853 | Bacteria | 4591 |
| 202 | Ga0436364_0979927 | 3300037853 | Bacteria | 13391 |
| 203 | Ga0436364_0981085 | 3300037853 | Bacteria | 3068 |
| 204 | Ga0436365_0702776 | 3300039437 | Bacteria | 2939 |
| 205 | Ga0436365_0826871 | 3300039437 | Bacteria | 77999 |
| 206 | Ga0436365_1234540 | 3300039437 | Bacteria | 27598 |
| 207 | Ga0439466_0197296 | 3300041411 | Bacteria | 612 |
| 208 | Ga0439465_0064292 | 3300041413 | Bacteria | 1220 |
| 209 | Ga0451843_1630061 | 3300041509 | Bacteria | 504 |
| 210 | Ga0439431_0036857 | 3300041997 | Bacteria | 1233 |
| 211 | Ga0439448_0057823 | 3300042005 | Bacteria | 1278 |
| 212 | Ga0439434_0221236 | 3300042435 | Bacteria | 642 |
| 213 | Ga0466969_0135200 | 3300044656 | Bacteria | 1142 |
| 214 | Ga0466972_0078917 | 3300044658 | Bacteria | 1568 |
| 215 | Ga0466972_0090714 | 3300044658 | Bacteria | 1449 |
| 216 | Ga0466972_0314112 | 3300044658 | Bacteria | 732 |
| 217 | Ga0466972_0483493 | 3300044658 | Bacteria | 582 |
| 218 | Ga0466965_0005275 | 3300044683 | Bacteria | 5814 |
| 219 | Ga0466965_0057452 | 3300044683 | Bacteria | 1939 |
| 220 | Ga0466965_0141617 | 3300044683 | Bacteria | 1252 |
| 221 | Ga0466965_0162585 | 3300044683 | Bacteria | 1171 |
| 222 | Ga0466966_0377692 | 3300044684 | Bacteria | 851 |
| 223 | Ga0466961_0007931 | 3300044693 | Bacteria | 6766 |
| 224 | Ga0466961_0165773 | 3300044693 | Bacteria | 1375 |
| 225 | Ga0466964_0072471 | 3300044706 | Bacteria | 1460 |
| 226 | Ga0466971_0039511 | 3300044719 | Bacteria | 2117 |
| 227 | Ga0466968_0164132 | 3300044735 | Bacteria | 1026 |
| 228 | Ga0466968_0166151 | 3300044735 | Bacteria | 1020 |
| 229 | Ga0466970_0012556 | 3300044765 | Bacteria | 4335 |
| 230 | Ga0466970_0018847 | 3300044765 | Bacteria | 3574 |
| 231 | Ga0466970_0037940 | 3300044765 | Bacteria | 2556 |
| 232 | Ga0466970_0126202 | 3300044765 | Bacteria | 1403 |
| 233 | Ga0466957_0044884 | 3300044842 | Bacteria | 2679 |
| 234 | Ga0466957_0740127 | 3300044842 | Bacteria | 696 |
| 235 | Ga0466960_0000284 | 3300044901 | Bacteria | 17649 |
| 236 | Ga0466960_0548384 | 3300044901 | Bacteria | 682 |
| 237 | Ga0466960_0723711 | 3300044901 | Bacteria | 598 |
| 238 | Ga0466959_0030216 | 3300045049 | Bacteria | 4012 |
| 239 | Ga0466959_0065668 | 3300045049 | Bacteria | 2633 |
| 240 | Ga0466967_0092315 | 3300045976 | Bacteria | 2753 |
| 241 | Ga0466967_0181346 | 3300045976 | Bacteria | 1986 |
| 242 | Ga0466967_0610356 | 3300045976 | Bacteria | 1077 |
| 243 | Ga0466967_1645562 | 3300045976 | Bacteria | 639 |
| 244 | Ga0495603_0190127 | 3300046455 | Bacteria | 1187 |
| 245 | Ga0495629_0167766 | 3300046459 | Bacteria | 1524 |
| 246 | Ga0495641_0156680 | 3300046461 | Bacteria | 1018 |
| 247 | Ga0495580_0845371 | 3300046472 | Bacteria | 591 |
| 248 | Ga0495639_0310729 | 3300046475 | Bacteria | 787 |
| 249 | Ga0495607_0249020 | 3300046501 | Bacteria | 856 |
| 250 | Ga0495630_0294531 | 3300046517 | Bacteria | 1240 |
| 251 | Ga0495665_0047294 | 3300046531 | Bacteria | 2282 |
| 252 | Ga0495640_0200441 | 3300046533 | Bacteria | 1265 |
| 253 | Ga0495634_0234430 | 3300046642 | Bacteria | 1128 |
| 254 | Ga0495658_0024765 | 3300046683 | Bacteria | 3201 |
| 255 | Ga0495624_0371654 | 3300046690 | Bacteria | 859 |
| 256 | Ga0495581_0017890 | 3300047315 | Bacteria | 4119 |
| 257 | Ga0495674_0095677 | 3300047319 | Bacteria | 2532 |
| 258 | Ga0495676_0382639 | 3300047321 | Bacteria | 936 |
| 259 | Ga0495683_0000620 | 3300047323 | Bacteria | 26506 |
| 260 | Ga0495593_0099521 | 3300047673 | Bacteria | 1492 |
| 261 | Ga0495614_0370740 | 3300048089 | Bacteria | 669 |
| 262 | Ga0496100_0000090 | 3300048903 | Bacteria | 51781 |
| 263 | Ga0496100_0326579 | 3300048903 | Bacteria | 1154 |
| 264 | Ga0496101_0000409 | 3300048904 | Bacteria | 27808 |
| 265 | Ga0496101_0001777 | 3300048904 | Bacteria | 12957 |
| 266 | Ga0496101_0184179 | 3300048904 | Bacteria | 1609 |
| 267 | Ga0496102_0023781 | 3300048905 | Bacteria | 5444 |
| 268 | Ga0496102_0029975 | 3300048905 | Bacteria | 4868 |
| 269 | Ga0496102_0479138 | 3300048905 | Bacteria | 1165 |
| 270 | Ga0496102_1596943 | 3300048905 | Bacteria | 570 |
| 271 | Ga0496103_0001655 | 3300048906 | Bacteria | 14592 |
| 272 | Ga0496103_0002004 | 3300048906 | Bacteria | 13126 |
| 273 | Ga0496104_0161977 | 3300048907 | Bacteria | 2146 |
| 274 | Ga0496104_0214017 | 3300048907 | Bacteria | 1839 |
| 275 | Ga0496105_0143159 | 3300048908 | Bacteria | 1967 |
| 276 | Ga0496106_0004805 | 3300048909 | Bacteria | 9996 |
| 277 | Ga0496106_1335545 | 3300048909 | Bacteria | 556 |
| 278 | Ga0496107_0001535 | 3300048910 | Bacteria | 14344 |
| 279 | Ga0496107_0002668 | 3300048910 | Bacteria | 11683 |
| 280 | Ga0496108_0005138 | 3300048911 | Bacteria | 10580 |
| 281 | Ga0496108_0160827 | 3300048911 | Bacteria | 1941 |
| 282 | Ga0496109_0000134 | 3300048912 | Bacteria | 75662 |
| 283 | Ga0496109_1154956 | 3300048912 | Bacteria | 711 |
| 284 | Ga0496109_1241920 | 3300048912 | Bacteria | 681 |
| 285 | Ga0496110_0066096 | 3300048913 | Bacteria | 3197 |
| 286 | Ga0496110_0985373 | 3300048913 | Bacteria | 750 |
| 287 | Ga0496110_1117595 | 3300048913 | Bacteria | 696 |
| 288 | Ga0496111_0002609 | 3300048914 | Bacteria | 10915 |
| 289 | Ga0496111_0300345 | 3300048914 | Bacteria | 1190 |
| 290 | Ga0496112_0309252 | 3300048915 | Bacteria | 1525 |
| 291 | Ga0496112_1093300 | 3300048915 | Bacteria | 716 |
| 292 | Ga0496113_0041312 | 3300048916 | Bacteria | 3403 |
| 293 | Ga0496113_0137219 | 3300048916 | Bacteria | 1922 |
| 294 | Ga0496113_1128882 | 3300048916 | Bacteria | 614 |
| 295 | Ga0496114_0003469 | 3300048917 | Bacteria | 12104 |
| 296 | Ga0496114_0003623 | 3300048917 | Bacteria | 11877 |
| 297 | Ga0496115_0002731 | 3300048918 | Bacteria | 12677 |
| 298 | Ga0496115_0027493 | 3300048918 | Bacteria | 4450 |
| 299 | Ga0496115_1136339 | 3300048918 | Bacteria | 590 |
| 300 | Ga0496116_0008260 | 3300048919 | Bacteria | 9060 |
| 301 | Ga0496117_0036655 | 3300048920 | Bacteria | 3665 |
| 302 | Ga0496118_0019274 | 3300048921 | Bacteria | 6105 |
| 303 | Ga0496119_0050766 | 3300048922 | Bacteria | 2553 |
| 304 | Ga0496120_0022565 | 3300048923 | Bacteria | 3958 |
| 305 | Ga0496120_0054068 | 3300048923 | Bacteria | 2278 |
| 306 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 307 | Ga0496122_0000138 | 3300048925 | Bacteria | 169434 |
| 308 | Ga0496122_0002933 | 3300048925 | Bacteria | 23264 |
| 309 | Ga0496123_0009161 | 3300048926 | Bacteria | 8951 |
| 310 | Ga0496123_0013559 | 3300048926 | Bacteria | 6825 |
| 311 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 312 | Ga0496124_0759494 | 3300048927 | Bacteria | 606 |
| 313 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 314 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 315 | Ga0496126_0004875 | 3300048929 | Bacteria | 15711 |
| 316 | Ga0496126_0154173 | 3300048929 | Bacteria | 1967 |
| 317 | Ga0496126_0339285 | 3300048929 | Bacteria | 1231 |
| 318 | Ga0496126_0531538 | 3300048929 | Bacteria | 936 |
| 319 | Ga0501032_0585810 | 3300049569 | Bacteria | 710 |
| 320 | Ga0501034_0147112 | 3300049571 | Bacteria | 2333 |
| 321 | Ga0501034_0352797 | 3300049571 | Bacteria | 1399 |
| 322 | Ga0501036_1427480 | 3300049572 | Bacteria | 561 |
| 323 | Ga0501047_1079828 | 3300049581 | Bacteria | 616 |
| 324 | Ga0501068_0494818 | 3300049584 | Bacteria | 793 |
| 325 | Ga0501070_0438453 | 3300049586 | Bacteria | 1054 |
| 326 | Ga0501070_1494544 | 3300049586 | Bacteria | 511 |
| 327 | Ga0501044_0455180 | 3300049823 | Bacteria | 1186 |
| 328 | nmdc:mga03683_208821_c1 | 3300050489 | Bacteria | 898 |
| 329 | nmdc:mga03n38_131463_c1 | 3300050490 | Bacteria | 1241 |
| 330 | nmdc:mga03n38_211131_c1 | 3300050490 | Bacteria | 1009 |
| 331 | nmdc:mga03n38_252708_c1 | 3300050490 | Bacteria | 932 |
| 332 | nmdc:mga03n38_63730_c1 | 3300050490 | Bacteria | 1685 |
| 333 | nmdc:mga00v17_50571_c1 | 3300050491 | Bacteria | 2526 |
| 334 | nmdc:mga00v17_655979_c1 | 3300050491 | Bacteria | 674 |
| 335 | nmdc:mga00v17_9190_c1 | 3300050491 | Bacteria | 5339 |
| 336 | nmdc:mga00v17_93620_c1 | 3300050491 | Bacteria | 1890 |
| 337 | nmdc:mga0yw44_65384_c1 | 3300050492 | Bacteria | 2241 |
| 338 | nmdc:mga06z11_102969_c1 | 3300050494 | Bacteria | 1569 |
| 339 | nmdc:mga06z11_330678_c1 | 3300050494 | Bacteria | 910 |
| 340 | nmdc:mga07m45_3014_c1 | 3300050496 | Bacteria | 8025 |
| 341 | nmdc:mga07m45_602100_c1 | 3300050496 | Bacteria | 635 |
| 342 | nmdc:mga0qj67_35013_c1 | 3300050509 | Bacteria | 3924 |
| 343 | nmdc:mga0sz30_1779_c1 | 3300050516 | Bacteria | 7651 |
| 344 | nmdc:mga0sz30_4943_c1 | 3300050516 | Bacteria | 4045 |
| 345 | nmdc:mga0sz30_5181_c1 | 3300050516 | Bacteria | 4774 |
| 346 | nmdc:mga0sz30_60551_c1 | 3300050516 | Bacteria | 1616 |
| 347 | Ga0500642_0120115 | 3300053130 | Bacteria | 1229 |
| 348 | Ga0500652_065546 | 3300053131 | Bacteria | 1500 |
| 349 | Ga0500627_0029071 | 3300053158 | Bacteria | 2302 |
| 350 | Ga0466962_0013152 | 3300061719 | Bacteria | 3981 |
| 351 | Ga0466962_0067100 | 3300061719 | Bacteria | 1713 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0585810 | Ga0501032_0585810_250_642 | 113 |
| 2 | 3300049572 | Ga0501036_1427480 | Ga0501036_1427480_61_453 | 113 |
| 3 | 3300005436 | Ga0070713_100015149 | Ga0070713_1000151494 | 115 |
| 4 | 3300005437 | Ga0070710_10002834 | Ga0070710_100028347 | 115 |
| 5 | iso_pu_bacteria | 2795385470 | 2795786325 | 117 |
| 6 | iso_pu_bacteria | 2842134933 | 2842139545 | 117 |
| 7 | iso_pu_bacteria | 2899370129 | 2899375900 | 117 |
| 8 | iso_pu_bacteria | 2929212328 | 2929217824 | 117 |
| 9 | iso_pu_bacteria | 2643221692 | 2644516458 | 119 |
| 10 | iso_pu_bacteria | 2919713450 | 2919718657 | 119 |
| 11 | 3300005518 | Ga0070699_100724957 | Ga0070699_1007249571 | 120 |
| 12 | 3300031824 | Ga0307413_10034705 | Ga0307413_100347052 | 120 |
| 13 | 3300031901 | Ga0307406_10082556 | Ga0307406_100825564 | 120 |
| 14 | 3300031995 | Ga0307409_100012864 | Ga0307409_1000128642 | 120 |
| 15 | 3300032002 | Ga0307416_100578117 | Ga0307416_1005781172 | 120 |
| 16 | 3300032126 | Ga0307415_100010253 | Ga0307415_1000102537 | 120 |
| 17 | 3300041413 | Ga0439465_0064292 | Ga0439465_0064292_524_886 | 120 |
| 18 | 3300041509 | Ga0451843_1630061 | Ga0451843_1630061_107_469 | 120 |
| 19 | 3300044658 | Ga0466972_0078917 | Ga0466972_0078917_1038_1406 | 120 |
| 20 | 3300044658 | Ga0466972_0483493 | Ga0466972_0483493_205_567 | 120 |
| 21 | 3300044735 | Ga0466968_0166151 | Ga0466968_0166151_503_865 | 120 |
| 22 | 3300044765 | Ga0466970_0012556 | Ga0466970_0012556_485_847 | 120 |
| 23 | 3300044765 | Ga0466970_0018847 | Ga0466970_0018847_637_999 | 120 |
| 24 | 3300044765 | Ga0466970_0037940 | Ga0466970_0037940_276_644 | 120 |
| 25 | 3300044842 | Ga0466957_0740127 | Ga0466957_0740127_45_407 | 120 |
| 26 | 3300044901 | Ga0466960_0723711 | Ga0466960_0723711_156_518 | 120 |
| 27 | 3300045976 | Ga0466967_0181346 | Ga0466967_0181346_268_630 | 120 |
| 28 | 3300045976 | Ga0466967_0610356 | Ga0466967_0610356_598_960 | 120 |
| 29 | 3300048903 | Ga0496100_0326579 | Ga0496100_0326579_577_939 | 120 |
| 30 | 3300048904 | Ga0496101_0184179 | Ga0496101_0184179_455_817 | 120 |
| 31 | 3300048915 | Ga0496112_0309252 | Ga0496112_0309252_556_918 | 120 |
| 32 | 3300048916 | Ga0496113_0137219 | Ga0496113_0137219_845_1207 | 120 |
| 33 | 3300048918 | Ga0496115_1136339 | Ga0496115_1136339_85_447 | 120 |
| 34 | 3300048923 | Ga0496120_0022565 | Ga0496120_0022565_2914_3276 | 120 |
| 35 | 3300048925 | Ga0496122_0002933 | Ga0496122_0002933_20553_20915 | 120 |
| 36 | 3300048926 | Ga0496123_0009161 | Ga0496123_0009161_512_874 | 120 |
| 37 | 3300048927 | Ga0496124_0759494 | Ga0496124_0759494_62_424 | 120 |
| 38 | 3300048929 | Ga0496126_0154173 | Ga0496126_0154173_698_1060 | 120 |
| 39 | 3300049571 | Ga0501034_0352797 | Ga0501034_0352797_540_902 | 120 |
| 40 | 3300049584 | Ga0501068_0494818 | Ga0501068_0494818_370_732 | 120 |
| 41 | 3300049586 | Ga0501070_0438453 | Ga0501070_0438453_248_610 | 120 |
| 42 | 3300049586 | Ga0501070_1494544 | Ga0501070_1494544_71_433 | 120 |
| 43 | 3300002074 | JGI24748J21848_1005224 | JGI24748J21848_10052242 | 121 |
| 44 | 3300002077 | JGI24744J21845_10001644 | JGI24744J21845_100016444 | 121 |
| 45 | 3300002239 | JGI24034J26672_10019064 | JGI24034J26672_100190642 | 121 |
| 46 | 3300005328 | Ga0070676_10079965 | Ga0070676_100799652 | 121 |
| 47 | 3300005335 | Ga0070666_10014399 | Ga0070666_100143992 | 121 |
| 48 | 3300005335 | Ga0070666_10260472 | Ga0070666_102604722 | 121 |
| 49 | 3300005337 | Ga0070682_100018531 | Ga0070682_1000185314 | 121 |
| 50 | 3300005338 | Ga0068868_100008196 | Ga0068868_1000081964 | 121 |
| 51 | 3300005340 | Ga0070689_100006258 | Ga0070689_1000062585 | 121 |
| 52 | 3300005341 | Ga0070691_10032458 | Ga0070691_100324582 | 121 |
| 53 | 3300005347 | Ga0070668_100016209 | Ga0070668_1000162092 | 121 |
| 54 | 3300005347 | Ga0070668_100116210 | Ga0070668_1001162102 | 121 |
| 55 | 3300005353 | Ga0070669_100003711 | Ga0070669_1000037114 | 121 |
| 56 | 3300005355 | Ga0070671_100001317 | Ga0070671_10000131719 | 121 |
| 57 | 3300005355 | Ga0070671_100030612 | Ga0070671_1000306122 | 121 |
| 58 | 3300005355 | Ga0070671_100136301 | Ga0070671_1001363014 | 121 |
| 59 | 3300005356 | Ga0070674_100004354 | Ga0070674_1000043546 | 121 |
| 60 | 3300005365 | Ga0070688_100025338 | Ga0070688_1000253382 | 121 |
| 61 | 3300005365 | Ga0070688_100923401 | Ga0070688_1009234012 | 121 |
| 62 | 3300005367 | Ga0070667_100001916 | Ga0070667_1000019162 | 121 |
| 63 | 3300005367 | Ga0070667_100016338 | Ga0070667_1000163382 | 121 |
| 64 | 3300005367 | Ga0070667_100019388 | Ga0070667_1000193883 | 121 |
| 65 | 3300005367 | Ga0070667_100256470 | Ga0070667_1002564702 | 121 |
| 66 | 3300005434 | Ga0070709_10179968 | Ga0070709_101799682 | 121 |
| 67 | 3300005435 | Ga0070714_101939161 | Ga0070714_1019391611 | 121 |
| 68 | 3300005436 | Ga0070713_100491839 | Ga0070713_1004918392 | 121 |
| 69 | 3300005437 | Ga0070710_10226009 | Ga0070710_102260092 | 121 |
| 70 | 3300005438 | Ga0070701_10002730 | Ga0070701_100027304 | 121 |
| 71 | 3300005438 | Ga0070701_10473991 | Ga0070701_104739911 | 121 |
| 72 | 3300005439 | Ga0070711_100008229 | Ga0070711_1000082295 | 121 |
| 73 | 3300005439 | Ga0070711_101661250 | Ga0070711_1016612501 | 121 |
| 74 | 3300005440 | Ga0070705_100012785 | Ga0070705_1000127856 | 121 |
| 75 | 3300005441 | Ga0070700_100006496 | Ga0070700_1000064967 | 121 |
| 76 | 3300005444 | Ga0070694_100006976 | Ga0070694_1000069765 | 121 |
| 77 | 3300005444 | Ga0070694_101909287 | Ga0070694_1019092871 | 121 |
| 78 | 3300005445 | Ga0070708_100485833 | Ga0070708_1004858332 | 121 |
| 79 | 3300005456 | Ga0070678_100003516 | Ga0070678_1000035166 | 121 |
| 80 | 3300005459 | Ga0068867_100008165 | Ga0068867_1000081655 | 121 |
| 81 | 3300005466 | Ga0070685_10385748 | Ga0070685_103857481 | 121 |
| 82 | 3300005539 | Ga0068853_100006315 | Ga0068853_1000063154 | 121 |
| 83 | 3300005543 | Ga0070672_100146268 | Ga0070672_1001462682 | 121 |
| 84 | 3300005544 | Ga0070686_100201307 | Ga0070686_1002013072 | 121 |
| 85 | 3300005544 | Ga0070686_100264897 | Ga0070686_1002648972 | 121 |
| 86 | 3300005545 | Ga0070695_100009055 | Ga0070695_1000090553 | 121 |
| 87 | 3300005546 | Ga0070696_100004409 | Ga0070696_1000044097 | 121 |
| 88 | 3300005547 | Ga0070693_100026206 | Ga0070693_1000262062 | 121 |
| 89 | 3300005548 | Ga0070665_100004853 | Ga0070665_1000048533 | 121 |
| 90 | 3300005548 | Ga0070665_100096029 | Ga0070665_1000960293 | 121 |
| 91 | 3300005549 | Ga0070704_100003494 | Ga0070704_1000034944 | 121 |
| 92 | 3300005563 | Ga0068855_100063501 | Ga0068855_1000635012 | 121 |
| 93 | 3300005578 | Ga0068854_100022009 | Ga0068854_1000220092 | 121 |
| 94 | 3300005615 | Ga0070702_100004707 | Ga0070702_1000047072 | 121 |
| 95 | 3300005616 | Ga0068852_100043506 | Ga0068852_1000435066 | 121 |
| 96 | 3300005617 | Ga0068859_100010827 | Ga0068859_1000108277 | 121 |
| 97 | 3300005617 | Ga0068859_100101964 | Ga0068859_1001019642 | 121 |
| 98 | 3300005718 | Ga0068866_10001362 | Ga0068866_100013625 | 121 |
| 99 | 3300005719 | Ga0068861_100006975 | Ga0068861_1000069755 | 121 |
| 100 | 3300005719 | Ga0068861_100231660 | Ga0068861_1002316602 | 121 |
| 101 | 3300005719 | Ga0068861_101624769 | Ga0068861_1016247691 | 121 |
| 102 | 3300005841 | Ga0068863_100133769 | Ga0068863_1001337693 | 121 |
| 103 | 3300005841 | Ga0068863_100176357 | Ga0068863_1001763573 | 121 |
| 104 | 3300005842 | Ga0068858_100008703 | Ga0068858_1000087036 | 121 |
| 105 | 3300005842 | Ga0068858_101763990 | Ga0068858_1017639901 | 121 |
| 106 | 3300005843 | Ga0068860_100008854 | Ga0068860_1000088544 | 121 |
| 107 | 3300005843 | Ga0068860_100746207 | Ga0068860_1007462072 | 121 |
| 108 | 3300005844 | Ga0068862_100011712 | Ga0068862_1000117125 | 121 |
| 109 | 3300005844 | Ga0068862_100258862 | Ga0068862_1002588622 | 121 |
| 110 | 3300005937 | Ga0081455_10017789 | Ga0081455_100177892 | 121 |
| 111 | 3300006028 | Ga0070717_10068227 | Ga0070717_100682272 | 121 |
| 112 | 3300006038 | Ga0075365_10081509 | Ga0075365_100815092 | 121 |
| 113 | 3300006042 | Ga0075368_10555142 | Ga0075368_105551422 | 121 |
| 114 | 3300006048 | Ga0075363_100062579 | Ga0075363_1000625793 | 121 |
| 115 | 3300006048 | Ga0075363_100067752 | Ga0075363_1000677522 | 121 |
| 116 | 3300006051 | Ga0075364_10030215 | Ga0075364_100302151 | 121 |
| 117 | 3300006051 | Ga0075364_10157275 | Ga0075364_101572752 | 121 |
| 118 | 3300006163 | Ga0070715_10003280 | Ga0070715_100032802 | 121 |
| 119 | 3300006163 | Ga0070715_10659287 | Ga0070715_106592872 | 121 |
| 120 | 3300006163 | Ga0070715_11087379 | Ga0070715_110873791 | 121 |
| 121 | 3300006173 | Ga0070716_100269520 | Ga0070716_1002695201 | 121 |
| 122 | 3300006175 | Ga0070712_100003259 | Ga0070712_10000325919 | 121 |
| 123 | 3300006175 | Ga0070712_100116404 | Ga0070712_1001164041 | 121 |
| 124 | 3300006175 | Ga0070712_100272697 | Ga0070712_1002726973 | 121 |
| 125 | 3300006175 | Ga0070712_101033970 | Ga0070712_1010339701 | 121 |
| 126 | 3300006177 | Ga0075362_10127009 | Ga0075362_101270092 | 121 |
| 127 | 3300006178 | Ga0075367_10011975 | Ga0075367_100119754 | 121 |
| 128 | 3300006186 | Ga0075369_10020128 | Ga0075369_100201281 | 121 |
| 129 | 3300006186 | Ga0075369_10053890 | Ga0075369_100538903 | 121 |
| 130 | 3300006186 | Ga0075369_10177113 | Ga0075369_101771132 | 121 |
| 131 | 3300006353 | Ga0075370_10002002 | Ga0075370_100020025 | 121 |
| 132 | 3300006353 | Ga0075370_10006879 | Ga0075370_100068792 | 121 |
| 133 | 3300006353 | Ga0075370_10304289 | Ga0075370_103042892 | 121 |
| 134 | 3300006846 | Ga0075430_100016862 | Ga0075430_1000168622 | 121 |
| 135 | 3300006881 | Ga0068865_100004752 | Ga0068865_1000047525 | 121 |
| 136 | 3300006931 | Ga0097620_100010827 | Ga0097620_1000108277 | 121 |
| 137 | 3300006931 | Ga0097620_100101961 | Ga0097620_1001019612 | 121 |
| 138 | 3300009098 | Ga0105245_10017554 | Ga0105245_100175548 | 121 |
| 139 | 3300009101 | Ga0105247_10002819 | Ga0105247_100028197 | 121 |
| 140 | 3300009147 | Ga0114129_13113439 | Ga0114129_131134391 | 121 |
| 141 | 3300009148 | Ga0105243_10011074 | Ga0105243_100110742 | 121 |
| 142 | 3300009176 | Ga0105242_10006080 | Ga0105242_100060807 | 121 |
| 143 | 3300009177 | Ga0105248_10012094 | Ga0105248_100120948 | 121 |
| 144 | 3300009177 | Ga0105248_11436054 | Ga0105248_114360542 | 121 |
| 145 | 3300009545 | Ga0105237_10008274 | Ga0105237_100082745 | 121 |
| 146 | 3300009545 | Ga0105237_10059924 | Ga0105237_100599242 | 121 |
| 147 | 3300009553 | Ga0105249_10005486 | Ga0105249_100054862 | 121 |
| 148 | 3300009553 | Ga0105249_10009141 | Ga0105249_100091415 | 121 |
| 149 | 3300009553 | Ga0105249_11466838 | Ga0105249_114668381 | 121 |
| 150 | 3300009986 | Ga0105033_105790 | Ga0105033_1057901 | 121 |
| 151 | 3300010375 | Ga0105239_10013252 | Ga0105239_100132528 | 121 |
| 152 | 3300010375 | Ga0105239_10014172 | Ga0105239_1001417211 | 121 |
| 153 | 3300010375 | Ga0105239_11417968 | Ga0105239_114179682 | 121 |
| 154 | 3300013105 | Ga0157369_10994670 | Ga0157369_109946702 | 121 |
| 155 | 3300013296 | Ga0157374_10070436 | Ga0157374_100704362 | 121 |
| 156 | 3300013297 | Ga0157378_10019714 | Ga0157378_100197143 | 121 |
| 157 | 3300013306 | Ga0163162_10031827 | Ga0163162_100318272 | 121 |
| 158 | 3300013306 | Ga0163162_10220271 | Ga0163162_102202712 | 121 |
| 159 | 3300013306 | Ga0163162_10726208 | Ga0163162_107262082 | 121 |
| 160 | 3300013307 | Ga0157372_10049810 | Ga0157372_100498103 | 121 |
| 161 | 3300013308 | Ga0157375_10019823 | Ga0157375_100198238 | 121 |
| 162 | 3300014325 | Ga0163163_11879629 | Ga0163163_118796292 | 121 |
| 163 | 3300014326 | Ga0157380_10004949 | Ga0157380_100049495 | 121 |
| 164 | 3300014968 | Ga0157379_10012584 | Ga0157379_100125842 | 121 |
| 165 | 3300014969 | Ga0157376_10191048 | Ga0157376_101910482 | 121 |
| 166 | 3300017792 | Ga0163161_10006553 | Ga0163161_100065535 | 121 |
| 167 | 3300021384 | Ga0213876_10000658 | Ga0213876_1000065813 | 121 |
| 168 | 3300021384 | Ga0213876_10006077 | Ga0213876_100060772 | 121 |
| 169 | 3300021388 | Ga0213875_10039175 | Ga0213875_100391753 | 121 |
| 170 | 3300021388 | Ga0213875_10043393 | Ga0213875_100433933 | 121 |
| 171 | 3300024225 | Ga0224572_1040979 | Ga0224572_10409791 | 121 |
| 172 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033259 | 121 |
| 173 | 3300025898 | Ga0207692_10030329 | Ga0207692_100303292 | 121 |
| 174 | 3300025903 | Ga0207680_10027412 | Ga0207680_100274122 | 121 |
| 175 | 3300025903 | Ga0207680_10283131 | Ga0207680_102831312 | 121 |
| 176 | 3300025906 | Ga0207699_10010450 | Ga0207699_100104502 | 121 |
| 177 | 3300025907 | Ga0207645_10019473 | Ga0207645_100194732 | 121 |
| 178 | 3300025914 | Ga0207671_10021347 | Ga0207671_100213472 | 121 |
| 179 | 3300025914 | Ga0207671_10030211 | Ga0207671_100302113 | 121 |
| 180 | 3300025915 | Ga0207693_10008781 | Ga0207693_100087815 | 121 |
| 181 | 3300025915 | Ga0207693_10073718 | Ga0207693_100737182 | 121 |
| 182 | 3300025915 | Ga0207693_10089246 | Ga0207693_100892461 | 121 |
| 183 | 3300025916 | Ga0207663_10004075 | Ga0207663_100040754 | 121 |
| 184 | 3300025916 | Ga0207663_10207440 | Ga0207663_102074402 | 121 |
| 185 | 3300025923 | Ga0207681_10010429 | Ga0207681_100104297 | 121 |
| 186 | 3300025929 | Ga0207664_10027041 | Ga0207664_100270411 | 121 |
| 187 | 3300025929 | Ga0207664_10552148 | Ga0207664_105521482 | 121 |
| 188 | 3300025931 | Ga0207644_10032209 | Ga0207644_100322097 | 121 |
| 189 | 3300025931 | Ga0207644_10094888 | Ga0207644_100948882 | 121 |
| 190 | 3300025933 | Ga0207706_10024647 | Ga0207706_100246473 | 121 |
| 191 | 3300025934 | Ga0207686_10026334 | Ga0207686_100263344 | 121 |
| 192 | 3300025936 | Ga0207670_10013510 | Ga0207670_100135104 | 121 |
| 193 | 3300025937 | Ga0207669_10000690 | Ga0207669_1000069025 | 121 |
| 194 | 3300025938 | Ga0207704_10002853 | Ga0207704_100028535 | 121 |
| 195 | 3300025940 | Ga0207691_10193375 | Ga0207691_101933752 | 121 |
| 196 | 3300025941 | Ga0207711_10005751 | Ga0207711_1000575119 | 121 |
| 197 | 3300025941 | Ga0207711_11390957 | Ga0207711_113909571 | 121 |
| 198 | 3300025942 | Ga0207689_10057725 | Ga0207689_100577252 | 121 |
| 199 | 3300025949 | Ga0207667_10136321 | Ga0207667_101363212 | 121 |
| 200 | 3300025961 | Ga0207712_10261378 | Ga0207712_102613782 | 121 |
| 201 | 3300025972 | Ga0207668_10014713 | Ga0207668_100147132 | 121 |
| 202 | 3300025981 | Ga0207640_10015915 | Ga0207640_100159154 | 121 |
| 203 | 3300025986 | Ga0207658_10015913 | Ga0207658_100159136 | 121 |
| 204 | 3300025986 | Ga0207658_10017018 | Ga0207658_100170186 | 121 |
| 205 | 3300025986 | Ga0207658_10030437 | Ga0207658_100304372 | 121 |
| 206 | 3300025986 | Ga0207658_10206774 | Ga0207658_102067742 | 121 |
| 207 | 3300026023 | Ga0207677_10030550 | Ga0207677_100305504 | 121 |
| 208 | 3300026035 | Ga0207703_11680053 | Ga0207703_116800531 | 121 |
| 209 | 3300026041 | Ga0207639_10023292 | Ga0207639_100232925 | 121 |
| 210 | 3300026067 | Ga0207678_10013460 | Ga0207678_100134603 | 121 |
| 211 | 3300026075 | Ga0207708_10004990 | Ga0207708_100049908 | 121 |
| 212 | 3300026078 | Ga0207702_10687912 | Ga0207702_106879122 | 121 |
| 213 | 3300026088 | Ga0207641_10035470 | Ga0207641_100354706 | 121 |
| 214 | 3300026088 | Ga0207641_10782505 | Ga0207641_107825053 | 121 |
| 215 | 3300026089 | Ga0207648_10001850 | Ga0207648_100018508 | 121 |
| 216 | 3300026118 | Ga0207675_100009645 | Ga0207675_1000096457 | 121 |
| 217 | 3300026118 | Ga0207675_100298553 | Ga0207675_1002985532 | 121 |
| 218 | 3300026118 | Ga0207675_101126153 | Ga0207675_1011261532 | 121 |
| 219 | 3300026121 | Ga0207683_10006176 | Ga0207683_100061766 | 121 |
| 220 | 3300028379 | Ga0268266_10002346 | Ga0268266_1000234623 | 121 |
| 221 | 3300028379 | Ga0268266_10244570 | Ga0268266_102445702 | 121 |
| 222 | 3300028380 | Ga0268265_10280644 | Ga0268265_102806442 | 121 |
| 223 | 3300028380 | Ga0268265_11456154 | Ga0268265_114561541 | 121 |
| 224 | 3300028381 | Ga0268264_10006389 | Ga0268264_100063895 | 121 |
| 225 | 3300028381 | Ga0268264_10738837 | Ga0268264_107388372 | 121 |
| 226 | 3300031251 | Ga0265327_10007636 | Ga0265327_100076362 | 121 |
| 227 | 3300032126 | Ga0307415_100478309 | Ga0307415_1004783092 | 121 |
| 228 | 3300034820 | Ga0373959_0092351 | Ga0373959_0092351_329_694 | 121 |
| 229 | 3300035170 | Ga0373943_0206721 | Ga0373943_0206721_498_863 | 121 |
| 230 | 3300035691 | Ga0373931_0002301 | Ga0373931_0002301_3686_4051 | 121 |
| 231 | 3300035725 | Ga0373947_0316320 | Ga0373947_0316320_335_700 | 121 |
| 232 | 3300036401 | Ga0373937_1019552 | Ga0373937_1019552_225_590 | 121 |
| 233 | 3300037068 | Ga0373925_0001327 | Ga0373925_0001327_5236_5622 | 121 |
| 234 | 3300037853 | Ga0436364_0207895 | Ga0436364_0207895_1964_2338 | 121 |
| 235 | 3300037853 | Ga0436364_0468501 | Ga0436364_0468501_2864_3274 | 121 |
| 236 | 3300037853 | Ga0436364_0979927 | Ga0436364_0979927_12837_13211 | 121 |
| 237 | 3300037853 | Ga0436364_0981085 | Ga0436364_0981085_909_1289 | 121 |
| 238 | 3300039437 | Ga0436365_0702776 | Ga0436365_0702776_2230_2604 | 121 |
| 239 | 3300039437 | Ga0436365_0826871 | Ga0436365_0826871_11021_11431 | 121 |
| 240 | 3300039437 | Ga0436365_1234540 | Ga0436365_1234540_14060_14470 | 121 |
| 241 | 3300041411 | Ga0439466_0197296 | Ga0439466_0197296_193_558 | 121 |
| 242 | 3300041997 | Ga0439431_0036857 | Ga0439431_0036857_422_787 | 121 |
| 243 | 3300042005 | Ga0439448_0057823 | Ga0439448_0057823_690_1055 | 121 |
| 244 | 3300042435 | Ga0439434_0221236 | Ga0439434_0221236_208_573 | 121 |
| 245 | 3300044656 | Ga0466969_0135200 | Ga0466969_0135200_525_890 | 121 |
| 246 | 3300044658 | Ga0466972_0090714 | Ga0466972_0090714_766_1131 | 121 |
| 247 | 3300044658 | Ga0466972_0314112 | Ga0466972_0314112_71_436 | 121 |
| 248 | 3300044683 | Ga0466965_0005275 | Ga0466965_0005275_4894_5259 | 121 |
| 249 | 3300044683 | Ga0466965_0057452 | Ga0466965_0057452_542_907 | 121 |
| 250 | 3300044683 | Ga0466965_0141617 | Ga0466965_0141617_509_874 | 121 |
| 251 | 3300044683 | Ga0466965_0162585 | Ga0466965_0162585_752_1117 | 121 |
| 252 | 3300044684 | Ga0466966_0377692 | Ga0466966_0377692_203_568 | 121 |
| 253 | 3300044693 | Ga0466961_0007931 | Ga0466961_0007931_2649_3050 | 121 |
| 254 | 3300044693 | Ga0466961_0165773 | Ga0466961_0165773_380_745 | 121 |
| 255 | 3300044706 | Ga0466964_0072471 | Ga0466964_0072471_468_833 | 121 |
| 256 | 3300044719 | Ga0466971_0039511 | Ga0466971_0039511_47_412 | 121 |
| 257 | 3300044735 | Ga0466968_0164132 | Ga0466968_0164132_612_977 | 121 |
| 258 | 3300044765 | Ga0466970_0126202 | Ga0466970_0126202_128_493 | 121 |
| 259 | 3300044842 | Ga0466957_0044884 | Ga0466957_0044884_1837_2202 | 121 |
| 260 | 3300044901 | Ga0466960_0000284 | Ga0466960_0000284_5368_5733 | 121 |
| 261 | 3300044901 | Ga0466960_0548384 | Ga0466960_0548384_209_574 | 121 |
| 262 | 3300045049 | Ga0466959_0030216 | Ga0466959_0030216_2026_2391 | 121 |
| 263 | 3300045049 | Ga0466959_0065668 | Ga0466959_0065668_1781_2182 | 121 |
| 264 | 3300045976 | Ga0466967_0092315 | Ga0466967_0092315_1788_2153 | 121 |
| 265 | 3300045976 | Ga0466967_1645562 | Ga0466967_1645562_260_625 | 121 |
| 266 | 3300046455 | Ga0495603_0190127 | Ga0495603_0190127_316_681 | 121 |
| 267 | 3300046459 | Ga0495629_0167766 | Ga0495629_0167766_858_1223 | 121 |
| 268 | 3300046461 | Ga0495641_0156680 | Ga0495641_0156680_197_562 | 121 |
| 269 | 3300046472 | Ga0495580_0845371 | Ga0495580_0845371_166_531 | 121 |
| 270 | 3300046475 | Ga0495639_0310729 | Ga0495639_0310729_326_691 | 121 |
| 271 | 3300046501 | Ga0495607_0249020 | Ga0495607_0249020_30_455 | 121 |
| 272 | 3300046517 | Ga0495630_0294531 | Ga0495630_0294531_606_971 | 121 |
| 273 | 3300046531 | Ga0495665_0047294 | Ga0495665_0047294_960_1325 | 121 |
| 274 | 3300046533 | Ga0495640_0200441 | Ga0495640_0200441_316_681 | 121 |
| 275 | 3300046642 | Ga0495634_0234430 | Ga0495634_0234430_127_492 | 121 |
| 276 | 3300046683 | Ga0495658_0024765 | Ga0495658_0024765_2606_2971 | 121 |
| 277 | 3300046690 | Ga0495624_0371654 | Ga0495624_0371654_277_642 | 121 |
| 278 | 3300047315 | Ga0495581_0017890 | Ga0495581_0017890_1278_1643 | 121 |
| 279 | 3300047319 | Ga0495674_0095677 | Ga0495674_0095677_602_967 | 121 |
| 280 | 3300047321 | Ga0495676_0382639 | Ga0495676_0382639_384_749 | 121 |
| 281 | 3300047323 | Ga0495683_0000620 | Ga0495683_0000620_17395_17820 | 121 |
| 282 | 3300047673 | Ga0495593_0099521 | Ga0495593_0099521_671_1036 | 121 |
| 283 | 3300048089 | Ga0495614_0370740 | Ga0495614_0370740_30_395 | 121 |
| 284 | 3300048903 | Ga0496100_0000090 | Ga0496100_0000090_17759_18124 | 121 |
| 285 | 3300048904 | Ga0496101_0000409 | Ga0496101_0000409_9659_10024 | 121 |
| 286 | 3300048904 | Ga0496101_0001777 | Ga0496101_0001777_7707_8072 | 121 |
| 287 | 3300048905 | Ga0496102_0023781 | Ga0496102_0023781_2231_2596 | 121 |
| 288 | 3300048905 | Ga0496102_0029975 | Ga0496102_0029975_595_960 | 121 |
| 289 | 3300048905 | Ga0496102_0479138 | Ga0496102_0479138_575_940 | 121 |
| 290 | 3300048905 | Ga0496102_1596943 | Ga0496102_1596943_131_496 | 121 |
| 291 | 3300048906 | Ga0496103_0001655 | Ga0496103_0001655_6605_6970 | 121 |
| 292 | 3300048906 | Ga0496103_0002004 | Ga0496103_0002004_7661_8026 | 121 |
| 293 | 3300048907 | Ga0496104_0161977 | Ga0496104_0161977_34_399 | 121 |
| 294 | 3300048907 | Ga0496104_0214017 | Ga0496104_0214017_1392_1757 | 121 |
| 295 | 3300048908 | Ga0496105_0143159 | Ga0496105_0143159_408_773 | 121 |
| 296 | 3300048909 | Ga0496106_0004805 | Ga0496106_0004805_6296_6661 | 121 |
| 297 | 3300048909 | Ga0496106_1335545 | Ga0496106_1335545_150_515 | 121 |
| 298 | 3300048910 | Ga0496107_0001535 | Ga0496107_0001535_8876_9241 | 121 |
| 299 | 3300048910 | Ga0496107_0002668 | Ga0496107_0002668_651_1016 | 121 |
| 300 | 3300048911 | Ga0496108_0005138 | Ga0496108_0005138_6927_7292 | 121 |
| 301 | 3300048911 | Ga0496108_0160827 | Ga0496108_0160827_178_543 | 121 |
| 302 | 3300048912 | Ga0496109_0000134 | Ga0496109_0000134_57513_57878 | 121 |
| 303 | 3300048912 | Ga0496109_1154956 | Ga0496109_1154956_237_602 | 121 |
| 304 | 3300048912 | Ga0496109_1241920 | Ga0496109_1241920_199_564 | 121 |
| 305 | 3300048913 | Ga0496110_0066096 | Ga0496110_0066096_2132_2497 | 121 |
| 306 | 3300048913 | Ga0496110_0985373 | Ga0496110_0985373_68_433 | 121 |
| 307 | 3300048913 | Ga0496110_1117595 | Ga0496110_1117595_126_491 | 121 |
| 308 | 3300048914 | Ga0496111_0002609 | Ga0496111_0002609_7209_7574 | 121 |
| 309 | 3300048914 | Ga0496111_0300345 | Ga0496111_0300345_568_933 | 121 |
| 310 | 3300048915 | Ga0496112_1093300 | Ga0496112_1093300_64_429 | 121 |
| 311 | 3300048916 | Ga0496113_0041312 | Ga0496113_0041312_2865_3230 | 121 |
| 312 | 3300048916 | Ga0496113_1128882 | Ga0496113_1128882_95_505 | 121 |
| 313 | 3300048917 | Ga0496114_0003469 | Ga0496114_0003469_8398_8763 | 121 |
| 314 | 3300048917 | Ga0496114_0003623 | Ga0496114_0003623_5116_5481 | 121 |
| 315 | 3300048918 | Ga0496115_0002731 | Ga0496115_0002731_8014_8379 | 121 |
| 316 | 3300048918 | Ga0496115_0027493 | Ga0496115_0027493_3575_3940 | 121 |
| 317 | 3300048919 | Ga0496116_0008260 | Ga0496116_0008260_3925_4290 | 121 |
| 318 | 3300048920 | Ga0496117_0036655 | Ga0496117_0036655_2108_2473 | 121 |
| 319 | 3300048921 | Ga0496118_0019274 | Ga0496118_0019274_926_1291 | 121 |
| 320 | 3300048922 | Ga0496119_0050766 | Ga0496119_0050766_415_780 | 121 |
| 321 | 3300048923 | Ga0496120_0054068 | Ga0496120_0054068_1790_2155 | 121 |
| 322 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_525111_525476 | 121 |
| 323 | 3300048925 | Ga0496122_0000138 | Ga0496122_0000138_27094_27459 | 121 |
| 324 | 3300048926 | Ga0496123_0013559 | Ga0496123_0013559_3626_3991 | 121 |
| 325 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_249904_250269 | 121 |
| 326 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_664292_664657 | 121 |
| 327 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_525111_525476 | 121 |
| 328 | 3300048929 | Ga0496126_0004875 | Ga0496126_0004875_9940_10350 | 121 |
| 329 | 3300048929 | Ga0496126_0339285 | Ga0496126_0339285_481_885 | 121 |
| 330 | 3300048929 | Ga0496126_0531538 | Ga0496126_0531538_383_748 | 121 |
| 331 | 3300049571 | Ga0501034_0147112 | Ga0501034_0147112_1523_1888 | 121 |
| 332 | 3300049581 | Ga0501047_1079828 | Ga0501047_1079828_218_583 | 121 |
| 333 | 3300049823 | Ga0501044_0455180 | Ga0501044_0455180_96_506 | 121 |
| 334 | 3300050489 | nmdc:mga03683_208821_c1 | nmdc:mga03683_208821_c1_343_708 | 121 |
| 335 | 3300050490 | nmdc:mga03n38_131463_c1 | nmdc:mga03n38_131463_c1_52_417 | 121 |
| 336 | 3300050490 | nmdc:mga03n38_211131_c1 | nmdc:mga03n38_211131_c1_410_775 | 121 |
| 337 | 3300050490 | nmdc:mga03n38_252708_c1 | nmdc:mga03n38_252708_c1_502_912 | 121 |
| 338 | 3300050490 | nmdc:mga03n38_63730_c1 | nmdc:mga03n38_63730_c1_1125_1490 | 121 |
| 339 | 3300050491 | nmdc:mga00v17_50571_c1 | nmdc:mga00v17_50571_c1_1308_1673 | 121 |
| 340 | 3300050491 | nmdc:mga00v17_655979_c1 | nmdc:mga00v17_655979_c1_206_571 | 121 |
| 341 | 3300050491 | nmdc:mga00v17_9190_c1 | nmdc:mga00v17_9190_c1_1586_1951 | 121 |
| 342 | 3300050491 | nmdc:mga00v17_93620_c1 | nmdc:mga00v17_93620_c1_312_722 | 121 |
| 343 | 3300050492 | nmdc:mga0yw44_65384_c1 | nmdc:mga0yw44_65384_c1_270_635 | 121 |
| 344 | 3300050494 | nmdc:mga06z11_102969_c1 | nmdc:mga06z11_102969_c1_1159_1524 | 121 |
| 345 | 3300050494 | nmdc:mga06z11_330678_c1 | nmdc:mga06z11_330678_c1_439_804 | 121 |
| 346 | 3300050496 | nmdc:mga07m45_3014_c1 | nmdc:mga07m45_3014_c1_2724_3134 | 121 |
| 347 | 3300050496 | nmdc:mga07m45_602100_c1 | nmdc:mga07m45_602100_c1_50_415 | 121 |
| 348 | 3300050509 | nmdc:mga0qj67_35013_c1 | nmdc:mga0qj67_35013_c1_3132_3497 | 121 |
| 349 | 3300050516 | nmdc:mga0sz30_1779_c1 | nmdc:mga0sz30_1779_c1_7015_7380 | 121 |
| 350 | 3300050516 | nmdc:mga0sz30_4943_c1 | nmdc:mga0sz30_4943_c1_2606_3016 | 121 |
| 351 | 3300050516 | nmdc:mga0sz30_5181_c1 | nmdc:mga0sz30_5181_c1_2788_3153 | 121 |
| 352 | 3300050516 | nmdc:mga0sz30_60551_c1 | nmdc:mga0sz30_60551_c1_1172_1537 | 121 |
| 353 | 3300053130 | Ga0500642_0120115 | Ga0500642_0120115_531_938 | 121 |
| 354 | 3300053131 | Ga0500652_065546 | Ga0500652_065546_987_1355 | 121 |
| 355 | 3300053158 | Ga0500627_0029071 | Ga0500627_0029071_1153_1521 | 121 |
| 356 | 3300061719 | Ga0466962_0013152 | Ga0466962_0013152_3009_3374 | 121 |
| 357 | 3300061719 | Ga0466962_0067100 | Ga0466962_0067100_436_837 | 121 |
| 358 | iso_pu_bacteria | 2547132424 | 2548694541 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gkn-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant | 0.9984 | 1 | 116 |
| 2gkm-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis trhbn tyrb10phe mutant | 0.9977 | 1 | 116 |
| 2gl3-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis trhbn, tyrb10phe glne11val mutant | 0.9971 | 1 | 117 |
| 1idr-assembly1.cif.gz_A | crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis | 0.9863 | 3 | 117 |
| 2gkn-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant | 0.9862 | 1 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3aq5A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9756 | 2 | 116 | 1.10.490.10 |
| 1uvyA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9724 | 3 | 118 | 1.10.490.10 |
| 1uvyA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9643 | 3 | 118 | 1.10.490.10 |
| af_P9WN25_1_136_1.10.490.10 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9604 | 3 | 121 | 1.10.490.10 |
| 6ciiA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9548 | 3 | 115 | 1.10.490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q740T9-F1-model_v4 | Group 1 truncated hemoglobin GlbN (Truncated hemoglobin) (trHbN) (Hemoglobin-like protein HbN) | 1.004 | 2 | 121 |
GO:0005344
GO:0019825 GO:0020037 GO:0046872 |
| AF-A0A2U3P017-F1-model_v4 | Group 1 truncated hemoglobin | 1.002 | 1 | 120 |
GO:0005344
GO:0019825 GO:0020037 GO:0046872 |
| AF-A0A1A2ZJK9-F1-model_v4 | Group 1 truncated hemoglobin | 1.002 | 1 | 117 |
GO:0005344
GO:0019825 GO:0020037 GO:0046872 |
| AF-A0A7I7V4P5-F1-model_v4 | deleted | 1.001 | 1 | 120 |
|
| AF-A0A1V3XFR3-F1-model_v4 | Group 1 truncated hemoglobin GlbN (Hemoglobin-like protein HbN) | 1.001 | 3 | 97 |
GO:0005344
GO:0019825 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar