F421132

General Info

Members Datasets Scaffolds Average Seq Length
358 229 351 123

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10006879|Ga0075370_100068792
Length 143
Sequence VFVSPGKHLHIGPETSTAFTCWMASIYEQIGGHEALEAVVADFYDRVLADDELATFFSGTNMARLRGKQVEFFAAALGGPEPYTGAPMRKVHQGRGITTHHFTLVAVHLADALATAGVADGVIEQILGAISPLRDDIATASPV

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2643221692 Nocardia sp. Root136 Isolate Unclassified
3 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
6 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
7 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.06
Nodule 0.28
Rhizoplane 10.61
Rhizosphere 69.27
Stem 0
Stem Tuber 0.28
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1005224 3300002074 Bacteria 1502
2 JGI24744J21845_10001644 3300002077 Bacteria 4473
3 JGI24034J26672_10019064 3300002239 Bacteria 1068
4 Ga0070676_10079965 3300005328 Bacteria 1980
5 Ga0070666_10014399 3300005335 Bacteria 5035
6 Ga0070666_10260472 3300005335 Bacteria 1229
7 Ga0070682_100018531 3300005337 Bacteria 4073
8 Ga0068868_100008196 3300005338 Bacteria 7474
9 Ga0070689_100006258 3300005340 Bacteria 8218
10 Ga0070691_10032458 3300005341 Bacteria 2454
11 Ga0070668_100016209 3300005347 Bacteria 5575
12 Ga0070668_100116210 3300005347 Bacteria 2133
13 Ga0070669_100003711 3300005353 Bacteria 11019
14 Ga0070671_100001317 3300005355 Bacteria 18655
15 Ga0070671_100030612 3300005355 Bacteria 4442
16 Ga0070671_100136301 3300005355 Bacteria 2070
17 Ga0070674_100004354 3300005356 Bacteria 8074
18 Ga0070688_100025338 3300005365 Bacteria 3511
19 Ga0070688_100923401 3300005365 Bacteria 689
20 Ga0070667_100001916 3300005367 Bacteria 18463
21 Ga0070667_100016338 3300005367 Bacteria 6140
22 Ga0070667_100019388 3300005367 Bacteria 5643
23 Ga0070667_100256470 3300005367 Bacteria 1565
24 Ga0070709_10179968 3300005434 Bacteria 1484
25 Ga0070714_101939161 3300005435 Bacteria 575
26 Ga0070713_100015149 3300005436 Bacteria 5749
27 Ga0070713_100491839 3300005436 Bacteria 1157
28 Ga0070710_10002834 3300005437 Bacteria 8267
29 Ga0070710_10226009 3300005437 Bacteria 1193
30 Ga0070701_10002730 3300005438 Bacteria 6848
31 Ga0070701_10473991 3300005438 Bacteria 808
32 Ga0070711_100008229 3300005439 Bacteria 6379
33 Ga0070711_101661250 3300005439 Bacteria 559
34 Ga0070705_100012785 3300005440 Bacteria 4278
35 Ga0070700_100006496 3300005441 Bacteria 6256
36 Ga0070694_100006976 3300005444 Bacteria 6865
37 Ga0070694_101909287 3300005444 Bacteria 507
38 Ga0070708_100485833 3300005445 Bacteria 1165
39 Ga0070678_100003516 3300005456 Bacteria 8738
40 Ga0068867_100008165 3300005459 Bacteria 7394
41 Ga0070685_10385748 3300005466 Bacteria 966
42 Ga0070699_100724957 3300005518 Bacteria 909
43 Ga0068853_100006315 3300005539 Bacteria 9404
44 Ga0070672_100146268 3300005543 Bacteria 1953
45 Ga0070686_100201307 3300005544 Bacteria 1428
46 Ga0070686_100264897 3300005544 Bacteria 1261
47 Ga0070695_100009055 3300005545 Bacteria 5918
48 Ga0070696_100004409 3300005546 Bacteria 9395
49 Ga0070693_100026206 3300005547 Bacteria 3146
50 Ga0070665_100004853 3300005548 Bacteria 13971
51 Ga0070665_100096029 3300005548 Bacteria 2969
52 Ga0070704_100003494 3300005549 Bacteria 9026
53 Ga0068855_100063501 3300005563 Bacteria 4310
54 Ga0068854_100022009 3300005578 Bacteria 4334
55 Ga0070702_100004707 3300005615 Bacteria 6262
56 Ga0068852_100043506 3300005616 Bacteria 3810
57 Ga0068859_100010827 3300005617 Bacteria 9178
58 Ga0068859_100101964 3300005617 Bacteria 2927
59 Ga0068866_10001362 3300005718 Bacteria 10579
60 Ga0068861_100006975 3300005719 Bacteria 7718
61 Ga0068861_100231660 3300005719 Bacteria 1567
62 Ga0068861_101624769 3300005719 Bacteria 637
63 Ga0068863_100133769 3300005841 Bacteria 2368
64 Ga0068863_100176357 3300005841 Bacteria 2051
65 Ga0068858_100008703 3300005842 Bacteria 9745
66 Ga0068858_101763990 3300005842 Bacteria 611
67 Ga0068860_100008854 3300005843 Bacteria 10027
68 Ga0068860_100746207 3300005843 Bacteria 990
69 Ga0068862_100011712 3300005844 Bacteria 7238
70 Ga0068862_100258862 3300005844 Bacteria 1588
71 Ga0081455_10017789 3300005937 Bacteria 6797
72 Ga0070717_10068227 3300006028 Bacteria 2960
73 Ga0075365_10081509 3300006038 Bacteria 2192
74 Ga0075368_10555142 3300006042 Bacteria 517
75 Ga0075363_100062579 3300006048 Bacteria 2007
76 Ga0075363_100067752 3300006048 Bacteria 1934
77 Ga0075364_10030215 3300006051 Bacteria 3476
78 Ga0075364_10157275 3300006051 Bacteria 1533
79 Ga0070715_10003280 3300006163 Bacteria 5113
80 Ga0070715_10659287 3300006163 Bacteria 620
81 Ga0070715_11087379 3300006163 Unclassified 503
82 Ga0070716_100269520 3300006173 Bacteria 1169
83 Ga0070712_100003259 3300006175 Bacteria 9994
84 Ga0070712_100116404 3300006175 Unclassified 2005
85 Ga0070712_100272697 3300006175 Bacteria 1360
86 Ga0070712_101033970 3300006175 Bacteria 712
87 Ga0075362_10127009 3300006177 Bacteria 1210
88 Ga0075367_10011975 3300006178 Bacteria 4607
89 Ga0075369_10020128 3300006186 Bacteria 2731
90 Ga0075369_10053890 3300006186 Bacteria 1746
91 Ga0075369_10177113 3300006186 Bacteria 980
92 Ga0075370_10002002 3300006353 Bacteria 9241
93 Ga0075370_10006879 3300006353 Bacteria 5754
94 Ga0075370_10304289 3300006353 Bacteria 948
95 Ga0075430_100016862 3300006846 Bacteria 6222
96 Ga0068865_100004752 3300006881 Bacteria 8210
97 Ga0097620_100010827 3300006931 Bacteria 9178
98 Ga0097620_100101961 3300006931 Bacteria 2927
99 Ga0105245_10017554 3300009098 Bacteria 6245
100 Ga0105247_10002819 3300009101 Bacteria 11598
101 Ga0114129_13113439 3300009147 Bacteria 542
102 Ga0105243_10011074 3300009148 Bacteria 6823
103 Ga0105242_10006080 3300009176 Bacteria 9309
104 Ga0105248_10012094 3300009177 Bacteria 9521
105 Ga0105248_11436054 3300009177 Bacteria 781
106 Ga0105237_10008274 3300009545 Bacteria 11297
107 Ga0105237_10059924 3300009545 Bacteria 3808
108 Ga0105249_10005486 3300009553 Bacteria 10957
109 Ga0105249_10009141 3300009553 Bacteria 8666
110 Ga0105249_11466838 3300009553 Bacteria 754
111 Ga0105033_105790 3300009986 Bacteria 1065
112 Ga0105239_10013252 3300010375 Bacteria 9164
113 Ga0105239_10014172 3300010375 Bacteria 8846
114 Ga0105239_11417968 3300010375 Bacteria 802
115 Ga0157369_10994670 3300013105 Bacteria 859
116 Ga0157374_10070436 3300013296 Bacteria 3295
117 Ga0157378_10019714 3300013297 Bacteria 5930
118 Ga0163162_10031827 3300013306 Bacteria 5234
119 Ga0163162_10220271 3300013306 Bacteria 2027
120 Ga0163162_10726208 3300013306 Bacteria 1114
121 Ga0157372_10049810 3300013307 Bacteria 4659
122 Ga0157375_10019823 3300013308 Bacteria 6129
123 Ga0163163_11879629 3300014325 Bacteria 659
124 Ga0157380_10004949 3300014326 Bacteria 9286
125 Ga0157379_10012584 3300014968 Bacteria 7391
126 Ga0157376_10191048 3300014969 Bacteria 1878
127 Ga0163161_10006553 3300017792 Bacteria 8058
128 Ga0213876_10000658 3300021384 Bacteria 24793
129 Ga0213876_10006077 3300021384 Bacteria 6599
130 Ga0213875_10039175 3300021388 Bacteria 2233
131 Ga0213875_10043393 3300021388 Bacteria 2112
132 Ga0224572_1040979 3300024225 Bacteria 872
133 Ga0209051_1000033 3300025303 Bacteria 380540
134 Ga0207692_10030329 3300025898 Bacteria 2578
135 Ga0207680_10027412 3300025903 Bacteria 3172
136 Ga0207680_10283131 3300025903 Bacteria 1152
137 Ga0207699_10010450 3300025906 Bacteria 4659
138 Ga0207645_10019473 3300025907 Bacteria 4449
139 Ga0207671_10021347 3300025914 Bacteria 4914
140 Ga0207671_10030211 3300025914 Bacteria 4042
141 Ga0207693_10008781 3300025915 Bacteria 8259
142 Ga0207693_10073718 3300025915 Bacteria 2672
143 Ga0207693_10089246 3300025915 Bacteria 2416
144 Ga0207663_10004075 3300025916 Bacteria 7247
145 Ga0207663_10207440 3300025916 Bacteria 1418
146 Ga0207681_10010429 3300025923 Bacteria 5687
147 Ga0207664_10027041 3300025929 Bacteria 4345
148 Ga0207664_10552148 3300025929 Bacteria 1033
149 Ga0207644_10032209 3300025931 Bacteria 3655
150 Ga0207644_10094888 3300025931 Bacteria 2230
151 Ga0207706_10024647 3300025933 Bacteria 5392
152 Ga0207686_10026334 3300025934 Bacteria 3391
153 Ga0207670_10013510 3300025936 Bacteria 4819
154 Ga0207669_10000690 3300025937 Bacteria 14571
155 Ga0207704_10002853 3300025938 Bacteria 7809
156 Ga0207691_10193375 3300025940 Bacteria 1774
157 Ga0207711_10005751 3300025941 Bacteria 10466
158 Ga0207711_11390957 3300025941 Bacteria 644
159 Ga0207689_10057725 3300025942 Bacteria 3192
160 Ga0207667_10136321 3300025949 Bacteria 2527
161 Ga0207712_10261378 3300025961 Bacteria 1404
162 Ga0207668_10014713 3300025972 Bacteria 4847
163 Ga0207640_10015915 3300025981 Bacteria 4364
164 Ga0207658_10015913 3300025986 Bacteria 5165
165 Ga0207658_10017018 3300025986 Bacteria 5005
166 Ga0207658_10030437 3300025986 Bacteria 3821
167 Ga0207658_10206774 3300025986 Bacteria 1642
168 Ga0207677_10030550 3300026023 Bacteria 3440
169 Ga0207703_11680053 3300026035 Bacteria 611
170 Ga0207639_10023292 3300026041 Bacteria 4470
171 Ga0207678_10013460 3300026067 Bacteria 7182
172 Ga0207708_10004990 3300026075 Bacteria 9774
173 Ga0207702_10687912 3300026078 Bacteria 1007
174 Ga0207641_10035470 3300026088 Bacteria 4155
175 Ga0207641_10782505 3300026088 Bacteria 943
176 Ga0207648_10001850 3300026089 Bacteria 23152
177 Ga0207675_100009645 3300026118 Bacteria 9035
178 Ga0207675_100298553 3300026118 Bacteria 1568
179 Ga0207675_101126153 3300026118 Bacteria 805
180 Ga0207683_10006176 3300026121 Bacteria 10266
181 Ga0268266_10002346 3300028379 Bacteria 20467
182 Ga0268266_10244570 3300028379 Bacteria 1657
183 Ga0268265_10280644 3300028380 Bacteria 1490
184 Ga0268265_11456154 3300028380 Bacteria 688
185 Ga0268264_10006389 3300028381 Bacteria 9930
186 Ga0268264_10738837 3300028381 Bacteria 980
187 Ga0265327_10007636 3300031251 Bacteria 8288
188 Ga0307413_10034705 3300031824 Bacteria 2886
189 Ga0307406_10082556 3300031901 Bacteria 2141
190 Ga0307409_100012864 3300031995 Bacteria 5354
191 Ga0307416_100578117 3300032002 Bacteria 1200
192 Ga0307415_100010253 3300032126 Bacteria 5298
193 Ga0307415_100478309 3300032126 Bacteria 1084
194 Ga0373959_0092351 3300034820 Bacteria 711
195 Ga0373943_0206721 3300035170 Bacteria 1089
196 Ga0373931_0002301 3300035691 Bacteria 8444
197 Ga0373947_0316320 3300035725 Bacteria 1043
198 Ga0373937_1019552 3300036401 Bacteria 776
199 Ga0373925_0001327 3300037068 Bacteria 21637
200 Ga0436364_0207895 3300037853 Bacteria 5819
201 Ga0436364_0468501 3300037853 Bacteria 4591
202 Ga0436364_0979927 3300037853 Bacteria 13391
203 Ga0436364_0981085 3300037853 Bacteria 3068
204 Ga0436365_0702776 3300039437 Bacteria 2939
205 Ga0436365_0826871 3300039437 Bacteria 77999
206 Ga0436365_1234540 3300039437 Bacteria 27598
207 Ga0439466_0197296 3300041411 Bacteria 612
208 Ga0439465_0064292 3300041413 Bacteria 1220
209 Ga0451843_1630061 3300041509 Bacteria 504
210 Ga0439431_0036857 3300041997 Bacteria 1233
211 Ga0439448_0057823 3300042005 Bacteria 1278
212 Ga0439434_0221236 3300042435 Bacteria 642
213 Ga0466969_0135200 3300044656 Bacteria 1142
214 Ga0466972_0078917 3300044658 Bacteria 1568
215 Ga0466972_0090714 3300044658 Bacteria 1449
216 Ga0466972_0314112 3300044658 Bacteria 732
217 Ga0466972_0483493 3300044658 Bacteria 582
218 Ga0466965_0005275 3300044683 Bacteria 5814
219 Ga0466965_0057452 3300044683 Bacteria 1939
220 Ga0466965_0141617 3300044683 Bacteria 1252
221 Ga0466965_0162585 3300044683 Bacteria 1171
222 Ga0466966_0377692 3300044684 Bacteria 851
223 Ga0466961_0007931 3300044693 Bacteria 6766
224 Ga0466961_0165773 3300044693 Bacteria 1375
225 Ga0466964_0072471 3300044706 Bacteria 1460
226 Ga0466971_0039511 3300044719 Bacteria 2117
227 Ga0466968_0164132 3300044735 Bacteria 1026
228 Ga0466968_0166151 3300044735 Bacteria 1020
229 Ga0466970_0012556 3300044765 Bacteria 4335
230 Ga0466970_0018847 3300044765 Bacteria 3574
231 Ga0466970_0037940 3300044765 Bacteria 2556
232 Ga0466970_0126202 3300044765 Bacteria 1403
233 Ga0466957_0044884 3300044842 Bacteria 2679
234 Ga0466957_0740127 3300044842 Bacteria 696
235 Ga0466960_0000284 3300044901 Bacteria 17649
236 Ga0466960_0548384 3300044901 Bacteria 682
237 Ga0466960_0723711 3300044901 Bacteria 598
238 Ga0466959_0030216 3300045049 Bacteria 4012
239 Ga0466959_0065668 3300045049 Bacteria 2633
240 Ga0466967_0092315 3300045976 Bacteria 2753
241 Ga0466967_0181346 3300045976 Bacteria 1986
242 Ga0466967_0610356 3300045976 Bacteria 1077
243 Ga0466967_1645562 3300045976 Bacteria 639
244 Ga0495603_0190127 3300046455 Bacteria 1187
245 Ga0495629_0167766 3300046459 Bacteria 1524
246 Ga0495641_0156680 3300046461 Bacteria 1018
247 Ga0495580_0845371 3300046472 Bacteria 591
248 Ga0495639_0310729 3300046475 Bacteria 787
249 Ga0495607_0249020 3300046501 Bacteria 856
250 Ga0495630_0294531 3300046517 Bacteria 1240
251 Ga0495665_0047294 3300046531 Bacteria 2282
252 Ga0495640_0200441 3300046533 Bacteria 1265
253 Ga0495634_0234430 3300046642 Bacteria 1128
254 Ga0495658_0024765 3300046683 Bacteria 3201
255 Ga0495624_0371654 3300046690 Bacteria 859
256 Ga0495581_0017890 3300047315 Bacteria 4119
257 Ga0495674_0095677 3300047319 Bacteria 2532
258 Ga0495676_0382639 3300047321 Bacteria 936
259 Ga0495683_0000620 3300047323 Bacteria 26506
260 Ga0495593_0099521 3300047673 Bacteria 1492
261 Ga0495614_0370740 3300048089 Bacteria 669
262 Ga0496100_0000090 3300048903 Bacteria 51781
263 Ga0496100_0326579 3300048903 Bacteria 1154
264 Ga0496101_0000409 3300048904 Bacteria 27808
265 Ga0496101_0001777 3300048904 Bacteria 12957
266 Ga0496101_0184179 3300048904 Bacteria 1609
267 Ga0496102_0023781 3300048905 Bacteria 5444
268 Ga0496102_0029975 3300048905 Bacteria 4868
269 Ga0496102_0479138 3300048905 Bacteria 1165
270 Ga0496102_1596943 3300048905 Bacteria 570
271 Ga0496103_0001655 3300048906 Bacteria 14592
272 Ga0496103_0002004 3300048906 Bacteria 13126
273 Ga0496104_0161977 3300048907 Bacteria 2146
274 Ga0496104_0214017 3300048907 Bacteria 1839
275 Ga0496105_0143159 3300048908 Bacteria 1967
276 Ga0496106_0004805 3300048909 Bacteria 9996
277 Ga0496106_1335545 3300048909 Bacteria 556
278 Ga0496107_0001535 3300048910 Bacteria 14344
279 Ga0496107_0002668 3300048910 Bacteria 11683
280 Ga0496108_0005138 3300048911 Bacteria 10580
281 Ga0496108_0160827 3300048911 Bacteria 1941
282 Ga0496109_0000134 3300048912 Bacteria 75662
283 Ga0496109_1154956 3300048912 Bacteria 711
284 Ga0496109_1241920 3300048912 Bacteria 681
285 Ga0496110_0066096 3300048913 Bacteria 3197
286 Ga0496110_0985373 3300048913 Bacteria 750
287 Ga0496110_1117595 3300048913 Bacteria 696
288 Ga0496111_0002609 3300048914 Bacteria 10915
289 Ga0496111_0300345 3300048914 Bacteria 1190
290 Ga0496112_0309252 3300048915 Bacteria 1525
291 Ga0496112_1093300 3300048915 Bacteria 716
292 Ga0496113_0041312 3300048916 Bacteria 3403
293 Ga0496113_0137219 3300048916 Bacteria 1922
294 Ga0496113_1128882 3300048916 Bacteria 614
295 Ga0496114_0003469 3300048917 Bacteria 12104
296 Ga0496114_0003623 3300048917 Bacteria 11877
297 Ga0496115_0002731 3300048918 Bacteria 12677
298 Ga0496115_0027493 3300048918 Bacteria 4450
299 Ga0496115_1136339 3300048918 Bacteria 590
300 Ga0496116_0008260 3300048919 Bacteria 9060
301 Ga0496117_0036655 3300048920 Bacteria 3665
302 Ga0496118_0019274 3300048921 Bacteria 6105
303 Ga0496119_0050766 3300048922 Bacteria 2553
304 Ga0496120_0022565 3300048923 Bacteria 3958
305 Ga0496120_0054068 3300048923 Bacteria 2278
306 Ga0496121_0000004 3300048924 Bacteria 1139011
307 Ga0496122_0000138 3300048925 Bacteria 169434
308 Ga0496122_0002933 3300048925 Bacteria 23264
309 Ga0496123_0009161 3300048926 Bacteria 8951
310 Ga0496123_0013559 3300048926 Bacteria 6825
311 Ga0496124_0000012 3300048927 Bacteria 512581
312 Ga0496124_0759494 3300048927 Bacteria 606
313 Ga0496125_0000003 3300048928 Bacteria 1189767
314 Ga0496126_0000001 3300048929 Bacteria 1139011
315 Ga0496126_0004875 3300048929 Bacteria 15711
316 Ga0496126_0154173 3300048929 Bacteria 1967
317 Ga0496126_0339285 3300048929 Bacteria 1231
318 Ga0496126_0531538 3300048929 Bacteria 936
319 Ga0501032_0585810 3300049569 Bacteria 710
320 Ga0501034_0147112 3300049571 Bacteria 2333
321 Ga0501034_0352797 3300049571 Bacteria 1399
322 Ga0501036_1427480 3300049572 Bacteria 561
323 Ga0501047_1079828 3300049581 Bacteria 616
324 Ga0501068_0494818 3300049584 Bacteria 793
325 Ga0501070_0438453 3300049586 Bacteria 1054
326 Ga0501070_1494544 3300049586 Bacteria 511
327 Ga0501044_0455180 3300049823 Bacteria 1186
328 nmdc:mga03683_208821_c1 3300050489 Bacteria 898
329 nmdc:mga03n38_131463_c1 3300050490 Bacteria 1241
330 nmdc:mga03n38_211131_c1 3300050490 Bacteria 1009
331 nmdc:mga03n38_252708_c1 3300050490 Bacteria 932
332 nmdc:mga03n38_63730_c1 3300050490 Bacteria 1685
333 nmdc:mga00v17_50571_c1 3300050491 Bacteria 2526
334 nmdc:mga00v17_655979_c1 3300050491 Bacteria 674
335 nmdc:mga00v17_9190_c1 3300050491 Bacteria 5339
336 nmdc:mga00v17_93620_c1 3300050491 Bacteria 1890
337 nmdc:mga0yw44_65384_c1 3300050492 Bacteria 2241
338 nmdc:mga06z11_102969_c1 3300050494 Bacteria 1569
339 nmdc:mga06z11_330678_c1 3300050494 Bacteria 910
340 nmdc:mga07m45_3014_c1 3300050496 Bacteria 8025
341 nmdc:mga07m45_602100_c1 3300050496 Bacteria 635
342 nmdc:mga0qj67_35013_c1 3300050509 Bacteria 3924
343 nmdc:mga0sz30_1779_c1 3300050516 Bacteria 7651
344 nmdc:mga0sz30_4943_c1 3300050516 Bacteria 4045
345 nmdc:mga0sz30_5181_c1 3300050516 Bacteria 4774
346 nmdc:mga0sz30_60551_c1 3300050516 Bacteria 1616
347 Ga0500642_0120115 3300053130 Bacteria 1229
348 Ga0500652_065546 3300053131 Bacteria 1500
349 Ga0500627_0029071 3300053158 Bacteria 2302
350 Ga0466962_0013152 3300061719 Bacteria 3981
351 Ga0466962_0067100 3300061719 Bacteria 1713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0585810 Ga0501032_0585810_250_642 113
2 3300049572 Ga0501036_1427480 Ga0501036_1427480_61_453 113
3 3300005436 Ga0070713_100015149 Ga0070713_1000151494 115
4 3300005437 Ga0070710_10002834 Ga0070710_100028347 115
5 iso_pu_bacteria 2795385470 2795786325 117
6 iso_pu_bacteria 2842134933 2842139545 117
7 iso_pu_bacteria 2899370129 2899375900 117
8 iso_pu_bacteria 2929212328 2929217824 117
9 iso_pu_bacteria 2643221692 2644516458 119
10 iso_pu_bacteria 2919713450 2919718657 119
11 3300005518 Ga0070699_100724957 Ga0070699_1007249571 120
12 3300031824 Ga0307413_10034705 Ga0307413_100347052 120
13 3300031901 Ga0307406_10082556 Ga0307406_100825564 120
14 3300031995 Ga0307409_100012864 Ga0307409_1000128642 120
15 3300032002 Ga0307416_100578117 Ga0307416_1005781172 120
16 3300032126 Ga0307415_100010253 Ga0307415_1000102537 120
17 3300041413 Ga0439465_0064292 Ga0439465_0064292_524_886 120
18 3300041509 Ga0451843_1630061 Ga0451843_1630061_107_469 120
19 3300044658 Ga0466972_0078917 Ga0466972_0078917_1038_1406 120
20 3300044658 Ga0466972_0483493 Ga0466972_0483493_205_567 120
21 3300044735 Ga0466968_0166151 Ga0466968_0166151_503_865 120
22 3300044765 Ga0466970_0012556 Ga0466970_0012556_485_847 120
23 3300044765 Ga0466970_0018847 Ga0466970_0018847_637_999 120
24 3300044765 Ga0466970_0037940 Ga0466970_0037940_276_644 120
25 3300044842 Ga0466957_0740127 Ga0466957_0740127_45_407 120
26 3300044901 Ga0466960_0723711 Ga0466960_0723711_156_518 120
27 3300045976 Ga0466967_0181346 Ga0466967_0181346_268_630 120
28 3300045976 Ga0466967_0610356 Ga0466967_0610356_598_960 120
29 3300048903 Ga0496100_0326579 Ga0496100_0326579_577_939 120
30 3300048904 Ga0496101_0184179 Ga0496101_0184179_455_817 120
31 3300048915 Ga0496112_0309252 Ga0496112_0309252_556_918 120
32 3300048916 Ga0496113_0137219 Ga0496113_0137219_845_1207 120
33 3300048918 Ga0496115_1136339 Ga0496115_1136339_85_447 120
34 3300048923 Ga0496120_0022565 Ga0496120_0022565_2914_3276 120
35 3300048925 Ga0496122_0002933 Ga0496122_0002933_20553_20915 120
36 3300048926 Ga0496123_0009161 Ga0496123_0009161_512_874 120
37 3300048927 Ga0496124_0759494 Ga0496124_0759494_62_424 120
38 3300048929 Ga0496126_0154173 Ga0496126_0154173_698_1060 120
39 3300049571 Ga0501034_0352797 Ga0501034_0352797_540_902 120
40 3300049584 Ga0501068_0494818 Ga0501068_0494818_370_732 120
41 3300049586 Ga0501070_0438453 Ga0501070_0438453_248_610 120
42 3300049586 Ga0501070_1494544 Ga0501070_1494544_71_433 120
43 3300002074 JGI24748J21848_1005224 JGI24748J21848_10052242 121
44 3300002077 JGI24744J21845_10001644 JGI24744J21845_100016444 121
45 3300002239 JGI24034J26672_10019064 JGI24034J26672_100190642 121
46 3300005328 Ga0070676_10079965 Ga0070676_100799652 121
47 3300005335 Ga0070666_10014399 Ga0070666_100143992 121
48 3300005335 Ga0070666_10260472 Ga0070666_102604722 121
49 3300005337 Ga0070682_100018531 Ga0070682_1000185314 121
50 3300005338 Ga0068868_100008196 Ga0068868_1000081964 121
51 3300005340 Ga0070689_100006258 Ga0070689_1000062585 121
52 3300005341 Ga0070691_10032458 Ga0070691_100324582 121
53 3300005347 Ga0070668_100016209 Ga0070668_1000162092 121
54 3300005347 Ga0070668_100116210 Ga0070668_1001162102 121
55 3300005353 Ga0070669_100003711 Ga0070669_1000037114 121
56 3300005355 Ga0070671_100001317 Ga0070671_10000131719 121
57 3300005355 Ga0070671_100030612 Ga0070671_1000306122 121
58 3300005355 Ga0070671_100136301 Ga0070671_1001363014 121
59 3300005356 Ga0070674_100004354 Ga0070674_1000043546 121
60 3300005365 Ga0070688_100025338 Ga0070688_1000253382 121
61 3300005365 Ga0070688_100923401 Ga0070688_1009234012 121
62 3300005367 Ga0070667_100001916 Ga0070667_1000019162 121
63 3300005367 Ga0070667_100016338 Ga0070667_1000163382 121
64 3300005367 Ga0070667_100019388 Ga0070667_1000193883 121
65 3300005367 Ga0070667_100256470 Ga0070667_1002564702 121
66 3300005434 Ga0070709_10179968 Ga0070709_101799682 121
67 3300005435 Ga0070714_101939161 Ga0070714_1019391611 121
68 3300005436 Ga0070713_100491839 Ga0070713_1004918392 121
69 3300005437 Ga0070710_10226009 Ga0070710_102260092 121
70 3300005438 Ga0070701_10002730 Ga0070701_100027304 121
71 3300005438 Ga0070701_10473991 Ga0070701_104739911 121
72 3300005439 Ga0070711_100008229 Ga0070711_1000082295 121
73 3300005439 Ga0070711_101661250 Ga0070711_1016612501 121
74 3300005440 Ga0070705_100012785 Ga0070705_1000127856 121
75 3300005441 Ga0070700_100006496 Ga0070700_1000064967 121
76 3300005444 Ga0070694_100006976 Ga0070694_1000069765 121
77 3300005444 Ga0070694_101909287 Ga0070694_1019092871 121
78 3300005445 Ga0070708_100485833 Ga0070708_1004858332 121
79 3300005456 Ga0070678_100003516 Ga0070678_1000035166 121
80 3300005459 Ga0068867_100008165 Ga0068867_1000081655 121
81 3300005466 Ga0070685_10385748 Ga0070685_103857481 121
82 3300005539 Ga0068853_100006315 Ga0068853_1000063154 121
83 3300005543 Ga0070672_100146268 Ga0070672_1001462682 121
84 3300005544 Ga0070686_100201307 Ga0070686_1002013072 121
85 3300005544 Ga0070686_100264897 Ga0070686_1002648972 121
86 3300005545 Ga0070695_100009055 Ga0070695_1000090553 121
87 3300005546 Ga0070696_100004409 Ga0070696_1000044097 121
88 3300005547 Ga0070693_100026206 Ga0070693_1000262062 121
89 3300005548 Ga0070665_100004853 Ga0070665_1000048533 121
90 3300005548 Ga0070665_100096029 Ga0070665_1000960293 121
91 3300005549 Ga0070704_100003494 Ga0070704_1000034944 121
92 3300005563 Ga0068855_100063501 Ga0068855_1000635012 121
93 3300005578 Ga0068854_100022009 Ga0068854_1000220092 121
94 3300005615 Ga0070702_100004707 Ga0070702_1000047072 121
95 3300005616 Ga0068852_100043506 Ga0068852_1000435066 121
96 3300005617 Ga0068859_100010827 Ga0068859_1000108277 121
97 3300005617 Ga0068859_100101964 Ga0068859_1001019642 121
98 3300005718 Ga0068866_10001362 Ga0068866_100013625 121
99 3300005719 Ga0068861_100006975 Ga0068861_1000069755 121
100 3300005719 Ga0068861_100231660 Ga0068861_1002316602 121
101 3300005719 Ga0068861_101624769 Ga0068861_1016247691 121
102 3300005841 Ga0068863_100133769 Ga0068863_1001337693 121
103 3300005841 Ga0068863_100176357 Ga0068863_1001763573 121
104 3300005842 Ga0068858_100008703 Ga0068858_1000087036 121
105 3300005842 Ga0068858_101763990 Ga0068858_1017639901 121
106 3300005843 Ga0068860_100008854 Ga0068860_1000088544 121
107 3300005843 Ga0068860_100746207 Ga0068860_1007462072 121
108 3300005844 Ga0068862_100011712 Ga0068862_1000117125 121
109 3300005844 Ga0068862_100258862 Ga0068862_1002588622 121
110 3300005937 Ga0081455_10017789 Ga0081455_100177892 121
111 3300006028 Ga0070717_10068227 Ga0070717_100682272 121
112 3300006038 Ga0075365_10081509 Ga0075365_100815092 121
113 3300006042 Ga0075368_10555142 Ga0075368_105551422 121
114 3300006048 Ga0075363_100062579 Ga0075363_1000625793 121
115 3300006048 Ga0075363_100067752 Ga0075363_1000677522 121
116 3300006051 Ga0075364_10030215 Ga0075364_100302151 121
117 3300006051 Ga0075364_10157275 Ga0075364_101572752 121
118 3300006163 Ga0070715_10003280 Ga0070715_100032802 121
119 3300006163 Ga0070715_10659287 Ga0070715_106592872 121
120 3300006163 Ga0070715_11087379 Ga0070715_110873791 121
121 3300006173 Ga0070716_100269520 Ga0070716_1002695201 121
122 3300006175 Ga0070712_100003259 Ga0070712_10000325919 121
123 3300006175 Ga0070712_100116404 Ga0070712_1001164041 121
124 3300006175 Ga0070712_100272697 Ga0070712_1002726973 121
125 3300006175 Ga0070712_101033970 Ga0070712_1010339701 121
126 3300006177 Ga0075362_10127009 Ga0075362_101270092 121
127 3300006178 Ga0075367_10011975 Ga0075367_100119754 121
128 3300006186 Ga0075369_10020128 Ga0075369_100201281 121
129 3300006186 Ga0075369_10053890 Ga0075369_100538903 121
130 3300006186 Ga0075369_10177113 Ga0075369_101771132 121
131 3300006353 Ga0075370_10002002 Ga0075370_100020025 121
132 3300006353 Ga0075370_10006879 Ga0075370_100068792 121
133 3300006353 Ga0075370_10304289 Ga0075370_103042892 121
134 3300006846 Ga0075430_100016862 Ga0075430_1000168622 121
135 3300006881 Ga0068865_100004752 Ga0068865_1000047525 121
136 3300006931 Ga0097620_100010827 Ga0097620_1000108277 121
137 3300006931 Ga0097620_100101961 Ga0097620_1001019612 121
138 3300009098 Ga0105245_10017554 Ga0105245_100175548 121
139 3300009101 Ga0105247_10002819 Ga0105247_100028197 121
140 3300009147 Ga0114129_13113439 Ga0114129_131134391 121
141 3300009148 Ga0105243_10011074 Ga0105243_100110742 121
142 3300009176 Ga0105242_10006080 Ga0105242_100060807 121
143 3300009177 Ga0105248_10012094 Ga0105248_100120948 121
144 3300009177 Ga0105248_11436054 Ga0105248_114360542 121
145 3300009545 Ga0105237_10008274 Ga0105237_100082745 121
146 3300009545 Ga0105237_10059924 Ga0105237_100599242 121
147 3300009553 Ga0105249_10005486 Ga0105249_100054862 121
148 3300009553 Ga0105249_10009141 Ga0105249_100091415 121
149 3300009553 Ga0105249_11466838 Ga0105249_114668381 121
150 3300009986 Ga0105033_105790 Ga0105033_1057901 121
151 3300010375 Ga0105239_10013252 Ga0105239_100132528 121
152 3300010375 Ga0105239_10014172 Ga0105239_1001417211 121
153 3300010375 Ga0105239_11417968 Ga0105239_114179682 121
154 3300013105 Ga0157369_10994670 Ga0157369_109946702 121
155 3300013296 Ga0157374_10070436 Ga0157374_100704362 121
156 3300013297 Ga0157378_10019714 Ga0157378_100197143 121
157 3300013306 Ga0163162_10031827 Ga0163162_100318272 121
158 3300013306 Ga0163162_10220271 Ga0163162_102202712 121
159 3300013306 Ga0163162_10726208 Ga0163162_107262082 121
160 3300013307 Ga0157372_10049810 Ga0157372_100498103 121
161 3300013308 Ga0157375_10019823 Ga0157375_100198238 121
162 3300014325 Ga0163163_11879629 Ga0163163_118796292 121
163 3300014326 Ga0157380_10004949 Ga0157380_100049495 121
164 3300014968 Ga0157379_10012584 Ga0157379_100125842 121
165 3300014969 Ga0157376_10191048 Ga0157376_101910482 121
166 3300017792 Ga0163161_10006553 Ga0163161_100065535 121
167 3300021384 Ga0213876_10000658 Ga0213876_1000065813 121
168 3300021384 Ga0213876_10006077 Ga0213876_100060772 121
169 3300021388 Ga0213875_10039175 Ga0213875_100391753 121
170 3300021388 Ga0213875_10043393 Ga0213875_100433933 121
171 3300024225 Ga0224572_1040979 Ga0224572_10409791 121
172 3300025303 Ga0209051_1000033 Ga0209051_1000033259 121
173 3300025898 Ga0207692_10030329 Ga0207692_100303292 121
174 3300025903 Ga0207680_10027412 Ga0207680_100274122 121
175 3300025903 Ga0207680_10283131 Ga0207680_102831312 121
176 3300025906 Ga0207699_10010450 Ga0207699_100104502 121
177 3300025907 Ga0207645_10019473 Ga0207645_100194732 121
178 3300025914 Ga0207671_10021347 Ga0207671_100213472 121
179 3300025914 Ga0207671_10030211 Ga0207671_100302113 121
180 3300025915 Ga0207693_10008781 Ga0207693_100087815 121
181 3300025915 Ga0207693_10073718 Ga0207693_100737182 121
182 3300025915 Ga0207693_10089246 Ga0207693_100892461 121
183 3300025916 Ga0207663_10004075 Ga0207663_100040754 121
184 3300025916 Ga0207663_10207440 Ga0207663_102074402 121
185 3300025923 Ga0207681_10010429 Ga0207681_100104297 121
186 3300025929 Ga0207664_10027041 Ga0207664_100270411 121
187 3300025929 Ga0207664_10552148 Ga0207664_105521482 121
188 3300025931 Ga0207644_10032209 Ga0207644_100322097 121
189 3300025931 Ga0207644_10094888 Ga0207644_100948882 121
190 3300025933 Ga0207706_10024647 Ga0207706_100246473 121
191 3300025934 Ga0207686_10026334 Ga0207686_100263344 121
192 3300025936 Ga0207670_10013510 Ga0207670_100135104 121
193 3300025937 Ga0207669_10000690 Ga0207669_1000069025 121
194 3300025938 Ga0207704_10002853 Ga0207704_100028535 121
195 3300025940 Ga0207691_10193375 Ga0207691_101933752 121
196 3300025941 Ga0207711_10005751 Ga0207711_1000575119 121
197 3300025941 Ga0207711_11390957 Ga0207711_113909571 121
198 3300025942 Ga0207689_10057725 Ga0207689_100577252 121
199 3300025949 Ga0207667_10136321 Ga0207667_101363212 121
200 3300025961 Ga0207712_10261378 Ga0207712_102613782 121
201 3300025972 Ga0207668_10014713 Ga0207668_100147132 121
202 3300025981 Ga0207640_10015915 Ga0207640_100159154 121
203 3300025986 Ga0207658_10015913 Ga0207658_100159136 121
204 3300025986 Ga0207658_10017018 Ga0207658_100170186 121
205 3300025986 Ga0207658_10030437 Ga0207658_100304372 121
206 3300025986 Ga0207658_10206774 Ga0207658_102067742 121
207 3300026023 Ga0207677_10030550 Ga0207677_100305504 121
208 3300026035 Ga0207703_11680053 Ga0207703_116800531 121
209 3300026041 Ga0207639_10023292 Ga0207639_100232925 121
210 3300026067 Ga0207678_10013460 Ga0207678_100134603 121
211 3300026075 Ga0207708_10004990 Ga0207708_100049908 121
212 3300026078 Ga0207702_10687912 Ga0207702_106879122 121
213 3300026088 Ga0207641_10035470 Ga0207641_100354706 121
214 3300026088 Ga0207641_10782505 Ga0207641_107825053 121
215 3300026089 Ga0207648_10001850 Ga0207648_100018508 121
216 3300026118 Ga0207675_100009645 Ga0207675_1000096457 121
217 3300026118 Ga0207675_100298553 Ga0207675_1002985532 121
218 3300026118 Ga0207675_101126153 Ga0207675_1011261532 121
219 3300026121 Ga0207683_10006176 Ga0207683_100061766 121
220 3300028379 Ga0268266_10002346 Ga0268266_1000234623 121
221 3300028379 Ga0268266_10244570 Ga0268266_102445702 121
222 3300028380 Ga0268265_10280644 Ga0268265_102806442 121
223 3300028380 Ga0268265_11456154 Ga0268265_114561541 121
224 3300028381 Ga0268264_10006389 Ga0268264_100063895 121
225 3300028381 Ga0268264_10738837 Ga0268264_107388372 121
226 3300031251 Ga0265327_10007636 Ga0265327_100076362 121
227 3300032126 Ga0307415_100478309 Ga0307415_1004783092 121
228 3300034820 Ga0373959_0092351 Ga0373959_0092351_329_694 121
229 3300035170 Ga0373943_0206721 Ga0373943_0206721_498_863 121
230 3300035691 Ga0373931_0002301 Ga0373931_0002301_3686_4051 121
231 3300035725 Ga0373947_0316320 Ga0373947_0316320_335_700 121
232 3300036401 Ga0373937_1019552 Ga0373937_1019552_225_590 121
233 3300037068 Ga0373925_0001327 Ga0373925_0001327_5236_5622 121
234 3300037853 Ga0436364_0207895 Ga0436364_0207895_1964_2338 121
235 3300037853 Ga0436364_0468501 Ga0436364_0468501_2864_3274 121
236 3300037853 Ga0436364_0979927 Ga0436364_0979927_12837_13211 121
237 3300037853 Ga0436364_0981085 Ga0436364_0981085_909_1289 121
238 3300039437 Ga0436365_0702776 Ga0436365_0702776_2230_2604 121
239 3300039437 Ga0436365_0826871 Ga0436365_0826871_11021_11431 121
240 3300039437 Ga0436365_1234540 Ga0436365_1234540_14060_14470 121
241 3300041411 Ga0439466_0197296 Ga0439466_0197296_193_558 121
242 3300041997 Ga0439431_0036857 Ga0439431_0036857_422_787 121
243 3300042005 Ga0439448_0057823 Ga0439448_0057823_690_1055 121
244 3300042435 Ga0439434_0221236 Ga0439434_0221236_208_573 121
245 3300044656 Ga0466969_0135200 Ga0466969_0135200_525_890 121
246 3300044658 Ga0466972_0090714 Ga0466972_0090714_766_1131 121
247 3300044658 Ga0466972_0314112 Ga0466972_0314112_71_436 121
248 3300044683 Ga0466965_0005275 Ga0466965_0005275_4894_5259 121
249 3300044683 Ga0466965_0057452 Ga0466965_0057452_542_907 121
250 3300044683 Ga0466965_0141617 Ga0466965_0141617_509_874 121
251 3300044683 Ga0466965_0162585 Ga0466965_0162585_752_1117 121
252 3300044684 Ga0466966_0377692 Ga0466966_0377692_203_568 121
253 3300044693 Ga0466961_0007931 Ga0466961_0007931_2649_3050 121
254 3300044693 Ga0466961_0165773 Ga0466961_0165773_380_745 121
255 3300044706 Ga0466964_0072471 Ga0466964_0072471_468_833 121
256 3300044719 Ga0466971_0039511 Ga0466971_0039511_47_412 121
257 3300044735 Ga0466968_0164132 Ga0466968_0164132_612_977 121
258 3300044765 Ga0466970_0126202 Ga0466970_0126202_128_493 121
259 3300044842 Ga0466957_0044884 Ga0466957_0044884_1837_2202 121
260 3300044901 Ga0466960_0000284 Ga0466960_0000284_5368_5733 121
261 3300044901 Ga0466960_0548384 Ga0466960_0548384_209_574 121
262 3300045049 Ga0466959_0030216 Ga0466959_0030216_2026_2391 121
263 3300045049 Ga0466959_0065668 Ga0466959_0065668_1781_2182 121
264 3300045976 Ga0466967_0092315 Ga0466967_0092315_1788_2153 121
265 3300045976 Ga0466967_1645562 Ga0466967_1645562_260_625 121
266 3300046455 Ga0495603_0190127 Ga0495603_0190127_316_681 121
267 3300046459 Ga0495629_0167766 Ga0495629_0167766_858_1223 121
268 3300046461 Ga0495641_0156680 Ga0495641_0156680_197_562 121
269 3300046472 Ga0495580_0845371 Ga0495580_0845371_166_531 121
270 3300046475 Ga0495639_0310729 Ga0495639_0310729_326_691 121
271 3300046501 Ga0495607_0249020 Ga0495607_0249020_30_455 121
272 3300046517 Ga0495630_0294531 Ga0495630_0294531_606_971 121
273 3300046531 Ga0495665_0047294 Ga0495665_0047294_960_1325 121
274 3300046533 Ga0495640_0200441 Ga0495640_0200441_316_681 121
275 3300046642 Ga0495634_0234430 Ga0495634_0234430_127_492 121
276 3300046683 Ga0495658_0024765 Ga0495658_0024765_2606_2971 121
277 3300046690 Ga0495624_0371654 Ga0495624_0371654_277_642 121
278 3300047315 Ga0495581_0017890 Ga0495581_0017890_1278_1643 121
279 3300047319 Ga0495674_0095677 Ga0495674_0095677_602_967 121
280 3300047321 Ga0495676_0382639 Ga0495676_0382639_384_749 121
281 3300047323 Ga0495683_0000620 Ga0495683_0000620_17395_17820 121
282 3300047673 Ga0495593_0099521 Ga0495593_0099521_671_1036 121
283 3300048089 Ga0495614_0370740 Ga0495614_0370740_30_395 121
284 3300048903 Ga0496100_0000090 Ga0496100_0000090_17759_18124 121
285 3300048904 Ga0496101_0000409 Ga0496101_0000409_9659_10024 121
286 3300048904 Ga0496101_0001777 Ga0496101_0001777_7707_8072 121
287 3300048905 Ga0496102_0023781 Ga0496102_0023781_2231_2596 121
288 3300048905 Ga0496102_0029975 Ga0496102_0029975_595_960 121
289 3300048905 Ga0496102_0479138 Ga0496102_0479138_575_940 121
290 3300048905 Ga0496102_1596943 Ga0496102_1596943_131_496 121
291 3300048906 Ga0496103_0001655 Ga0496103_0001655_6605_6970 121
292 3300048906 Ga0496103_0002004 Ga0496103_0002004_7661_8026 121
293 3300048907 Ga0496104_0161977 Ga0496104_0161977_34_399 121
294 3300048907 Ga0496104_0214017 Ga0496104_0214017_1392_1757 121
295 3300048908 Ga0496105_0143159 Ga0496105_0143159_408_773 121
296 3300048909 Ga0496106_0004805 Ga0496106_0004805_6296_6661 121
297 3300048909 Ga0496106_1335545 Ga0496106_1335545_150_515 121
298 3300048910 Ga0496107_0001535 Ga0496107_0001535_8876_9241 121
299 3300048910 Ga0496107_0002668 Ga0496107_0002668_651_1016 121
300 3300048911 Ga0496108_0005138 Ga0496108_0005138_6927_7292 121
301 3300048911 Ga0496108_0160827 Ga0496108_0160827_178_543 121
302 3300048912 Ga0496109_0000134 Ga0496109_0000134_57513_57878 121
303 3300048912 Ga0496109_1154956 Ga0496109_1154956_237_602 121
304 3300048912 Ga0496109_1241920 Ga0496109_1241920_199_564 121
305 3300048913 Ga0496110_0066096 Ga0496110_0066096_2132_2497 121
306 3300048913 Ga0496110_0985373 Ga0496110_0985373_68_433 121
307 3300048913 Ga0496110_1117595 Ga0496110_1117595_126_491 121
308 3300048914 Ga0496111_0002609 Ga0496111_0002609_7209_7574 121
309 3300048914 Ga0496111_0300345 Ga0496111_0300345_568_933 121
310 3300048915 Ga0496112_1093300 Ga0496112_1093300_64_429 121
311 3300048916 Ga0496113_0041312 Ga0496113_0041312_2865_3230 121
312 3300048916 Ga0496113_1128882 Ga0496113_1128882_95_505 121
313 3300048917 Ga0496114_0003469 Ga0496114_0003469_8398_8763 121
314 3300048917 Ga0496114_0003623 Ga0496114_0003623_5116_5481 121
315 3300048918 Ga0496115_0002731 Ga0496115_0002731_8014_8379 121
316 3300048918 Ga0496115_0027493 Ga0496115_0027493_3575_3940 121
317 3300048919 Ga0496116_0008260 Ga0496116_0008260_3925_4290 121
318 3300048920 Ga0496117_0036655 Ga0496117_0036655_2108_2473 121
319 3300048921 Ga0496118_0019274 Ga0496118_0019274_926_1291 121
320 3300048922 Ga0496119_0050766 Ga0496119_0050766_415_780 121
321 3300048923 Ga0496120_0054068 Ga0496120_0054068_1790_2155 121
322 3300048924 Ga0496121_0000004 Ga0496121_0000004_525111_525476 121
323 3300048925 Ga0496122_0000138 Ga0496122_0000138_27094_27459 121
324 3300048926 Ga0496123_0013559 Ga0496123_0013559_3626_3991 121
325 3300048927 Ga0496124_0000012 Ga0496124_0000012_249904_250269 121
326 3300048928 Ga0496125_0000003 Ga0496125_0000003_664292_664657 121
327 3300048929 Ga0496126_0000001 Ga0496126_0000001_525111_525476 121
328 3300048929 Ga0496126_0004875 Ga0496126_0004875_9940_10350 121
329 3300048929 Ga0496126_0339285 Ga0496126_0339285_481_885 121
330 3300048929 Ga0496126_0531538 Ga0496126_0531538_383_748 121
331 3300049571 Ga0501034_0147112 Ga0501034_0147112_1523_1888 121
332 3300049581 Ga0501047_1079828 Ga0501047_1079828_218_583 121
333 3300049823 Ga0501044_0455180 Ga0501044_0455180_96_506 121
334 3300050489 nmdc:mga03683_208821_c1 nmdc:mga03683_208821_c1_343_708 121
335 3300050490 nmdc:mga03n38_131463_c1 nmdc:mga03n38_131463_c1_52_417 121
336 3300050490 nmdc:mga03n38_211131_c1 nmdc:mga03n38_211131_c1_410_775 121
337 3300050490 nmdc:mga03n38_252708_c1 nmdc:mga03n38_252708_c1_502_912 121
338 3300050490 nmdc:mga03n38_63730_c1 nmdc:mga03n38_63730_c1_1125_1490 121
339 3300050491 nmdc:mga00v17_50571_c1 nmdc:mga00v17_50571_c1_1308_1673 121
340 3300050491 nmdc:mga00v17_655979_c1 nmdc:mga00v17_655979_c1_206_571 121
341 3300050491 nmdc:mga00v17_9190_c1 nmdc:mga00v17_9190_c1_1586_1951 121
342 3300050491 nmdc:mga00v17_93620_c1 nmdc:mga00v17_93620_c1_312_722 121
343 3300050492 nmdc:mga0yw44_65384_c1 nmdc:mga0yw44_65384_c1_270_635 121
344 3300050494 nmdc:mga06z11_102969_c1 nmdc:mga06z11_102969_c1_1159_1524 121
345 3300050494 nmdc:mga06z11_330678_c1 nmdc:mga06z11_330678_c1_439_804 121
346 3300050496 nmdc:mga07m45_3014_c1 nmdc:mga07m45_3014_c1_2724_3134 121
347 3300050496 nmdc:mga07m45_602100_c1 nmdc:mga07m45_602100_c1_50_415 121
348 3300050509 nmdc:mga0qj67_35013_c1 nmdc:mga0qj67_35013_c1_3132_3497 121
349 3300050516 nmdc:mga0sz30_1779_c1 nmdc:mga0sz30_1779_c1_7015_7380 121
350 3300050516 nmdc:mga0sz30_4943_c1 nmdc:mga0sz30_4943_c1_2606_3016 121
351 3300050516 nmdc:mga0sz30_5181_c1 nmdc:mga0sz30_5181_c1_2788_3153 121
352 3300050516 nmdc:mga0sz30_60551_c1 nmdc:mga0sz30_60551_c1_1172_1537 121
353 3300053130 Ga0500642_0120115 Ga0500642_0120115_531_938 121
354 3300053131 Ga0500652_065546 Ga0500652_065546_987_1355 121
355 3300053158 Ga0500627_0029071 Ga0500627_0029071_1153_1521 121
356 3300061719 Ga0466962_0013152 Ga0466962_0013152_3009_3374 121
357 3300061719 Ga0466962_0067100 Ga0466962_0067100_436_837 121
358 iso_pu_bacteria 2547132424 2548694541 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

25

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gkn-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant 0.9984 1 116
2gkm-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn tyrb10phe mutant 0.9977 1 116
2gl3-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis trhbn, tyrb10phe glne11val mutant 0.9971 1 117
1idr-assembly1.cif.gz_A crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis 0.9863 3 117
2gkn-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant 0.9862 1 117
ID Description Score Start End Superfamily
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9756 2 116 1.10.490.10
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9724 3 118 1.10.490.10
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9643 3 118 1.10.490.10
af_P9WN25_1_136_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9604 3 121 1.10.490.10
6ciiA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9548 3 115 1.10.490.10
ID Description Score Start End GO Terms
AF-Q740T9-F1-model_v4 Group 1 truncated hemoglobin GlbN (Truncated hemoglobin) (trHbN) (Hemoglobin-like protein HbN) 1.004 2 121 GO:0005344
GO:0019825
GO:0020037
GO:0046872
AF-A0A2U3P017-F1-model_v4 Group 1 truncated hemoglobin 1.002 1 120 GO:0005344
GO:0019825
GO:0020037
GO:0046872
AF-A0A1A2ZJK9-F1-model_v4 Group 1 truncated hemoglobin 1.002 1 117 GO:0005344
GO:0019825
GO:0020037
GO:0046872
AF-A0A7I7V4P5-F1-model_v4 deleted 1.001 1 120
AF-A0A1V3XFR3-F1-model_v4 Group 1 truncated hemoglobin GlbN (Hemoglobin-like protein HbN) 1.001 3 97 GO:0005344
GO:0019825
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.81 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map