F421113

General Info

Members Datasets Scaffolds Average Seq Length
358 183 716 340

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100081020|Ga0070704_1000810202
Length 385
Sequence MLKRYMHNRERRLAMLNDNRVVRPFEWGTEFIGHDRDETEPHELFAKYSAKTIANSDEYFAIPKSFDFTLGSLLHRSEPGAVATGSPDLGSAISSNPHSAIRNSKSGNPVAIAPGSDKAPQVLTWTSSVTTPSVENNTAYATYFPHETNRKAAVIILPHWNAKAGTYFDLCKFFNKVGLSALRLTLPYHEERMPPELERADYLVGSNVGRSLQSIRQSVADTRACVMWLKQQGYEKVGIVGTSIGSCVAFLAFVHDPAIDAAVFNHVSGYMADVTWHGLSTYHVRDGFGDNIELDELREYWLPVSPMAYMEKLAAQPPRPQRYIYTLYDLSFPVDLSRETMRALRRHKIKHSKATIPCGHYTLGEKPWVYLDGYKIIKFLHKHLK

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 13.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100081020 3300005549 Bacteria 2389
2 LJQas_1000404 3300000549 Bacteria 7304
3 Ga0065712_10089268 3300005290 Bacteria 2445
4 Ga0065715_10107606 3300005293 Unclassified 2737
5 Ga0070658_10002465 3300005327 Bacteria 15465
6 Ga0070658_10008917 3300005327 Bacteria 8061
7 Ga0070683_100078052 3300005329 Bacteria 3097
8 Ga0070683_100109905 3300005329 Bacteria 2600
9 Ga0070690_100255632 3300005330 Bacteria 1241
10 Ga0070680_100225626 3300005336 Unclassified 1582
11 Ga0068868_100029243 3300005338 Bacteria 4219
12 Ga0068868_100093900 3300005338 Bacteria 2419
13 Ga0068868_100145262 3300005338 Bacteria 1950
14 Ga0070660_100069648 3300005339 Bacteria 2743
15 Ga0070660_100100468 3300005339 Unclassified 2291
16 Ga0070660_100166067 3300005339 Unclassified 1781
17 Ga0070660_100240296 3300005339 Bacteria 1475
18 Ga0070661_100097574 3300005344 Bacteria 2182
19 Ga0070668_100107993 3300005347 Bacteria 2212
20 Ga0070669_100010213 3300005353 Bacteria 6670
21 Ga0070674_100161364 3300005356 Bacteria 1701
22 Ga0070659_100012559 3300005366 Bacteria 6278
23 Ga0070667_100096156 3300005367 Bacteria 2554
24 Ga0070667_100185279 3300005367 Bacteria 1842
25 Ga0070701_10034716 3300005438 Bacteria 2528
26 Ga0070700_100251908 3300005441 Bacteria 1267
27 Ga0070663_100200196 3300005455 Bacteria 1558
28 Ga0070678_100226990 3300005456 Bacteria 1555
29 Ga0070678_100302803 3300005456 Bacteria 1359
30 Ga0070662_100016705 3300005457 Bacteria 4932
31 Ga0070662_100024936 3300005457 Bacteria 4126
32 Ga0070681_10003243 3300005458 Bacteria 15172
33 Ga0070681_10023342 3300005458 Bacteria 6219
34 Ga0070681_10051643 3300005458 Bacteria 4101
35 Ga0070681_10282837 3300005458 Unclassified 1569
36 Ga0068867_100038005 3300005459 Bacteria 3502
37 Ga0070699_100109064 3300005518 Bacteria 2429
38 Ga0070679_100049251 3300005530 Bacteria 4196
39 Ga0070684_100303643 3300005535 Bacteria 1465
40 Ga0068853_100009898 3300005539 Bacteria 7696
41 Ga0068853_100017775 3300005539 Bacteria 5870
42 Ga0068853_100047013 3300005539 Bacteria 3703
43 Ga0068853_100067188 3300005539 Bacteria 3114
44 Ga0070665_100095776 3300005548 Bacteria 2973
45 Ga0068855_100004898 3300005563 Bacteria 16341
46 Ga0068855_100021930 3300005563 Bacteria 7657
47 Ga0068855_100070095 3300005563 Bacteria 4079
48 Ga0070664_100034739 3300005564 Bacteria 4230
49 Ga0070664_100038535 3300005564 Bacteria 4024
50 Ga0070664_100053799 3300005564 Unclassified 3414
51 Ga0070664_100087363 3300005564 Plasmid 2696
52 Ga0070664_100177163 3300005564 Bacteria 1893
53 Ga0068857_100007374 3300005577 Bacteria 9468
54 Ga0068857_100012221 3300005577 Bacteria 7469
55 Ga0068857_100017208 3300005577 Bacteria 6333
56 Ga0068857_100018747 3300005577 Bacteria 6073
57 Ga0068857_100027724 3300005577 Bacteria 4995
58 Ga0068856_100039642 3300005614 Bacteria 4625
59 Ga0068852_100133000 3300005616 Bacteria 2293
60 Ga0068859_100090299 3300005617 Unclassified 3114
61 Ga0068859_100108585 3300005617 Bacteria 2836
62 Ga0068859_100259168 3300005617 Unclassified 1830
63 Ga0068864_100130668 3300005618 Bacteria 2255
64 Ga0068861_100100052 3300005719 Bacteria 2304
65 Ga0068870_10005562 3300005840 Bacteria 5505
66 Ga0068870_10039999 3300005840 Bacteria 2429
67 Ga0068863_100018139 3300005841 Bacteria 6738
68 Ga0068863_100478836 3300005841 Unclassified 1224
69 Ga0068858_100005622 3300005842 Bacteria 12259
70 Ga0068858_100011604 3300005842 Bacteria 8309
71 Ga0068858_100066451 3300005842 Unclassified 3338
72 Ga0068858_100069333 3300005842 Bacteria 3268
73 Ga0068860_100017397 3300005843 Bacteria 7004
74 Ga0068860_100166416 3300005843 Bacteria 2128
75 Ga0068860_100172837 3300005843 Bacteria 2087
76 Ga0068860_100176975 3300005843 Bacteria 2062
77 Ga0068862_100034149 3300005844 Bacteria 4302
78 Ga0081539_10122525 3300005985 Bacteria 1289
79 Ga0097621_100011339 3300006237 Bacteria 6558
80 Ga0097621_100462429 3300006237 Unclassified 1144
81 Ga0068871_100019594 3300006358 Bacteria 5168
82 Ga0068871_100305077 3300006358 Bacteria 1398
83 Ga0075434_100048750 3300006871 Bacteria 4203
84 Ga0068865_100011362 3300006881 Bacteria 5568
85 Ga0097620_100090305 3300006931 Unclassified 3114
86 Ga0097620_100108592 3300006931 Bacteria 2836
87 Ga0097620_100259177 3300006931 Unclassified 1830
88 Ga0105240_10006491 3300009093 Bacteria 17181
89 Ga0105240_10241496 3300009093 Unclassified 2094
90 Ga0105240_10464804 3300009093 Bacteria 1413
91 Ga0111539_10021950 3300009094 Bacteria 7846
92 Ga0111539_10131774 3300009094 Bacteria 2927
93 Ga0105245_10009176 3300009098 Bacteria 8622
94 Ga0105245_10033563 3300009098 Bacteria 4550
95 Ga0105245_10048245 3300009098 Bacteria 3809
96 Ga0105245_10052205 3300009098 Unclassified 3667
97 Ga0105245_10053479 3300009098 Bacteria 3624
98 Ga0105247_10032162 3300009101 Bacteria 3187
99 Ga0105243_10027555 3300009148 Bacteria 4354
100 Ga0105241_10063455 3300009174 Bacteria 2850
101 Ga0105242_10043123 3300009176 Bacteria 3648
102 Ga0105242_10051387 3300009176 Bacteria 3358
103 Ga0105242_10064917 3300009176 Bacteria 3010
104 Ga0105242_10113719 3300009176 Bacteria 2312
105 Ga0105248_10066853 3300009177 Bacteria 4035
106 Ga0105248_10193791 3300009177 Unclassified 2290
107 Ga0105248_10348760 3300009177 Bacteria 1666
108 Ga0105237_10074052 3300009545 Bacteria 3397
109 Ga0105238_10006252 3300009551 Bacteria 11832
110 Ga0105238_10120359 3300009551 Bacteria 2605
111 Ga0105238_10145513 3300009551 Bacteria 2346
112 Ga0105249_10000854 3300009553 Bacteria 27209
113 Ga0105249_10013148 3300009553 Bacteria 7305
114 Ga0105249_10269707 3300009553 Bacteria 1695
115 Ga0105249_10285911 3300009553 Bacteria 1649
116 Ga0105239_10007191 3300010375 Bacteria 12796
117 Ga0105239_10032054 3300010375 Bacteria 5775
118 Ga0105239_10154563 3300010375 Bacteria 2562
119 Ga0105239_10198984 3300010375 Bacteria 2244
120 Ga0105246_10349049 3300011119 Unclassified 1212
121 Ga0157370_10035307 3300013104 Bacteria 4862
122 Ga0157370_10047618 3300013104 Unclassified 4109
123 Ga0157369_10046528 3300013105 Bacteria 4715
124 Ga0157369_10245797 3300013105 Bacteria 1868
125 Ga0157369_10394611 3300013105 Bacteria 1436
126 Ga0157374_10072095 3300013296 Unclassified 3258
127 Ga0157374_10077316 3300013296 Bacteria 3149
128 Ga0157374_10247355 3300013296 Bacteria 1754
129 Ga0157378_10032878 3300013297 Bacteria 4584
130 Ga0163162_10011846 3300013306 Bacteria 8506
131 Ga0163162_10038104 3300013306 Bacteria 4798
132 Ga0163162_10058173 3300013306 Bacteria 3894
133 Ga0163162_10171138 3300013306 Bacteria 2297
134 Ga0157372_10018851 3300013307 Bacteria 7425
135 Ga0157372_10063681 3300013307 Unclassified 4136
136 Ga0157372_10202247 3300013307 Unclassified 2301
137 Ga0157375_10009051 3300013308 Bacteria 8719
138 Ga0163163_10000009 3300014325 Bacteria 268331
139 Ga0163163_10006106 3300014325 Bacteria 10489
140 Ga0163163_10080021 3300014325 Bacteria 3267
141 Ga0163163_10135336 3300014325 Bacteria 2505
142 Ga0157380_10004540 3300014326 Bacteria 9637
143 Ga0157380_10196723 3300014326 Bacteria 1785
144 Ga0157379_10100934 3300014968 Bacteria 2590
145 Ga0157379_10133029 3300014968 Bacteria 2239
146 Ga0163161_10001272 3300017792 Bacteria 18823
147 Ga0163161_10033808 3300017792 Bacteria 3654
148 Ga0207682_10030088 3300025893 Bacteria 2173
149 Ga0207710_10004900 3300025900 Bacteria 5804
150 Ga0207680_10104503 3300025903 Bacteria 1826
151 Ga0207643_10004537 3300025908 Bacteria 7462
152 Ga0207705_10027086 3300025909 Unclassified 4086
153 Ga0207705_10069634 3300025909 Bacteria 2548
154 Ga0207654_10016381 3300025911 Bacteria 3859
155 Ga0207654_10067836 3300025911 Bacteria 2109
156 Ga0207707_10006264 3300025912 Bacteria 10390
157 Ga0207707_10015368 3300025912 Bacteria 6666
158 Ga0207707_10035130 3300025912 Bacteria 4384
159 Ga0207695_10003677 3300025913 Bacteria 21373
160 Ga0207695_10061410 3300025913 Bacteria 3884
161 Ga0207657_10002822 3300025919 Bacteria 18677
162 Ga0207657_10076650 3300025919 Bacteria 2820
163 Ga0207657_10181423 3300025919 Unclassified 1702
164 Ga0207652_10280899 3300025921 Unclassified 1502
165 Ga0207681_10008484 3300025923 Bacteria 6279
166 Ga0207694_10034755 3300025924 Bacteria 3866
167 Ga0207694_10040117 3300025924 Bacteria 3604
168 Ga0207687_10052428 3300025927 Bacteria 2847
169 Ga0207644_10019675 3300025931 Unclassified 4584
170 Ga0207706_10016032 3300025933 Bacteria 6773
171 Ga0207706_10047494 3300025933 Bacteria 3798
172 Ga0207706_10198108 3300025933 Bacteria 1761
173 Ga0207686_10016800 3300025934 Bacteria 4110
174 Ga0207686_10022275 3300025934 Bacteria 3648
175 Ga0207686_10051118 3300025934 Bacteria 2573
176 Ga0207686_10185346 3300025934 Bacteria 1479
177 Ga0207669_10101336 3300025937 Bacteria 1905
178 Ga0207704_10053107 3300025938 Bacteria 2461
179 Ga0207691_10132765 3300025940 Bacteria 2198
180 Ga0207711_10122687 3300025941 Unclassified 2321
181 Ga0207711_10162457 3300025941 Bacteria 2023
182 Ga0207689_10232557 3300025942 Unclassified 1523
183 Ga0207661_10074369 3300025944 Bacteria 2785
184 Ga0207679_10024809 3300025945 Bacteria 4115
185 Ga0207679_10173496 3300025945 Bacteria 1777
186 Ga0207679_10337490 3300025945 Bacteria 1310
187 Ga0207667_10011936 3300025949 Bacteria 10059
188 Ga0207667_10085568 3300025949 Unclassified 3264
189 Ga0207651_10082910 3300025960 Unclassified 2317
190 Ga0207712_10001224 3300025961 Bacteria 17729
191 Ga0207712_10008336 3300025961 Bacteria 6549
192 Ga0207668_10281140 3300025972 Bacteria 1365
193 Ga0207640_10085838 3300025981 Bacteria 2165
194 Ga0207677_10016683 3300026023 Bacteria 4358
195 Ga0207703_10006497 3300026035 Bacteria 9333
196 Ga0207703_10020186 3300026035 Bacteria 5210
197 Ga0207703_10047649 3300026035 Unclassified 3456
198 Ga0207703_10073164 3300026035 Unclassified 2835
199 Ga0207703_10537075 3300026035 Bacteria 1101
200 Ga0207639_10028009 3300026041 Bacteria 4109
201 Ga0207639_10131094 3300026041 Bacteria 2075
202 Ga0207678_10039389 3300026067 Bacteria 4102
203 Ga0207708_10023622 3300026075 Bacteria 4649
204 Ga0207648_10021440 3300026089 Bacteria 5807
205 Ga0207676_10060894 3300026095 Bacteria 2987
206 Ga0207676_10068747 3300026095 Unclassified 2834
207 Ga0207676_10080353 3300026095 Unclassified 2646
208 Ga0207676_10165653 3300026095 Unclassified 1920
209 Ga0207674_10010111 3300026116 Bacteria 10726
210 Ga0207674_10018668 3300026116 Bacteria 7532
211 Ga0207674_10023862 3300026116 Bacteria 6543
212 Ga0207674_10432272 3300026116 Unclassified 1272
213 Ga0207675_100001793 3300026118 Bacteria 21479
214 Ga0207698_10097848 3300026142 Bacteria 2423
215 Ga0207698_10217002 3300026142 Unclassified 1726
216 Ga0268265_10003174 3300028380 Bacteria 11941
217 Ga0268264_10003289 3300028381 Bacteria 13971
218 Ga0268264_10144203 3300028381 Bacteria 2127
219 Ga0265316_10049951 3300031344 Bacteria 3293
220 Ga0307408_100069368 3300031548 Bacteria 2599
221 Ga0265313_10049762 3300031595 Bacteria 2015
222 Ga0265314_10004444 3300031711 Bacteria 13017
223 Ga0307405_10008408 3300031731 Bacteria 5229
224 Ga0307405_10035330 3300031731 Bacteria 2984
225 Ga0307405_10042034 3300031731 Bacteria 2780
226 Ga0307413_10003230 3300031824 Bacteria 6825
227 Ga0307413_10003290 3300031824 Bacteria 6780
228 Ga0307413_10135134 3300031824 Bacteria 1694
229 Ga0307410_10087813 3300031852 Bacteria 2200
230 Ga0307406_10015496 3300031901 Bacteria 4414
231 Ga0307406_10021142 3300031901 Archaea 3845
232 Ga0307406_10097706 3300031901 Unclassified 1992
233 Ga0307406_10259898 3300031901 Bacteria 1313
234 Ga0307407_10005732 3300031903 Bacteria 5426
235 Ga0307407_10021890 3300031903 Bacteria 3306
236 Ga0307407_10085560 3300031903 Bacteria 1918
237 Ga0307412_10026223 3300031911 Bacteria 3620
238 Ga0307412_10106276 3300031911 Bacteria 1995
239 Ga0307412_10175278 3300031911 Unclassified 1607
240 Ga0307409_100003107 3300031995 Bacteria 8903
241 Ga0307409_100187825 3300031995 Bacteria 1836
242 Ga0307416_100195918 3300032002 Unclassified 1911
243 Ga0307414_10004377 3300032004 Bacteria 7667
244 Ga0307414_10131144 3300032004 Bacteria 1946
245 Ga0307414_10182473 3300032004 Bacteria 1689
246 Ga0307411_10003365 3300032005 Bacteria 7408
247 Ga0307411_10059417 3300032005 Bacteria 2535
248 Ga0307411_10132630 3300032005 Bacteria 1823
249 Ga0307415_100002037 3300032126 Bacteria 9972
250 Ga0307415_100149874 3300032126 Bacteria 1794
251 Ga0307415_100224945 3300032126 Bacteria 1507
252 Ga0307415_100305396 3300032126 Bacteria 1320
253 Ga0307415_100347253 3300032126 Bacteria 1247
254 Ga0373934_0054303 3300035086 Bacteria 1591
255 Ga0373956_0004394 3300035119 Bacteria 5646
256 Ga0373957_0007737 3300035120 Bacteria 3451
257 Ga0373943_0046765 3300035170 Bacteria 2113
258 Ga0373955_0011154 3300035172 Bacteria 4271
259 Ga0373937_0000669 3300036401 Bacteria 29860
260 Ga0436365_0946196 3300039437 Unclassified 1221
261 Ga0451576_0037837 3300045051 Bacteria 5109
262 Ga0495592_0149173 3300046454 Bacteria 1619
263 Ga0495651_0020778 3300046462 Bacteria 5096
264 Ga0495653_0099527 3300046463 Unclassified 2110
265 Ga0495594_0128602 3300046499 Unclassified 1434
266 Ga0495598_0003099 3300046537 Unclassified 3499
267 Ga0495645_0132848 3300046543 Bacteria 1743
268 Ga0495668_0001848 3300046616 Bacteria 19058
269 Ga0495588_0139571 3300046674 Unclassified 1280
270 Ga0495671_0114804 3300046692 Unclassified 1315
271 Ga0496104_0260056 3300048907 Bacteria 1649
272 Ga0496109_0034658 3300048912 Unclassified 4549
273 Ga0496112_0132515 3300048915 Unclassified 2463
274 Ga0496114_0102447 3300048917 Bacteria 2446
275 Ga0501031_0034558 3300049568 Bacteria 3299
276 Ga0501031_0056297 3300049568 Bacteria 2561
277 Ga0501032_0002326 3300049569 Bacteria 14900
278 Ga0501032_0008186 3300049569 Bacteria 7621
279 Ga0501032_0012878 3300049569 Bacteria 5962
280 Ga0501032_0034025 3300049569 Bacteria 3489
281 Ga0501033_0001510 3300049570 Bacteria 20603
282 Ga0501033_0009339 3300049570 Bacteria 7551
283 Ga0501033_0212124 3300049570 Bacteria 1380
284 Ga0501034_0110389 3300049571 Bacteria 2741
285 Ga0501034_0133229 3300049571 Bacteria 2467
286 Ga0501036_0014152 3300049572 Bacteria 6636
287 Ga0501036_0017393 3300049572 Bacteria 6010
288 Ga0501036_0019170 3300049572 Bacteria 5739
289 Ga0501036_0064453 3300049572 Bacteria 3101
290 Ga0501037_0006229 3300049573 Bacteria 8725
291 Ga0501037_0021154 3300049573 Bacteria 4806
292 Ga0501037_0051403 3300049573 Bacteria 3014
293 Ga0501038_0006053 3300049574 Bacteria 11192
294 Ga0501038_0014327 3300049574 Bacteria 7224
295 Ga0501038_0020293 3300049574 Bacteria 5977
296 Ga0501038_0021313 3300049574 Bacteria 5818
297 Ga0501039_0137544 3300049575 Bacteria 1918
298 Ga0501042_0012106 3300049578 Bacteria 5837
299 Ga0501042_0127955 3300049578 Bacteria 1829
300 Ga0501043_0005026 3300049579 Bacteria 10704
301 Ga0501043_0009788 3300049579 Bacteria 7513
302 Ga0501043_0011068 3300049579 Bacteria 7065
303 Ga0501046_0014082 3300049580 Bacteria 6753
304 Ga0501046_0055189 3300049580 Bacteria 3123
305 Ga0501046_0079506 3300049580 Bacteria 2534
306 Ga0501047_0001059 3300049581 Bacteria 27451
307 Ga0501047_0008062 3300049581 Bacteria 9939
308 Ga0501047_0024515 3300049581 Bacteria 5788
309 Ga0501048_0026905 3300049582 Bacteria 4185
310 Ga0501067_0006570 3300049583 Bacteria 6446
311 Ga0501067_0011023 3300049583 Bacteria 5004
312 Ga0501067_0192737 3300049583 Bacteria 1135
313 Ga0501068_0020023 3300049584 Bacteria 3893
314 Ga0501068_0022962 3300049584 Bacteria 3653
315 Ga0501068_0124570 3300049584 Bacteria 1608
316 Ga0501069_0020455 3300049585 Bacteria 3586
317 Ga0501069_0035327 3300049585 Bacteria 2753
318 Ga0501069_0037904 3300049585 Bacteria 2660
319 Ga0501070_0011657 3300049586 Bacteria 7422
320 Ga0501070_0033477 3300049586 Bacteria 4300
321 Ga0501071_0190902 3300049587 Bacteria 1536
322 Ga0501072_0012300 3300049588 Bacteria 6541
323 Ga0501072_0017834 3300049588 Bacteria 5459
324 Ga0501073_0004272 3300049589 Bacteria 10712
325 Ga0501073_0094084 3300049589 Bacteria 2081
326 Ga0501073_0096180 3300049589 Bacteria 2056
327 Ga0501074_0000782 3300049590 Bacteria 20108
328 Ga0501074_0008417 3300049590 Bacteria 7480
329 Ga0501074_0048304 3300049590 Bacteria 3074
330 Ga0501075_0010938 3300049591 Bacteria 6400
331 Ga0501076_0018053 3300049592 Bacteria 5370
332 Ga0501079_0063687 3300049741 Bacteria 2844
333 Ga0501079_0119001 3300049741 Bacteria 2053
334 Ga0501079_0270964 3300049741 Bacteria 1327
335 Ga0501080_0001540 3300049742 Bacteria 19465
336 Ga0501080_0037383 3300049742 Bacteria 4534
337 Ga0501080_0109405 3300049742 Bacteria 2561
338 Ga0501081_0202606 3300049743 Bacteria 1439
339 Ga0501083_0009054 3300049744 Bacteria 7031
340 Ga0501083_0077504 3300049744 Bacteria 2205
341 Ga0501035_0008681 3300049822 Bacteria 9460
342 Ga0501035_0012981 3300049822 Bacteria 7686
343 Ga0501035_0082093 3300049822 Bacteria 2844
344 Ga0501044_0005509 3300049823 Bacteria 14056
345 Ga0501044_0031954 3300049823 Bacteria 5534
346 Ga0501044_0068196 3300049823 Bacteria 3623
347 Ga0501044_0090166 3300049823 Bacteria 3093
348 Ga0501045_0059382 3300049824 Bacteria 2801
349 nmdc:mga08y16_166573_c1 3300050511 Bacteria 2289
350 nmdc:mga0n895_149618_c1 3300050512 Bacteria 2364
351 Ga0495601_0067727 3300053077 Bacteria 2275
352 Ga0500641_0006167 3300053096 Bacteria 4250
353 Ga0501084_0007490 3300054114 Bacteria 9000
354 Ga0501084_0035210 3300054114 Bacteria 4185
355 Ga0501084_0111987 3300054114 Bacteria 2293
356 Ga0501082_0003161 3300060353 Bacteria 14351
357 Ga0501082_0012391 3300060353 Bacteria 7328
358 Ga0501082_0196722 3300060353 Bacteria 1754
359 Ga0070704_100081020
360 LJQas_1000404
361 Ga0065712_10089268
362 Ga0065715_10107606
363 Ga0070658_10002465
364 Ga0070658_10008917
365 Ga0070683_100078052
366 Ga0070683_100109905
367 Ga0070690_100255632
368 Ga0070680_100225626
369 Ga0068868_100029243
370 Ga0068868_100093900
371 Ga0068868_100145262
372 Ga0070660_100069648
373 Ga0070660_100100468
374 Ga0070660_100166067
375 Ga0070660_100240296
376 Ga0070661_100097574
377 Ga0070668_100107993
378 Ga0070669_100010213
379 Ga0070674_100161364
380 Ga0070659_100012559
381 Ga0070667_100096156
382 Ga0070667_100185279
383 Ga0070701_10034716
384 Ga0070700_100251908
385 Ga0070663_100200196
386 Ga0070678_100226990
387 Ga0070678_100302803
388 Ga0070662_100016705
389 Ga0070662_100024936
390 Ga0070681_10003243
391 Ga0070681_10023342
392 Ga0070681_10051643
393 Ga0070681_10282837
394 Ga0068867_100038005
395 Ga0070699_100109064
396 Ga0070679_100049251
397 Ga0070684_100303643
398 Ga0068853_100009898
399 Ga0068853_100017775
400 Ga0068853_100047013
401 Ga0068853_100067188
402 Ga0070665_100095776
403 Ga0068855_100004898
404 Ga0068855_100021930
405 Ga0068855_100070095
406 Ga0070664_100034739
407 Ga0070664_100038535
408 Ga0070664_100053799
409 Ga0070664_100087363
410 Ga0070664_100177163
411 Ga0068857_100007374
412 Ga0068857_100012221
413 Ga0068857_100017208
414 Ga0068857_100018747
415 Ga0068857_100027724
416 Ga0068856_100039642
417 Ga0068852_100133000
418 Ga0068859_100090299
419 Ga0068859_100108585
420 Ga0068859_100259168
421 Ga0068864_100130668
422 Ga0068861_100100052
423 Ga0068870_10005562
424 Ga0068870_10039999
425 Ga0068863_100018139
426 Ga0068863_100478836
427 Ga0068858_100005622
428 Ga0068858_100011604
429 Ga0068858_100066451
430 Ga0068858_100069333
431 Ga0068860_100017397
432 Ga0068860_100166416
433 Ga0068860_100172837
434 Ga0068860_100176975
435 Ga0068862_100034149
436 Ga0081539_10122525
437 Ga0097621_100011339
438 Ga0097621_100462429
439 Ga0068871_100019594
440 Ga0068871_100305077
441 Ga0075434_100048750
442 Ga0068865_100011362
443 Ga0097620_100090305
444 Ga0097620_100108592
445 Ga0097620_100259177
446 Ga0105240_10006491
447 Ga0105240_10241496
448 Ga0105240_10464804
449 Ga0111539_10021950
450 Ga0111539_10131774
451 Ga0105245_10009176
452 Ga0105245_10033563
453 Ga0105245_10048245
454 Ga0105245_10052205
455 Ga0105245_10053479
456 Ga0105247_10032162
457 Ga0105243_10027555
458 Ga0105241_10063455
459 Ga0105242_10043123
460 Ga0105242_10051387
461 Ga0105242_10064917
462 Ga0105242_10113719
463 Ga0105248_10066853
464 Ga0105248_10193791
465 Ga0105248_10348760
466 Ga0105237_10074052
467 Ga0105238_10006252
468 Ga0105238_10120359
469 Ga0105238_10145513
470 Ga0105249_10000854
471 Ga0105249_10013148
472 Ga0105249_10269707
473 Ga0105249_10285911
474 Ga0105239_10007191
475 Ga0105239_10032054
476 Ga0105239_10154563
477 Ga0105239_10198984
478 Ga0105246_10349049
479 Ga0157370_10035307
480 Ga0157370_10047618
481 Ga0157369_10046528
482 Ga0157369_10245797
483 Ga0157369_10394611
484 Ga0157374_10072095
485 Ga0157374_10077316
486 Ga0157374_10247355
487 Ga0157378_10032878
488 Ga0163162_10011846
489 Ga0163162_10038104
490 Ga0163162_10058173
491 Ga0163162_10171138
492 Ga0157372_10018851
493 Ga0157372_10063681
494 Ga0157372_10202247
495 Ga0157375_10009051
496 Ga0163163_10000009
497 Ga0163163_10006106
498 Ga0163163_10080021
499 Ga0163163_10135336
500 Ga0157380_10004540
501 Ga0157380_10196723
502 Ga0157379_10100934
503 Ga0157379_10133029
504 Ga0163161_10001272
505 Ga0163161_10033808
506 Ga0207682_10030088
507 Ga0207710_10004900
508 Ga0207680_10104503
509 Ga0207643_10004537
510 Ga0207705_10027086
511 Ga0207705_10069634
512 Ga0207654_10016381
513 Ga0207654_10067836
514 Ga0207707_10006264
515 Ga0207707_10015368
516 Ga0207707_10035130
517 Ga0207695_10003677
518 Ga0207695_10061410
519 Ga0207657_10002822
520 Ga0207657_10076650
521 Ga0207657_10181423
522 Ga0207652_10280899
523 Ga0207681_10008484
524 Ga0207694_10034755
525 Ga0207694_10040117
526 Ga0207687_10052428
527 Ga0207644_10019675
528 Ga0207706_10016032
529 Ga0207706_10047494
530 Ga0207706_10198108
531 Ga0207686_10016800
532 Ga0207686_10022275
533 Ga0207686_10051118
534 Ga0207686_10185346
535 Ga0207669_10101336
536 Ga0207704_10053107
537 Ga0207691_10132765
538 Ga0207711_10122687
539 Ga0207711_10162457
540 Ga0207689_10232557
541 Ga0207661_10074369
542 Ga0207679_10024809
543 Ga0207679_10173496
544 Ga0207679_10337490
545 Ga0207667_10011936
546 Ga0207667_10085568
547 Ga0207651_10082910
548 Ga0207712_10001224
549 Ga0207712_10008336
550 Ga0207668_10281140
551 Ga0207640_10085838
552 Ga0207677_10016683
553 Ga0207703_10006497
554 Ga0207703_10020186
555 Ga0207703_10047649
556 Ga0207703_10073164
557 Ga0207703_10537075
558 Ga0207639_10028009
559 Ga0207639_10131094
560 Ga0207678_10039389
561 Ga0207708_10023622
562 Ga0207648_10021440
563 Ga0207676_10060894
564 Ga0207676_10068747
565 Ga0207676_10080353
566 Ga0207676_10165653
567 Ga0207674_10010111
568 Ga0207674_10018668
569 Ga0207674_10023862
570 Ga0207674_10432272
571 Ga0207675_100001793
572 Ga0207698_10097848
573 Ga0207698_10217002
574 Ga0268265_10003174
575 Ga0268264_10003289
576 Ga0268264_10144203
577 Ga0265316_10049951
578 Ga0307408_100069368
579 Ga0265313_10049762
580 Ga0265314_10004444
581 Ga0307405_10008408
582 Ga0307405_10035330
583 Ga0307405_10042034
584 Ga0307413_10003230
585 Ga0307413_10003290
586 Ga0307413_10135134
587 Ga0307410_10087813
588 Ga0307406_10015496
589 Ga0307406_10021142
590 Ga0307406_10097706
591 Ga0307406_10259898
592 Ga0307407_10005732
593 Ga0307407_10021890
594 Ga0307407_10085560
595 Ga0307412_10026223
596 Ga0307412_10106276
597 Ga0307412_10175278
598 Ga0307409_100003107
599 Ga0307409_100187825
600 Ga0307416_100195918
601 Ga0307414_10004377
602 Ga0307414_10131144
603 Ga0307414_10182473
604 Ga0307411_10003365
605 Ga0307411_10059417
606 Ga0307411_10132630
607 Ga0307415_100002037
608 Ga0307415_100149874
609 Ga0307415_100224945
610 Ga0307415_100305396
611 Ga0307415_100347253
612 Ga0373934_0054303
613 Ga0373956_0004394
614 Ga0373957_0007737
615 Ga0373943_0046765
616 Ga0373955_0011154
617 Ga0373937_0000669
618 Ga0436365_0946196
619 Ga0451576_0037837
620 Ga0495592_0149173
621 Ga0495651_0020778
622 Ga0495653_0099527
623 Ga0495594_0128602
624 Ga0495598_0003099
625 Ga0495645_0132848
626 Ga0495668_0001848
627 Ga0495588_0139571
628 Ga0495671_0114804
629 Ga0496104_0260056
630 Ga0496109_0034658
631 Ga0496112_0132515
632 Ga0496114_0102447
633 Ga0501031_0034558
634 Ga0501031_0056297
635 Ga0501032_0002326
636 Ga0501032_0008186
637 Ga0501032_0012878
638 Ga0501032_0034025
639 Ga0501033_0001510
640 Ga0501033_0009339
641 Ga0501033_0212124
642 Ga0501034_0110389
643 Ga0501034_0133229
644 Ga0501036_0014152
645 Ga0501036_0017393
646 Ga0501036_0019170
647 Ga0501036_0064453
648 Ga0501037_0006229
649 Ga0501037_0021154
650 Ga0501037_0051403
651 Ga0501038_0006053
652 Ga0501038_0014327
653 Ga0501038_0020293
654 Ga0501038_0021313
655 Ga0501039_0137544
656 Ga0501042_0012106
657 Ga0501042_0127955
658 Ga0501043_0005026
659 Ga0501043_0009788
660 Ga0501043_0011068
661 Ga0501046_0014082
662 Ga0501046_0055189
663 Ga0501046_0079506
664 Ga0501047_0001059
665 Ga0501047_0008062
666 Ga0501047_0024515
667 Ga0501048_0026905
668 Ga0501067_0006570
669 Ga0501067_0011023
670 Ga0501067_0192737
671 Ga0501068_0020023
672 Ga0501068_0022962
673 Ga0501068_0124570
674 Ga0501069_0020455
675 Ga0501069_0035327
676 Ga0501069_0037904
677 Ga0501070_0011657
678 Ga0501070_0033477
679 Ga0501071_0190902
680 Ga0501072_0012300
681 Ga0501072_0017834
682 Ga0501073_0004272
683 Ga0501073_0094084
684 Ga0501073_0096180
685 Ga0501074_0000782
686 Ga0501074_0008417
687 Ga0501074_0048304
688 Ga0501075_0010938
689 Ga0501076_0018053
690 Ga0501079_0063687
691 Ga0501079_0119001
692 Ga0501079_0270964
693 Ga0501080_0001540
694 Ga0501080_0037383
695 Ga0501080_0109405
696 Ga0501081_0202606
697 Ga0501083_0009054
698 Ga0501083_0077504
699 Ga0501035_0008681
700 Ga0501035_0012981
701 Ga0501035_0082093
702 Ga0501044_0005509
703 Ga0501044_0031954
704 Ga0501044_0068196
705 Ga0501044_0090166
706 Ga0501045_0059382
707 nmdc:mga08y16_166573_c1
708 nmdc:mga0n895_149618_c1
709 Ga0495601_0067727
710 Ga0500641_0006167
711 Ga0501084_0007490
712 Ga0501084_0035210
713 Ga0501084_0111987
714 Ga0501082_0003161
715 Ga0501082_0012391
716 Ga0501082_0196722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z8z-assembly1.cif.gz_A crystal structure of the hypothetical protein from ruminiclostridium thermocellum atcc 27405 0.8058 3 330
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.7838 74 336
4z8z-assembly1.cif.gz_A crystal structure of the hypothetical protein from ruminiclostridium thermocellum atcc 27405 0.7826 3 330
1ufo-assembly2.cif.gz_D crystal structure of tt1662 from thermus thermophilus 0.7734 61 337
1ufo-assembly2.cif.gz_D crystal structure of tt1662 from thermus thermophilus 0.7651 61 337
ID Description Score Start End Superfamily
af_A0A0R0EWP2_30_290_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8628 90 139 3.40.50.1820
af_O53697_147_385_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8334 84 312 3.40.50.1820
af_O53697_147_385_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7945 84 312 3.40.50.1820
af_P13798_472_732_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7913 91 336 3.40.50.1820
af_P42840_58_270_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.791 91 314 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7Y4TMR9-F1-model_v4 Abhydrolase domain-containing 18 0.9942 145 337
AF-A0A136K3E3-F1-model_v4 deleted 0.9939 1 337
AF-A0A136K3E3-F1-model_v4 deleted 0.991 1 337
AF-A0A7Y4TMR9-F1-model_v4 Abhydrolase domain-containing 18 0.9891 145 337
AF-A0A357F332-F1-model_v4 Abhydrolase domain-containing 18 0.9888 207 337 GO:0016787

Map