F421069

General Info

Members Datasets Scaffolds Average Seq Length
358 184 716 188

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100115003|Ga0070682_1001150032
Length 216
Sequence VTFLSQSGLANSGNVTDYPTVVHRGSCLTRGVDRVAEAFRACPREEFLPRGERRRASYDGPIPIGHGQTNSQPRTVEAMLRLLDVHEGQRVLDVGSGSGWTTALLAHLTGPGGRVLGVELEPALVELGTEHLDAQGLPWASIHTAVPGVLGLPSAAPYHRILVSAMADELPEELVAQLHTGGVMVIPVAGTMLRVATSMRDRQVTRHGSYRFVPLH

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
97 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
170 2643221561 Nocardioides sp. Root151 Isolate Unclassified
171 2643221613 Oerskovia sp. Root22 Isolate Unclassified
172 2643221615 Nocardioides sp. Root224 Isolate Unclassified
173 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
174 2643221696 Nocardioides sp. Root140 Isolate Unclassified
175 2643221711 Terrabacter sp. Root85 Isolate Unclassified
176 2643221721 Oerskovia sp. Root918 Isolate Unclassified
177 2738541305 Nocardioides sp. CF167 Isolate Unclassified
178 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
179 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
180 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
181 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
182 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
183 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
184 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0.28
Isolates 4.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.82
Nodule 0
Rhizoplane 17.32
Rhizosphere 70.95
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100115003 3300005337 Bacteria 1799
2 JGI24735J21928_10039125 3300002067 Bacteria 1387
3 Ga0070658_10051985 3300005327 Bacteria 3322
4 Ga0070683_100010370 3300005329 Bacteria 8013
5 Ga0070683_100109118 3300005329 Bacteria 2610
6 Ga0070680_100196575 3300005336 Bacteria 1700
7 Ga0070682_100120497 3300005337 Bacteria 1760
8 Ga0070682_100147701 3300005337 Bacteria 1610
9 Ga0070682_100215431 3300005337 Bacteria 1363
10 Ga0070682_101026931 3300005337 Bacteria 686
11 Ga0070660_100092735 3300005339 Bacteria 2384
12 Ga0070660_100280371 3300005339 Bacteria 1364
13 Ga0070660_100633628 3300005339 Bacteria 895
14 Ga0070661_100634198 3300005344 Unclassified 866
15 Ga0070692_10079374 3300005345 Bacteria 1764
16 Ga0070674_100209398 3300005356 Bacteria 1510
17 Ga0070674_100442208 3300005356 Bacteria 1071
18 Ga0070667_100053036 3300005367 Bacteria 3422
19 Ga0070700_101113856 3300005441 Unclassified 655
20 Ga0070678_100101051 3300005456 Bacteria 2235
21 Ga0070685_10532355 3300005466 Unclassified 836
22 Ga0070685_10541470 3300005466 Bacteria 830
23 Ga0070679_100007453 3300005530 Bacteria 10224
24 Ga0070679_100917138 3300005530 Bacteria 820
25 Ga0070684_100050807 3300005535 Bacteria 3602
26 Ga0070684_100070773 3300005535 Bacteria 3070
27 Ga0070684_100135385 3300005535 Bacteria 2225
28 Ga0068853_100918607 3300005539 Unclassified 841
29 Ga0070672_100451499 3300005543 Bacteria 1107
30 Ga0070686_100107289 3300005544 Bacteria 1896
31 Ga0070664_100057469 3300005564 Bacteria 3307
32 Ga0068857_100348755 3300005577 Bacteria 1370
33 Ga0068856_100375967 3300005614 Bacteria 1440
34 Ga0068856_100426522 3300005614 Bacteria 1346
35 Ga0070702_100178387 3300005615 Bacteria 1388
36 Ga0068852_100148198 3300005616 Bacteria 2179
37 Ga0068864_100082955 3300005618 Bacteria 2814
38 Ga0068864_100833437 3300005618 Bacteria 908
39 Ga0068858_100296794 3300005842 Bacteria 1541
40 Ga0068860_100059973 3300005843 Bacteria 3616
41 Ga0081539_10057018 3300005985 Bacteria 2164
42 Ga0075365_10020060 3300006038 Bacteria 4137
43 Ga0075365_10028265 3300006038 Bacteria 3576
44 Ga0075365_10182951 3300006038 Bacteria 1465
45 Ga0075365_10305853 3300006038 Bacteria 1119
46 Ga0075365_10400603 3300006038 Bacteria 968
47 Ga0075368_10054447 3300006042 Bacteria 1594
48 Ga0075368_10066661 3300006042 Bacteria 1448
49 Ga0075363_100023408 3300006048 Bacteria 3130
50 Ga0075364_10011571 3300006051 Bacteria 5363
51 Ga0075364_10017915 3300006051 Bacteria 4428
52 Ga0075364_10445432 3300006051 Bacteria 885
53 Ga0075362_10091508 3300006177 Bacteria 1412
54 Ga0075370_10020032 3300006353 Bacteria 3649
55 Ga0075370_10118188 3300006353 Bacteria 1542
56 Ga0068871_100973220 3300006358 Bacteria 789
57 Ga0111539_10550969 3300009094 Bacteria 1343
58 Ga0111539_10883967 3300009094 Bacteria 1039
59 Ga0105245_10000417 3300009098 Bacteria 39694
60 Ga0105245_10596456 3300009098 Bacteria 1131
61 Ga0105245_10658247 3300009098 Bacteria 1078
62 Ga0105245_11333842 3300009098 Bacteria 767
63 Ga0105243_10125728 3300009148 Bacteria 2168
64 Ga0105243_10200996 3300009148 Bacteria 1748
65 Ga0105243_10472672 3300009148 Bacteria 1181
66 Ga0105248_10555124 3300009177 Bacteria 1296
67 Ga0105239_10008340 3300010375 Bacteria 11808
68 Ga0105239_10025071 3300010375 Bacteria 6569
69 Ga0157371_10080407 3300013102 Bacteria 2308
70 Ga0157370_10244430 3300013104 Bacteria 1660
71 Ga0157370_10246856 3300013104 Bacteria 1651
72 Ga0157369_10268944 3300013105 Bacteria 1777
73 Ga0157369_10283428 3300013105 Bacteria 1725
74 Ga0157369_10800667 3300013105 Bacteria 968
75 Ga0157374_11695277 3300013296 Unclassified 657
76 Ga0157372_10001027 3300013307 Bacteria 30507
77 Ga0157372_10095571 3300013307 Bacteria 3386
78 Ga0157372_10233936 3300013307 Bacteria 2131
79 Ga0157372_10268618 3300013307 Bacteria 1981
80 Ga0157375_10046673 3300013308 Bacteria 4226
81 Ga0157375_10122331 3300013308 Bacteria 2714
82 Ga0157375_10219683 3300013308 Bacteria 2059
83 Ga0157375_10326162 3300013308 Bacteria 1700
84 Ga0157375_10372937 3300013308 Bacteria 1593
85 Ga0157375_10579819 3300013308 Bacteria 1282
86 Ga0157375_10785307 3300013308 Bacteria 1102
87 Ga0157375_11358550 3300013308 Bacteria 836
88 Ga0163163_10056856 3300014325 Bacteria 3867
89 Ga0157380_10813670 3300014326 Bacteria 952
90 Ga0182008_10043941 3300014497 Bacteria 2223
91 Ga0157379_10007454 3300014968 Bacteria 9473
92 Ga0163161_10160968 3300017792 Bacteria 1712
93 Ga0206353_11635558 3300020082 Bacteria 1713
94 Ga0207688_10009254 3300025901 Bacteria 5369
95 Ga0207647_10006675 3300025904 Bacteria 8384
96 Ga0207705_10062330 3300025909 Bacteria 2693
97 Ga0207705_10313035 3300025909 Bacteria 1205
98 Ga0207660_10080476 3300025917 Bacteria 2392
99 Ga0207657_10056609 3300025919 Bacteria 3382
100 Ga0207657_10075428 3300025919 Bacteria 2846
101 Ga0207694_11123729 3300025924 Bacteria 665
102 Ga0207687_10064244 3300025927 Bacteria 2602
103 Ga0207687_10100018 3300025927 Bacteria 2132
104 Ga0207687_10882569 3300025927 Unclassified 765
105 Ga0207669_10570783 3300025937 Bacteria 916
106 Ga0207711_10213188 3300025941 Bacteria 1764
107 Ga0207661_10096180 3300025944 Bacteria 2477
108 Ga0207661_10139621 3300025944 Bacteria 2084
109 Ga0207661_10199724 3300025944 Bacteria 1757
110 Ga0207661_10852486 3300025944 Bacteria 839
111 Ga0207679_10032341 3300025945 Bacteria 3671
112 Ga0207679_10728887 3300025945 Bacteria 901
113 Ga0207679_11149759 3300025945 Bacteria 712
114 Ga0207651_10852828 3300025960 Bacteria 810
115 Ga0207658_10005478 3300025986 Bacteria 8703
116 Ga0207677_10334023 3300026023 Bacteria 1264
117 Ga0207703_10223554 3300026035 Bacteria 1685
118 Ga0207708_10044584 3300026075 Bacteria 3379
119 Ga0207708_10304871 3300026075 Unclassified 1296
120 Ga0207702_10331339 3300026078 Bacteria 1452
121 Ga0207676_10226575 3300026095 Bacteria 1668
122 Ga0207676_10770697 3300026095 Bacteria 937
123 Ga0207675_100221297 3300026118 Bacteria 1824
124 Ga0207683_10124226 3300026121 Bacteria 2319
125 Ga0207698_10013261 3300026142 Bacteria 5430
126 Ga0268266_10003293 3300028379 Bacteria 16233
127 Ga0268264_10125765 3300028381 Bacteria 2265
128 Ga0268264_10529047 3300028381 Bacteria 1153
129 Ga0316575_10043086 3300031665 Bacteria 1788
130 Ga0316579_10007256 3300031691 Bacteria 4567
131 Ga0316576_10047971 3300031727 Bacteria 3095
132 Ga0316578_10005342 3300031728 Bacteria 6215
133 Ga0307405_10343066 3300031731 Bacteria 1149
134 Ga0307405_10503444 3300031731 Bacteria 971
135 Ga0307405_10634918 3300031731 Bacteria 876
136 Ga0307405_10790424 3300031731 Bacteria 794
137 Ga0307406_10338171 3300031901 Bacteria 1171
138 Ga0307406_10741238 3300031901 Bacteria 824
139 Ga0307409_100027743 3300031995 Bacteria 4019
140 Ga0307409_100034816 3300031995 Bacteria 3684
141 Ga0307409_100126641 3300031995 Bacteria 2174
142 Ga0307416_100052618 3300032002 Bacteria 3261
143 Ga0307416_100192248 3300032002 Bacteria 1926
144 Ga0307415_100025312 3300032126 Bacteria 3721
145 Ga0307415_101119914 3300032126 Bacteria 738
146 Ga0316580_10004420 3300032139 Bacteria 4074
147 Ga0316574_0017428 3300035398 Bacteria 4203
148 Ga0316582_0015523 3300036647 Bacteria 4359
149 Ga0316584_0030603 3300036712 Bacteria 3975
150 Ga0395899_0342717 3300037312 Bacteria 1002
151 Ga0395898_0180954 3300037466 Bacteria 2015
152 Ga0395901_0094506 3300038443 Bacteria 3132
153 Ga0395901_0175151 3300038443 Bacteria 2250
154 Ga0395901_0342492 3300038443 Bacteria 1544
155 Ga0395901_0458141 3300038443 Bacteria 1303
156 Ga0395901_1307436 3300038443 Bacteria 687
157 Ga0436365_0060503 3300039437 Bacteria 2299
158 Ga0439436_0052543 3300041404 Bacteria 1149
159 Ga0451789_0742023 3300041443 Bacteria 847
160 Ga0451800_1617632 3300041459 Bacteria 1259
161 Ga0451853_1997705 3300041512 Bacteria 1588
162 Ga0451853_2456206 3300041512 Bacteria 1166
163 Ga0439433_0004809 3300041999 Bacteria 2902
164 Ga0439457_022502 3300042014 Bacteria 1396
165 Ga0450907_041459 3300042146 Bacteria 788
166 Ga0466972_0139035 3300044658 Bacteria 1143
167 Ga0466965_0019767 3300044683 Bacteria 3235
168 Ga0466965_0086267 3300044683 Bacteria 1592
169 Ga0466965_0272355 3300044683 Bacteria 912
170 Ga0466965_0285314 3300044683 Bacteria 893
171 Ga0466961_0451626 3300044693 Bacteria 778
172 Ga0466963_0074619 3300044694 Bacteria 2288
173 Ga0466963_0196224 3300044694 Bacteria 1411
174 Ga0466963_0460008 3300044694 Bacteria 898
175 Ga0466963_0598624 3300044694 Unclassified 779
176 Ga0466964_0108349 3300044706 Bacteria 1235
177 Ga0466964_0268669 3300044706 Bacteria 848
178 Ga0466970_0040473 3300044765 Bacteria 2475
179 Ga0466970_0066420 3300044765 Bacteria 1936
180 Ga0466957_0108680 3300044842 Bacteria 1757
181 Ga0466957_0308789 3300044842 Bacteria 1064
182 Ga0466960_0003505 3300044901 Bacteria 6036
183 Ga0466960_0009839 3300044901 Bacteria 3954
184 Ga0466960_0022604 3300044901 Bacteria 2813
185 Ga0466960_0103316 3300044901 Bacteria 1471
186 Ga0466967_0020755 3300045976 Bacteria 5319
187 Ga0466967_0052843 3300045976 Bacteria 3569
188 Ga0466967_0055191 3300045976 Bacteria 3499
189 Ga0466967_0205977 3300045976 Bacteria 1864
190 Ga0466967_0210984 3300045976 Bacteria 1842
191 Ga0466967_0486113 3300045976 Bacteria 1210
192 Ga0466967_0711905 3300045976 Bacteria 995
193 Ga0466967_1080881 3300045976 Bacteria 799
194 Ga0466967_1198656 3300045976 Bacteria 756
195 Ga0495638_0121007 3300046460 Bacteria 1547
196 Ga0495686_0107220 3300047472 Bacteria 1679
197 Ga0496100_0174241 3300048903 Bacteria 1552
198 Ga0496100_0237738 3300048903 Bacteria 1343
199 Ga0496100_0255163 3300048903 Bacteria 1298
200 Ga0496100_0636985 3300048903 Bacteria 829
201 Ga0496101_0139116 3300048904 Bacteria 1849
202 Ga0496102_0013730 3300048905 Bacteria 7024
203 Ga0496102_0027121 3300048905 Bacteria 5115
204 Ga0496102_0100776 3300048905 Bacteria 2683
205 Ga0496102_0457778 3300048905 Bacteria 1197
206 Ga0496102_0552782 3300048905 Bacteria 1074
207 Ga0496102_0554642 3300048905 Bacteria 1072
208 Ga0496103_0055508 3300048906 Bacteria 2457
209 Ga0496103_0161044 3300048906 Bacteria 1439
210 Ga0496104_0040002 3300048907 Bacteria 4393
211 Ga0496104_0051598 3300048907 Bacteria 3882
212 Ga0496105_0000922 3300048908 Bacteria 20044
213 Ga0496105_0007483 3300048908 Bacteria 8457
214 Ga0496105_0109644 3300048908 Bacteria 2279
215 Ga0496105_0554367 3300048908 Bacteria 897
216 Ga0496106_0171497 3300048909 Bacteria 1720
217 Ga0496106_0184950 3300048909 Bacteria 1655
218 Ga0496106_0220004 3300048909 Bacteria 1514
219 Ga0496106_0268890 3300048909 Bacteria 1365
220 Ga0496106_0816884 3300048909 Bacteria 739
221 Ga0496107_0014225 3300048910 Bacteria 5572
222 Ga0496107_0667650 3300048910 Bacteria 766
223 Ga0496107_0797687 3300048910 Unclassified 691
224 Ga0496108_0008265 3300048911 Bacteria 8442
225 Ga0496108_0081214 3300048911 Bacteria 2747
226 Ga0496108_0941353 3300048911 Bacteria 740
227 Ga0496109_0015299 3300048912 Bacteria 6682
228 Ga0496109_0023621 3300048912 Bacteria 5458
229 Ga0496109_0058583 3300048912 Bacteria 3518
230 Ga0496109_0073569 3300048912 Bacteria 3140
231 Ga0496109_0079565 3300048912 Bacteria 3020
232 Ga0496110_0001314 3300048913 Bacteria 17842
233 Ga0496110_0089395 3300048913 Bacteria 2753
234 Ga0496110_0113215 3300048913 Bacteria 2440
235 Ga0496110_0560057 3300048913 Bacteria 1038
236 Ga0496111_0022669 3300048914 Bacteria 4399
237 Ga0496111_0170758 3300048914 Bacteria 1616
238 Ga0496111_0313778 3300048914 Bacteria 1162
239 Ga0496111_0575155 3300048914 Bacteria 826
240 Ga0496112_0482004 3300048915 Bacteria 1177
241 Ga0496113_0038422 3300048916 Bacteria 3520
242 Ga0496113_0327549 3300048916 Bacteria 1228
243 Ga0496113_0497491 3300048916 Bacteria 979
244 Ga0496114_0004062 3300048917 Bacteria 11306
245 Ga0496114_0014922 3300048917 Bacteria 6244
246 Ga0496114_0016566 3300048917 Bacteria 5941
247 Ga0496114_0023371 3300048917 Bacteria 5044
248 Ga0496114_0025970 3300048917 Bacteria 4792
249 Ga0496114_0047390 3300048917 Bacteria 3575
250 Ga0496114_0091319 3300048917 Bacteria 2586
251 Ga0496114_0094748 3300048917 Bacteria 2540
252 Ga0496114_0116290 3300048917 Bacteria 2296
253 Ga0496114_0149390 3300048917 Bacteria 2026
254 Ga0496114_0152979 3300048917 Bacteria 2001
255 Ga0496115_0010969 3300048918 Bacteria 6786
256 Ga0496115_0013984 3300048918 Bacteria 6074
257 Ga0501031_0004914 3300049568 Bacteria 8686
258 Ga0501032_0043371 3300049569 Bacteria 3047
259 Ga0501033_0392428 3300049570 Bacteria 969
260 Ga0501034_0027076 3300049571 Bacteria 5833
261 Ga0501036_0029902 3300049572 Bacteria 4604
262 Ga0501036_0042563 3300049572 Bacteria 3845
263 Ga0501036_0356176 3300049572 Bacteria 1222
264 Ga0501037_0036450 3300049573 Bacteria 3625
265 Ga0501037_0119256 3300049573 Bacteria 1898
266 Ga0501038_0009037 3300049574 Bacteria 9145
267 Ga0501038_0084385 3300049574 Bacteria 2672
268 Ga0501038_0255431 3300049574 Bacteria 1387
269 Ga0501039_0233974 3300049575 Bacteria 1444
270 Ga0501039_0336112 3300049575 Bacteria 1187
271 Ga0501041_0025982 3300049577 Bacteria 3520
272 Ga0501042_0032807 3300049578 Bacteria 3678
273 Ga0501043_0372657 3300049579 Bacteria 1082
274 Ga0501046_0005454 3300049580 Bacteria 11371
275 Ga0501047_0008084 3300049581 Bacteria 9926
276 Ga0501047_0211438 3300049581 Bacteria 1798
277 Ga0501047_1047487 3300049581 Bacteria 629
278 Ga0501048_0026445 3300049582 Bacteria 4225
279 Ga0501048_0032904 3300049582 Bacteria 3747
280 Ga0501067_0007301 3300049583 Bacteria 6136
281 Ga0501067_0315813 3300049583 Bacteria 870
282 Ga0501068_0009431 3300049584 Bacteria 5462
283 Ga0501068_0137507 3300049584 Bacteria 1530
284 Ga0501068_0297427 3300049584 Bacteria 1033
285 Ga0501069_0065950 3300049585 Bacteria 2025
286 Ga0501070_0018520 3300049586 Bacteria 5842
287 Ga0501070_0170410 3300049586 Bacteria 1793
288 Ga0501070_0250216 3300049586 Bacteria 1450
289 Ga0501071_0035304 3300049587 Bacteria 3561
290 Ga0501071_0043872 3300049587 Bacteria 3207
291 Ga0501071_0074823 3300049587 Bacteria 2472
292 Ga0501071_0195536 3300049587 Bacteria 1518
293 Ga0501072_0016492 3300049588 Bacteria 5674
294 Ga0501073_0009470 3300049589 Bacteria 7190
295 Ga0501073_0076408 3300049589 Bacteria 2330
296 Ga0501073_0212142 3300049589 Bacteria 1338
297 Ga0501074_0017346 3300049590 Bacteria 5222
298 Ga0501074_0038413 3300049590 Bacteria 3469
299 Ga0501074_0077711 3300049590 Bacteria 2382
300 Ga0501074_0115037 3300049590 Bacteria 1924
301 Ga0501075_0089676 3300049591 Bacteria 2332
302 Ga0501075_0302276 3300049591 Bacteria 1219
303 Ga0501075_0477254 3300049591 Bacteria 951
304 Ga0501076_0894431 3300049592 Bacteria 732
305 Ga0501077_0020720 3300049593 Bacteria 4163
306 Ga0501077_0443543 3300049593 Bacteria 831
307 Ga0501077_0547932 3300049593 Bacteria 742
308 Ga0501079_0063015 3300049741 Bacteria 2860
309 Ga0501080_0022611 3300049742 Bacteria 5824
310 Ga0501080_0027211 3300049742 Bacteria 5318
311 Ga0501080_0033921 3300049742 Bacteria 4765
312 Ga0501080_0108408 3300049742 Bacteria 2574
313 Ga0501081_0403833 3300049743 Bacteria 1012
314 Ga0501083_0003226 3300049744 Bacteria 11372
315 Ga0501083_0033908 3300049744 Bacteria 3493
316 Ga0501083_0376113 3300049744 Bacteria 924
317 Ga0501035_0004963 3300049822 Bacteria 12617
318 Ga0501035_0151650 3300049822 Bacteria 2011
319 Ga0501044_0007756 3300049823 Bacteria 11799
320 Ga0501044_0590086 3300049823 Bacteria 1005
321 Ga0501045_0155494 3300049824 Bacteria 1701
322 nmdc:mga03n38_60437_c1 3300050490 Bacteria 1723
323 nmdc:mga00v17_228390_c1 3300050491 Bacteria 1206
324 nmdc:mga00v17_349113_c1 3300050491 Bacteria 962
325 nmdc:mga0yw44_12811_c2 3300050492 Bacteria 3703
326 nmdc:mga0yw44_146537_c1 3300050492 Bacteria 1239
327 nmdc:mga0yw44_26182_c1 3300050492 Bacteria 3328
328 nmdc:mga0yw44_269466_c1 3300050492 Bacteria 1136
329 nmdc:mga0yw44_278686_c1 3300050492 Bacteria 1117
330 nmdc:mga0yw44_309700_c1 3300050492 Bacteria 1059
331 nmdc:mga0yw44_98821_c1 3300050492 Bacteria 1856
332 nmdc:mga06z11_135084_c2 3300050494 Bacteria 1009
333 nmdc:mga07m45_23872_c1 3300050496 Bacteria 3345
334 nmdc:mga08y16_561212_c1 3300050511 Bacteria 1154
335 Ga0495619_0013266 3300053085 Bacteria 5193
336 Ga0500556_0001524 3300053104 Bacteria 9519
337 Ga0500616_0006724 3300053153 Bacteria 7462
338 Ga0501084_0037578 3300054114 Bacteria 4047
339 Ga0501084_0216964 3300054114 Bacteria 1614
340 Ga0501084_0262858 3300054114 Bacteria 1457
341 Ga0501082_0001824 3300060353 Bacteria 18764
342 Ga0501082_0231841 3300060353 Bacteria 1607
343 Ga0530510_0070075 3300061734 Bacteria 2545
344 2643824949 2643221561 Bacteria 4984412
345 2644082037 2643221613 Bacteria 4622396
346 2644092674 2643221615 Bacteria 5487866
347 2644322287 2643221657 Bacteria 5490246
348 2644532501 2643221696 Bacteria 5431823
349 2644609420 2643221711 Bacteria 4865335
350 2644664980 2643221721 Bacteria 4486924
351 2738870827 2738541305 Bacteria 4910150
352 2812334685 2811994874 Bacteria 5367947
353 2812374630 2811994882 Bacteria 4688362
354 2819666252 2818991458 Bacteria 4794049
355 2819693089 2818991462 Bacteria 4320267
356 2819730271 2818991469 Bacteria 4644110
357 2897562505 2897561785 Bacteria 3256946
358 2935894228 2935890801 Bacteria 4593001
359 Ga0070682_100115003
360 JGI24735J21928_10039125
361 Ga0070658_10051985
362 Ga0070683_100010370
363 Ga0070683_100109118
364 Ga0070680_100196575
365 Ga0070682_100120497
366 Ga0070682_100147701
367 Ga0070682_100215431
368 Ga0070682_101026931
369 Ga0070660_100092735
370 Ga0070660_100280371
371 Ga0070660_100633628
372 Ga0070661_100634198
373 Ga0070692_10079374
374 Ga0070674_100209398
375 Ga0070674_100442208
376 Ga0070667_100053036
377 Ga0070700_101113856
378 Ga0070678_100101051
379 Ga0070685_10532355
380 Ga0070685_10541470
381 Ga0070679_100007453
382 Ga0070679_100917138
383 Ga0070684_100050807
384 Ga0070684_100070773
385 Ga0070684_100135385
386 Ga0068853_100918607
387 Ga0070672_100451499
388 Ga0070686_100107289
389 Ga0070664_100057469
390 Ga0068857_100348755
391 Ga0068856_100375967
392 Ga0068856_100426522
393 Ga0070702_100178387
394 Ga0068852_100148198
395 Ga0068864_100082955
396 Ga0068864_100833437
397 Ga0068858_100296794
398 Ga0068860_100059973
399 Ga0081539_10057018
400 Ga0075365_10020060
401 Ga0075365_10028265
402 Ga0075365_10182951
403 Ga0075365_10305853
404 Ga0075365_10400603
405 Ga0075368_10054447
406 Ga0075368_10066661
407 Ga0075363_100023408
408 Ga0075364_10011571
409 Ga0075364_10017915
410 Ga0075364_10445432
411 Ga0075362_10091508
412 Ga0075370_10020032
413 Ga0075370_10118188
414 Ga0068871_100973220
415 Ga0111539_10550969
416 Ga0111539_10883967
417 Ga0105245_10000417
418 Ga0105245_10596456
419 Ga0105245_10658247
420 Ga0105245_11333842
421 Ga0105243_10125728
422 Ga0105243_10200996
423 Ga0105243_10472672
424 Ga0105248_10555124
425 Ga0105239_10008340
426 Ga0105239_10025071
427 Ga0157371_10080407
428 Ga0157370_10244430
429 Ga0157370_10246856
430 Ga0157369_10268944
431 Ga0157369_10283428
432 Ga0157369_10800667
433 Ga0157374_11695277
434 Ga0157372_10001027
435 Ga0157372_10095571
436 Ga0157372_10233936
437 Ga0157372_10268618
438 Ga0157375_10046673
439 Ga0157375_10122331
440 Ga0157375_10219683
441 Ga0157375_10326162
442 Ga0157375_10372937
443 Ga0157375_10579819
444 Ga0157375_10785307
445 Ga0157375_11358550
446 Ga0163163_10056856
447 Ga0157380_10813670
448 Ga0182008_10043941
449 Ga0157379_10007454
450 Ga0163161_10160968
451 Ga0206353_11635558
452 Ga0207688_10009254
453 Ga0207647_10006675
454 Ga0207705_10062330
455 Ga0207705_10313035
456 Ga0207660_10080476
457 Ga0207657_10056609
458 Ga0207657_10075428
459 Ga0207694_11123729
460 Ga0207687_10064244
461 Ga0207687_10100018
462 Ga0207687_10882569
463 Ga0207669_10570783
464 Ga0207711_10213188
465 Ga0207661_10096180
466 Ga0207661_10139621
467 Ga0207661_10199724
468 Ga0207661_10852486
469 Ga0207679_10032341
470 Ga0207679_10728887
471 Ga0207679_11149759
472 Ga0207651_10852828
473 Ga0207658_10005478
474 Ga0207677_10334023
475 Ga0207703_10223554
476 Ga0207708_10044584
477 Ga0207708_10304871
478 Ga0207702_10331339
479 Ga0207676_10226575
480 Ga0207676_10770697
481 Ga0207675_100221297
482 Ga0207683_10124226
483 Ga0207698_10013261
484 Ga0268266_10003293
485 Ga0268264_10125765
486 Ga0268264_10529047
487 Ga0316575_10043086
488 Ga0316579_10007256
489 Ga0316576_10047971
490 Ga0316578_10005342
491 Ga0307405_10343066
492 Ga0307405_10503444
493 Ga0307405_10634918
494 Ga0307405_10790424
495 Ga0307406_10338171
496 Ga0307406_10741238
497 Ga0307409_100027743
498 Ga0307409_100034816
499 Ga0307409_100126641
500 Ga0307416_100052618
501 Ga0307416_100192248
502 Ga0307415_100025312
503 Ga0307415_101119914
504 Ga0316580_10004420
505 Ga0316574_0017428
506 Ga0316582_0015523
507 Ga0316584_0030603
508 Ga0395899_0342717
509 Ga0395898_0180954
510 Ga0395901_0094506
511 Ga0395901_0175151
512 Ga0395901_0342492
513 Ga0395901_0458141
514 Ga0395901_1307436
515 Ga0436365_0060503
516 Ga0439436_0052543
517 Ga0451789_0742023
518 Ga0451800_1617632
519 Ga0451853_1997705
520 Ga0451853_2456206
521 Ga0439433_0004809
522 Ga0439457_022502
523 Ga0450907_041459
524 Ga0466972_0139035
525 Ga0466965_0019767
526 Ga0466965_0086267
527 Ga0466965_0272355
528 Ga0466965_0285314
529 Ga0466961_0451626
530 Ga0466963_0074619
531 Ga0466963_0196224
532 Ga0466963_0460008
533 Ga0466963_0598624
534 Ga0466964_0108349
535 Ga0466964_0268669
536 Ga0466970_0040473
537 Ga0466970_0066420
538 Ga0466957_0108680
539 Ga0466957_0308789
540 Ga0466960_0003505
541 Ga0466960_0009839
542 Ga0466960_0022604
543 Ga0466960_0103316
544 Ga0466967_0020755
545 Ga0466967_0052843
546 Ga0466967_0055191
547 Ga0466967_0205977
548 Ga0466967_0210984
549 Ga0466967_0486113
550 Ga0466967_0711905
551 Ga0466967_1080881
552 Ga0466967_1198656
553 Ga0495638_0121007
554 Ga0495686_0107220
555 Ga0496100_0174241
556 Ga0496100_0237738
557 Ga0496100_0255163
558 Ga0496100_0636985
559 Ga0496101_0139116
560 Ga0496102_0013730
561 Ga0496102_0027121
562 Ga0496102_0100776
563 Ga0496102_0457778
564 Ga0496102_0552782
565 Ga0496102_0554642
566 Ga0496103_0055508
567 Ga0496103_0161044
568 Ga0496104_0040002
569 Ga0496104_0051598
570 Ga0496105_0000922
571 Ga0496105_0007483
572 Ga0496105_0109644
573 Ga0496105_0554367
574 Ga0496106_0171497
575 Ga0496106_0184950
576 Ga0496106_0220004
577 Ga0496106_0268890
578 Ga0496106_0816884
579 Ga0496107_0014225
580 Ga0496107_0667650
581 Ga0496107_0797687
582 Ga0496108_0008265
583 Ga0496108_0081214
584 Ga0496108_0941353
585 Ga0496109_0015299
586 Ga0496109_0023621
587 Ga0496109_0058583
588 Ga0496109_0073569
589 Ga0496109_0079565
590 Ga0496110_0001314
591 Ga0496110_0089395
592 Ga0496110_0113215
593 Ga0496110_0560057
594 Ga0496111_0022669
595 Ga0496111_0170758
596 Ga0496111_0313778
597 Ga0496111_0575155
598 Ga0496112_0482004
599 Ga0496113_0038422
600 Ga0496113_0327549
601 Ga0496113_0497491
602 Ga0496114_0004062
603 Ga0496114_0014922
604 Ga0496114_0016566
605 Ga0496114_0023371
606 Ga0496114_0025970
607 Ga0496114_0047390
608 Ga0496114_0091319
609 Ga0496114_0094748
610 Ga0496114_0116290
611 Ga0496114_0149390
612 Ga0496114_0152979
613 Ga0496115_0010969
614 Ga0496115_0013984
615 Ga0501031_0004914
616 Ga0501032_0043371
617 Ga0501033_0392428
618 Ga0501034_0027076
619 Ga0501036_0029902
620 Ga0501036_0042563
621 Ga0501036_0356176
622 Ga0501037_0036450
623 Ga0501037_0119256
624 Ga0501038_0009037
625 Ga0501038_0084385
626 Ga0501038_0255431
627 Ga0501039_0233974
628 Ga0501039_0336112
629 Ga0501041_0025982
630 Ga0501042_0032807
631 Ga0501043_0372657
632 Ga0501046_0005454
633 Ga0501047_0008084
634 Ga0501047_0211438
635 Ga0501047_1047487
636 Ga0501048_0026445
637 Ga0501048_0032904
638 Ga0501067_0007301
639 Ga0501067_0315813
640 Ga0501068_0009431
641 Ga0501068_0137507
642 Ga0501068_0297427
643 Ga0501069_0065950
644 Ga0501070_0018520
645 Ga0501070_0170410
646 Ga0501070_0250216
647 Ga0501071_0035304
648 Ga0501071_0043872
649 Ga0501071_0074823
650 Ga0501071_0195536
651 Ga0501072_0016492
652 Ga0501073_0009470
653 Ga0501073_0076408
654 Ga0501073_0212142
655 Ga0501074_0017346
656 Ga0501074_0038413
657 Ga0501074_0077711
658 Ga0501074_0115037
659 Ga0501075_0089676
660 Ga0501075_0302276
661 Ga0501075_0477254
662 Ga0501076_0894431
663 Ga0501077_0020720
664 Ga0501077_0443543
665 Ga0501077_0547932
666 Ga0501079_0063015
667 Ga0501080_0022611
668 Ga0501080_0027211
669 Ga0501080_0033921
670 Ga0501080_0108408
671 Ga0501081_0403833
672 Ga0501083_0003226
673 Ga0501083_0033908
674 Ga0501083_0376113
675 Ga0501035_0004963
676 Ga0501035_0151650
677 Ga0501044_0007756
678 Ga0501044_0590086
679 Ga0501045_0155494
680 nmdc:mga03n38_60437_c1
681 nmdc:mga00v17_228390_c1
682 nmdc:mga00v17_349113_c1
683 nmdc:mga0yw44_12811_c2
684 nmdc:mga0yw44_146537_c1
685 nmdc:mga0yw44_26182_c1
686 nmdc:mga0yw44_269466_c1
687 nmdc:mga0yw44_278686_c1
688 nmdc:mga0yw44_309700_c1
689 nmdc:mga0yw44_98821_c1
690 nmdc:mga06z11_135084_c2
691 nmdc:mga07m45_23872_c1
692 nmdc:mga08y16_561212_c1
693 Ga0495619_0013266
694 Ga0500556_0001524
695 Ga0500616_0006724
696 Ga0501084_0037578
697 Ga0501084_0216964
698 Ga0501084_0262858
699 Ga0501082_0001824
700 Ga0501082_0231841
701 Ga0530510_0070075
702 2643824949
703 2644082037
704 2644092674
705 2644322287
706 2644532501
707 2644609420
708 2644664980
709 2738870827
710 2812334685
711 2812374630
712 2819666252
713 2819693089
714 2819730271
715 2897562505
716 2935894228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

27

216

0.9

PF13649

Methyltransf_25

Methyltransferase domain

91

199

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.9591 1 185
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.9568 2 186
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.9491 1 185
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.9469 2 186
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.9373 2 185
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9728 58 112 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9568 2 186 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9469 2 186 3.40.50.150
af_F4JZ42_97_383_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9456 50 112 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9425 44 104 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A399YFB6-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.988 10 186 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A7C6MIT2-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9838 69 185 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A7Y2M763-F1-model_v4 deleted 0.9826 2 186
AF-A0A1F5PXV2-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9736 2 186 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A7Y2M763-F1-model_v4 deleted 0.9722 2 186

Map