F421067

General Info

Members Datasets Scaffolds Average Seq Length
358 181 716 132

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100585809|Ga0068869_1005858092
Length 129
Sequence MLNRREFVWSAAAGAGAMGVLASETQAAEPTMSLNVVYPNHEGARFDMAYYRSSHIPLVMKVTKAKSALLIEGVPGANGAAAPFVMIVHFEFASADALKAGLADPAMADVRADVAKFTDITPTVMLGKS

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
144 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.86
Nodule 0
Rhizoplane 1.4
Rhizosphere 73.18
Stem 0
Stem Tuber 0
Unclassified 28.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100585809 3300005334 Unclassified 941
2 MBSR1b_contig_10608881 2162886012 Unclassified 1247
3 Ga0065712_10468269 3300005290 Unclassified 672
4 Ga0065715_10351613 3300005293 Unclassified 950
5 Ga0070676_10590153 3300005328 Bacteria 800
6 Ga0070690_100158773 3300005330 Bacteria 1548
7 Ga0070670_100172207 3300005331 Bacteria 1878
8 Ga0070677_10081861 3300005333 Bacteria 1383
9 Ga0068869_100056058 3300005334 Bacteria 2873
10 Ga0068869_100402603 3300005334 Bacteria 1126
11 Ga0070666_10369110 3300005335 Bacteria 1029
12 Ga0070666_10476979 3300005335 Bacteria 903
13 Ga0070680_100502816 3300005336 Unclassified 1037
14 Ga0070680_100810353 3300005336 Unclassified 807
15 Ga0070682_100396446 3300005337 Bacteria 1042
16 Ga0068868_100037388 3300005338 Bacteria 3763
17 Ga0070660_100611069 3300005339 Unclassified 912
18 Ga0070689_100009825 3300005340 Bacteria 6801
19 Ga0070691_10031600 3300005341 Bacteria 2484
20 Ga0070691_10300765 3300005341 Unclassified 876
21 Ga0070687_100001077 3300005343 Bacteria 9356
22 Ga0070661_100015920 3300005344 Bacteria 5308
23 Ga0070661_100663576 3300005344 Bacteria 847
24 Ga0070692_10463357 3300005345 Unclassified 814
25 Ga0070668_100052284 3300005347 Bacteria 3149
26 Ga0070668_100163728 3300005347 Bacteria 1806
27 Ga0070668_100259028 3300005347 Bacteria 1446
28 Ga0070668_100783386 3300005347 Bacteria 846
29 Ga0070669_100224631 3300005353 Unclassified 1486
30 Ga0070675_100073369 3300005354 Bacteria 2841
31 Ga0070675_100132436 3300005354 Unclassified 2125
32 Ga0070671_100154192 3300005355 Bacteria 1940
33 Ga0070671_100279769 3300005355 Unclassified 1419
34 Ga0070671_100454558 3300005355 Bacteria 1099
35 Ga0070674_100005650 3300005356 Bacteria 7248
36 Ga0070674_101036110 3300005356 Bacteria 722
37 Ga0070673_100195449 3300005364 Bacteria 1740
38 Ga0070673_100242225 3300005364 Bacteria 1569
39 Ga0070688_100008060 3300005365 Bacteria 5705
40 Ga0070659_100068121 3300005366 Unclassified 2823
41 Ga0070659_100177477 3300005366 Bacteria 1747
42 Ga0070667_100051073 3300005367 Bacteria 3485
43 Ga0070667_100253878 3300005367 Bacteria 1573
44 Ga0070667_102140904 3300005367 Bacteria 527
45 Ga0070701_10025521 3300005438 Bacteria 2871
46 Ga0070700_100063124 3300005441 Bacteria 2343
47 Ga0070694_100049075 3300005444 Bacteria 2841
48 Ga0070694_100161000 3300005444 Bacteria 1647
49 Ga0070694_101326701 3300005444 Unclassified 606
50 Ga0070663_100281991 3300005455 Bacteria 1324
51 Ga0070663_100568595 3300005455 Archaea 950
52 Ga0070663_100601057 3300005455 Unclassified 925
53 Ga0070678_100215145 3300005456 Bacteria 1594
54 Ga0070678_100642954 3300005456 Bacteria 951
55 Ga0070662_100381842 3300005457 Bacteria 1160
56 Ga0070662_101063892 3300005457 Unclassified 694
57 Ga0068867_100012626 3300005459 Bacteria 5973
58 Ga0068867_100602680 3300005459 Unclassified 958
59 Ga0068867_100774710 3300005459 Unclassified 853
60 Ga0068867_101111392 3300005459 Unclassified 722
61 Ga0070699_101344904 3300005518 Unclassified 655
62 Ga0070672_100010270 3300005543 Bacteria 6490
63 Ga0070672_100170578 3300005543 Unclassified 1809
64 Ga0070686_101387967 3300005544 Unclassified 589
65 Ga0070695_100108271 3300005545 Bacteria 1882
66 Ga0070695_100617667 3300005545 Unclassified 852
67 Ga0070693_100006075 3300005547 Bacteria 5849
68 Ga0070665_100339153 3300005548 Bacteria 1508
69 Ga0070665_100412247 3300005548 Bacteria 1359
70 Ga0070665_100827561 3300005548 Unclassified 939
71 Ga0070665_101027767 3300005548 Unclassified 836
72 Ga0070704_100232112 3300005549 Bacteria 1506
73 Ga0070704_100825351 3300005549 Bacteria 830
74 Ga0070664_100054612 3300005564 Bacteria 3389
75 Ga0070664_100174921 3300005564 Bacteria 1905
76 Ga0070664_101867425 3300005564 Bacteria 570
77 Ga0068857_100454625 3300005577 Bacteria 1198
78 Ga0068854_100331680 3300005578 Bacteria 1240
79 Ga0068854_101391249 3300005578 Bacteria 634
80 Ga0068859_100014190 3300005617 Bacteria 7989
81 Ga0068859_100038109 3300005617 Bacteria 4824
82 Ga0068859_100153508 3300005617 Bacteria 2379
83 Ga0068859_102452162 3300005617 Unclassified 574
84 Ga0068864_100016008 3300005618 Bacteria 6239
85 Ga0068864_100096750 3300005618 Bacteria 2613
86 Ga0068866_10115799 3300005718 Bacteria 1503
87 Ga0068861_100034796 3300005719 Bacteria 3726
88 Ga0068861_100096861 3300005719 Unclassified 2339
89 Ga0068861_100525873 3300005719 Bacteria 1073
90 Ga0068863_100021622 3300005841 Bacteria 6136
91 Ga0068863_100028143 3300005841 Bacteria 5366
92 Ga0068858_100288403 3300005842 Bacteria 1564
93 Ga0068858_100295468 3300005842 Bacteria 1545
94 Ga0068860_100017083 3300005843 Bacteria 7073
95 Ga0068862_100008263 3300005844 Bacteria 8610
96 Ga0068862_100070719 3300005844 Bacteria 3013
97 Ga0068862_100077449 3300005844 Bacteria 2879
98 Ga0068862_101033302 3300005844 Bacteria 814
99 Ga0068862_101792636 3300005844 Unclassified 623
100 Ga0075365_10044861 3300006038 Bacteria 2898
101 Ga0075365_10089040 3300006038 Bacteria 2101
102 Ga0075365_10951731 3300006038 Unclassified 605
103 Ga0075368_10030956 3300006042 Bacteria 2074
104 Ga0075368_10045800 3300006042 Bacteria 1729
105 Ga0075368_10072845 3300006042 Bacteria 1390
106 Ga0075368_10086393 3300006042 Bacteria 1280
107 Ga0075368_10100629 3300006042 Bacteria 1187
108 Ga0075368_10120429 3300006042 Bacteria 1086
109 Ga0075368_10423857 3300006042 Bacteria 587
110 Ga0075363_100087378 3300006048 Bacteria 1712
111 Ga0075363_100317697 3300006048 Unclassified 906
112 Ga0075363_100873067 3300006048 Bacteria 550
113 Ga0075364_10005285 3300006051 Bacteria 7495
114 Ga0075364_10029158 3300006051 Bacteria 3538
115 Ga0075364_10029453 3300006051 Bacteria 3521
116 Ga0075364_10046277 3300006051 Bacteria 2832
117 Ga0075364_10215928 3300006051 Unclassified 1301
118 Ga0075364_10246927 3300006051 Bacteria 1213
119 Ga0075364_10384315 3300006051 Bacteria 958
120 Ga0075364_10445092 3300006051 Bacteria 885
121 Ga0075362_10001264 3300006177 Bacteria 7981
122 Ga0075362_10086256 3300006177 Bacteria 1452
123 Ga0075362_10106660 3300006177 Bacteria 1315
124 Ga0075362_10251133 3300006177 Unclassified 870
125 Ga0075367_10000860 3300006178 Bacteria 12124
126 Ga0075367_10006769 3300006178 Bacteria 5819
127 Ga0075367_10037435 3300006178 Unclassified 2819
128 Ga0075367_10041978 3300006178 Bacteria 2675
129 Ga0075367_10084417 3300006178 Bacteria 1925
130 Ga0075367_10231730 3300006178 Unclassified 1156
131 Ga0075367_10485869 3300006178 Bacteria 783
132 Ga0075367_10865598 3300006178 Unclassified 576
133 Ga0075369_10200476 3300006186 Bacteria 921
134 Ga0075366_10000191 3300006195 Bacteria 26957
135 Ga0075366_10010359 3300006195 Bacteria 5233
136 Ga0075366_10017759 3300006195 Bacteria 4100
137 Ga0075366_10021097 3300006195 Bacteria 3786
138 Ga0075366_10025051 3300006195 Unclassified 3482
139 Ga0075366_10034223 3300006195 Bacteria 2992
140 Ga0075366_10087402 3300006195 Bacteria 1866
141 Ga0075366_10283251 3300006195 Bacteria 1013
142 Ga0075366_10411426 3300006195 Bacteria 833
143 Ga0097621_100315832 3300006237 Bacteria 1383
144 Ga0075370_10162996 3300006353 Bacteria 1309
145 Ga0068871_100682918 3300006358 Archaea 940
146 Ga0075428_100111622 3300006844 Bacteria 2978
147 Ga0075428_100481044 3300006844 Bacteria 1329
148 Ga0075428_100544716 3300006844 Unclassified 1240
149 Ga0075428_100900300 3300006844 Bacteria 938
150 Ga0075430_100073870 3300006846 Bacteria 2858
151 Ga0075430_100770688 3300006846 Unclassified 793
152 Ga0075431_100118453 3300006847 Bacteria 2732
153 Ga0075433_10178053 3300006852 Bacteria 1892
154 Ga0075433_10186698 3300006852 Bacteria 1844
155 Ga0075433_10395318 3300006852 Unclassified 1220
156 Ga0075434_100028473 3300006871 Bacteria 5489
157 Ga0075434_101696647 3300006871 Unclassified 639
158 Ga0068865_100023216 3300006881 Bacteria 4059
159 Ga0068865_100184634 3300006881 Bacteria 1608
160 Ga0097620_100014190 3300006931 Bacteria 7989
161 Ga0097620_100038108 3300006931 Bacteria 4824
162 Ga0097620_100153506 3300006931 Bacteria 2379
163 Ga0097620_102452128 3300006931 Unclassified 574
164 Ga0075435_100006846 3300007076 Bacteria 8089
165 Ga0075435_100166131 3300007076 Unclassified 1861
166 Ga0111539_10000076 3300009094 Bacteria 98052
167 Ga0111539_10000997 3300009094 Bacteria 37088
168 Ga0111539_10005878 3300009094 Bacteria 15845
169 Ga0111539_10678563 3300009094 Bacteria 1199
170 Ga0105245_10196284 3300009098 Bacteria 1936
171 Ga0105247_10057674 3300009101 Bacteria 2401
172 Ga0114129_10566031 3300009147 Bacteria 1476
173 Ga0114129_11053808 3300009147 Unclassified 1021
174 Ga0114129_11239489 3300009147 Bacteria 927
175 Ga0105243_10345345 3300009148 Bacteria 1365
176 Ga0105243_10807999 3300009148 Bacteria 925
177 Ga0105243_11665572 3300009148 Unclassified 666
178 Ga0105241_10781493 3300009174 Bacteria 878
179 Ga0105242_10610894 3300009176 Bacteria 1055
180 Ga0105248_10032627 3300009177 Bacteria 5818
181 Ga0105248_10083107 3300009177 Bacteria 3603
182 Ga0105248_10445184 3300009177 Unclassified 1460
183 Ga0105237_10150734 3300009545 Bacteria 2322
184 Ga0105237_11276786 3300009545 Bacteria 741
185 Ga0105238_10223531 3300009551 Unclassified 1859
186 Ga0105249_10154638 3300009553 Bacteria 2211
187 Ga0105239_11194479 3300010375 Unclassified 876
188 Ga0105246_10622497 3300011119 Unclassified 936
189 Ga0105246_11227707 3300011119 Unclassified 691
190 Ga0157374_10916842 3300013296 Bacteria 894
191 Ga0163162_10502295 3300013306 Bacteria 1343
192 Ga0157375_10431058 3300013308 Archaea 1484
193 Ga0157375_10464675 3300013308 Unclassified 1431
194 Ga0163163_10057975 3300014325 Bacteria 3829
195 Ga0157380_10059106 3300014326 Bacteria 3058
196 Ga0157380_10135994 3300014326 Bacteria 2104
197 Ga0157377_10653977 3300014745 Unclassified 757
198 Ga0157379_10377739 3300014968 Unclassified 1300
199 Ga0206356_10492373 3300020070 Bacteria 678
200 Ga0207697_10070903 3300025315 Bacteria 1460
201 Ga0207642_10078126 3300025899 Bacteria 1598
202 Ga0207680_10265584 3300025903 Bacteria 1189
203 Ga0207643_10035200 3300025908 Unclassified 2806
204 Ga0207684_10259384 3300025910 Bacteria 1500
205 Ga0207671_10763285 3300025914 Unclassified 768
206 Ga0207660_10398723 3300025917 Unclassified 1108
207 Ga0207660_11112047 3300025917 Unclassified 644
208 Ga0207662_10003245 3300025918 Bacteria 8334
209 Ga0207649_10041680 3300025920 Unclassified 2795
210 Ga0207681_10169247 3300025923 Unclassified 1655
211 Ga0207694_10825051 3300025924 Bacteria 783
212 Ga0207650_10111304 3300025925 Bacteria 2120
213 Ga0207659_10043775 3300025926 Bacteria 3146
214 Ga0207659_11032702 3300025926 Bacteria 707
215 Ga0207687_10425616 3300025927 Archaea 1096
216 Ga0207644_10184971 3300025931 Unclassified 1635
217 Ga0207644_10267917 3300025931 Archaea 1368
218 Ga0207690_10070552 3300025932 Bacteria 2407
219 Ga0207706_10065988 3300025933 Bacteria 3186
220 Ga0207706_10189297 3300025933 Bacteria 1807
221 Ga0207686_11103958 3300025934 Unclassified 647
222 Ga0207669_10016716 3300025937 Bacteria 3738
223 Ga0207704_10098931 3300025938 Bacteria 1939
224 Ga0207704_10539596 3300025938 Unclassified 946
225 Ga0207691_10051710 3300025940 Bacteria 3755
226 Ga0207711_10077890 3300025941 Bacteria 2891
227 Ga0207689_10033876 3300025942 Bacteria 4243
228 Ga0207689_10195518 3300025942 Unclassified 1669
229 Ga0207689_10377323 3300025942 Bacteria 1180
230 Ga0207679_10400925 3300025945 Bacteria 1207
231 Ga0207679_10438454 3300025945 Bacteria 1156
232 Ga0207712_10029589 3300025961 Bacteria 3676
233 Ga0207712_11825674 3300025961 Unclassified 545
234 Ga0207668_10042948 3300025972 Bacteria 3065
235 Ga0207668_10160816 3300025972 Bacteria 1750
236 Ga0207668_10271247 3300025972 Unclassified 1387
237 Ga0207668_10718127 3300025972 Bacteria 879
238 Ga0207640_10281034 3300025981 Bacteria 1307
239 Ga0207640_11920689 3300025981 Bacteria 536
240 Ga0207658_10220246 3300025986 Unclassified 1596
241 Ga0207658_10340371 3300025986 Bacteria 1304
242 Ga0207658_10487833 3300025986 Bacteria 1096
243 Ga0207677_10236431 3300026023 Bacteria 1475
244 Ga0207678_10015641 3300026067 Bacteria 6670
245 Ga0207678_10143179 3300026067 Bacteria 2040
246 Ga0207708_10011439 3300026075 Bacteria 6610
247 Ga0207641_10085717 3300026088 Bacteria 2745
248 Ga0207641_10174763 3300026088 Unclassified 1963
249 Ga0207648_10014802 3300026089 Bacteria 7197
250 Ga0207676_10253554 3300026095 Bacteria 1585
251 Ga0207674_10891935 3300026116 Unclassified 857
252 Ga0207674_11152756 3300026116 Unclassified 745
253 Ga0207675_100033277 3300026118 Bacteria 4803
254 Ga0207675_100036796 3300026118 Unclassified 4565
255 Ga0207675_100089261 3300026118 Bacteria 2896
256 Ga0207675_100221721 3300026118 Bacteria 1822
257 Ga0207683_10230176 3300026121 Bacteria 1690
258 Ga0207683_10498687 3300026121 Bacteria 1124
259 Ga0209813_10048242 3300027866 Bacteria 1321
260 Ga0209813_10090558 3300027866 Unclassified 1026
261 Ga0207428_10000660 3300027907 Bacteria 40431
262 Ga0207428_10002618 3300027907 Bacteria 17951
263 Ga0207428_10092266 3300027907 Bacteria 2350
264 Ga0268266_10110585 3300028379 Bacteria 2434
265 Ga0268266_11000614 3300028379 Archaea 809
266 Ga0268266_11899046 3300028379 Unclassified 570
267 Ga0268265_10053228 3300028380 Bacteria 3066
268 Ga0268265_10055792 3300028380 Bacteria 3003
269 Ga0268265_10074862 3300028380 Bacteria 2650
270 Ga0268264_10193538 3300028381 Unclassified 1855
271 Ga0307509_10010497 3300031507 Bacteria 11341
272 Ga0307509_10199947 3300031507 Bacteria 1837
273 Ga0307409_102022405 3300031995 Bacteria 606
274 Ga0307411_11428133 3300032005 Bacteria 634
275 Ga0373959_0112974 3300034820 Bacteria 657
276 Ga0373931_0760652 3300035691 Bacteria 644
277 Ga0242420_150953 3300038996 Unclassified 522
278 Ga0451797_0032928 3300041453 Bacteria 532
279 Ga0451800_1146580 3300041459 Bacteria 540
280 Ga0450894_001212 3300042131 Unclassified 3808
281 Ga0450896_002091 3300042133 Unclassified 2546
282 Ga0450906_022009 3300042145 Unclassified 1137
283 Ga0495638_0070227 3300046460 Bacteria 2144
284 Ga0496101_0168605 3300048904 Bacteria 1682
285 Ga0496108_0106204 3300048911 Bacteria 2398
286 Ga0496109_1112537 3300048912 Bacteria 727
287 Ga0501031_0724614 3300049568 Unclassified 638
288 Ga0501036_0784915 3300049572 Unclassified 785
289 Ga0501040_0878546 3300049576 Unclassified 649
290 Ga0501040_1386252 3300049576 Unclassified 510
291 Ga0501041_1140820 3300049577 Unclassified 503
292 Ga0501076_1578286 3300049592 Unclassified 539
293 Ga0501081_0362799 3300049743 Unclassified 1069
294 Ga0501035_0463592 3300049822 Unclassified 1047
295 Ga0501045_0593885 3300049824 Unclassified 820
296 nmdc:mga03683_134123_c1 3300050489 Bacteria 1110
297 nmdc:mga03683_205387_c1 3300050489 Unclassified 572
298 nmdc:mga03683_52666_c1 3300050489 Bacteria 1702
299 nmdc:mga03n38_283907_c1 3300050490 Bacteria 884
300 nmdc:mga03n38_30850_c1 3300050490 Unclassified 2257
301 nmdc:mga03n38_309000_c1 3300050490 Unclassified 851
302 nmdc:mga00v17_107389_c1 3300050491 Bacteria 1768
303 nmdc:mga00v17_133713_c1 3300050491 Bacteria 1587
304 nmdc:mga00v17_156846_c1 3300050491 Bacteria 1464
305 nmdc:mga00v17_190877_c1 3300050491 Bacteria 1323
306 nmdc:mga00v17_24094_c1 3300050491 Bacteria 3526
307 nmdc:mga00v17_250061_c1 3300050491 Unclassified 1149
308 nmdc:mga00v17_43701_c1 3300050491 Bacteria 2699
309 nmdc:mga00v17_74906_c1 3300050491 Unclassified 2104
310 nmdc:mga00v17_988790_c1 3300050491 Bacteria 530
311 nmdc:mga0yw44_26700_c1 3300050492 Bacteria 3301
312 nmdc:mga0yw44_663772_c1 3300050492 Unclassified 708
313 nmdc:mga0k408_115292_c1 3300050493 Archaea 1589
314 nmdc:mga0k408_12742_c1 3300050493 Bacteria 4599
315 nmdc:mga0k408_13654_c1 3300050493 Unclassified 4458
316 nmdc:mga0k408_192563_c1 3300050493 Unclassified 1217
317 nmdc:mga0k408_22236_c1 3300050493 Bacteria 3570
318 nmdc:mga0k408_339049_c1 3300050493 Bacteria 896
319 nmdc:mga0k408_5396_c1 3300050493 Bacteria 6800
320 nmdc:mga0k408_54234_c1 3300050493 Bacteria 2323
321 nmdc:mga0k408_7126_c1 3300050493 Bacteria 5974
322 nmdc:mga06z11_13730_c1 3300050494 Bacteria 3567
323 nmdc:mga06z11_43705_c1 3300050494 Unclassified 2256
324 nmdc:mga06z11_483131_c1 3300050494 Bacteria 750
325 nmdc:mga06z11_68737_c1 3300050494 Bacteria 1868
326 nmdc:mga04h51_106948_c1 3300050495 Unclassified 1026
327 nmdc:mga04h51_54166_c1 3300050495 Bacteria 1355
328 nmdc:mga04h51_81047_c1 3300050495 Bacteria 1152
329 nmdc:mga07m45_24798_c1 3300050496 Bacteria 3287
330 nmdc:mga07m45_26848_c1 3300050496 Bacteria 3167
331 nmdc:mga07m45_402388_c1 3300050496 Unclassified 795
332 nmdc:mga07m45_564902_c1 3300050496 Unclassified 658
333 nmdc:mga07m45_752890_c1 3300050496 Unclassified 559
334 nmdc:mga05p37_802416_c1 3300050507 Unclassified 1030
335 nmdc:mga09592_69168_c1 3300050508 Bacteria 2995
336 nmdc:mga0qj67_1511511_c1 3300050509 Bacteria 516
337 nmdc:mga0qj67_63339_c1 3300050509 Bacteria 2940
338 nmdc:mga0qj67_85582_c1 3300050509 Bacteria 2528
339 nmdc:mga06r32_35261_c1 3300050510 Bacteria 4721
340 nmdc:mga08y16_16033_c1 3300050511 Bacteria 7878
341 nmdc:mga08y16_5852_c1 3300050511 Bacteria 12882
342 nmdc:mga08y16_6354_c1 3300050511 Bacteria 12393
343 nmdc:mga0n895_1120104_c1 3300050512 Bacteria 764
344 nmdc:mga0n895_349430_c1 3300050512 Bacteria 1498
345 nmdc:mga0rr50_33578_c1 3300050513 Bacteria 3666
346 nmdc:mga0rr50_603591_c1 3300050513 Bacteria 936
347 nmdc:mga0a205_211994_c1 3300050515 Bacteria 1825
348 nmdc:mga0a205_292419_c1 3300050515 Bacteria 1503
349 nmdc:mga0a205_298268_c1 3300050515 Bacteria 1485
350 nmdc:mga0a205_801182_c1 3300050515 Unclassified 790
351 nmdc:mga0sz30_121457_c1 3300050516 Bacteria 1148
352 Ga0500583_0499323 3300053092 Unclassified 572
353 Ga0500555_000156 3300053103 Bacteria 32598
354 Ga0500616_0000099 3300053153 Bacteria 175058
355 Ga0500645_000254 3300053730 Bacteria 39219
356 Ga0501084_0191931 3300054114 Bacteria 1723
357 Ga0590075_037076 3300059424 Bacteria 1243
358 Ga0501082_0429410 3300060353 Unclassified 1154
359 Ga0068869_100585809
360 MBSR1b_contig_10608881
361 Ga0065712_10468269
362 Ga0065715_10351613
363 Ga0070676_10590153
364 Ga0070690_100158773
365 Ga0070670_100172207
366 Ga0070677_10081861
367 Ga0068869_100056058
368 Ga0068869_100402603
369 Ga0070666_10369110
370 Ga0070666_10476979
371 Ga0070680_100502816
372 Ga0070680_100810353
373 Ga0070682_100396446
374 Ga0068868_100037388
375 Ga0070660_100611069
376 Ga0070689_100009825
377 Ga0070691_10031600
378 Ga0070691_10300765
379 Ga0070687_100001077
380 Ga0070661_100015920
381 Ga0070661_100663576
382 Ga0070692_10463357
383 Ga0070668_100052284
384 Ga0070668_100163728
385 Ga0070668_100259028
386 Ga0070668_100783386
387 Ga0070669_100224631
388 Ga0070675_100073369
389 Ga0070675_100132436
390 Ga0070671_100154192
391 Ga0070671_100279769
392 Ga0070671_100454558
393 Ga0070674_100005650
394 Ga0070674_101036110
395 Ga0070673_100195449
396 Ga0070673_100242225
397 Ga0070688_100008060
398 Ga0070659_100068121
399 Ga0070659_100177477
400 Ga0070667_100051073
401 Ga0070667_100253878
402 Ga0070667_102140904
403 Ga0070701_10025521
404 Ga0070700_100063124
405 Ga0070694_100049075
406 Ga0070694_100161000
407 Ga0070694_101326701
408 Ga0070663_100281991
409 Ga0070663_100568595
410 Ga0070663_100601057
411 Ga0070678_100215145
412 Ga0070678_100642954
413 Ga0070662_100381842
414 Ga0070662_101063892
415 Ga0068867_100012626
416 Ga0068867_100602680
417 Ga0068867_100774710
418 Ga0068867_101111392
419 Ga0070699_101344904
420 Ga0070672_100010270
421 Ga0070672_100170578
422 Ga0070686_101387967
423 Ga0070695_100108271
424 Ga0070695_100617667
425 Ga0070693_100006075
426 Ga0070665_100339153
427 Ga0070665_100412247
428 Ga0070665_100827561
429 Ga0070665_101027767
430 Ga0070704_100232112
431 Ga0070704_100825351
432 Ga0070664_100054612
433 Ga0070664_100174921
434 Ga0070664_101867425
435 Ga0068857_100454625
436 Ga0068854_100331680
437 Ga0068854_101391249
438 Ga0068859_100014190
439 Ga0068859_100038109
440 Ga0068859_100153508
441 Ga0068859_102452162
442 Ga0068864_100016008
443 Ga0068864_100096750
444 Ga0068866_10115799
445 Ga0068861_100034796
446 Ga0068861_100096861
447 Ga0068861_100525873
448 Ga0068863_100021622
449 Ga0068863_100028143
450 Ga0068858_100288403
451 Ga0068858_100295468
452 Ga0068860_100017083
453 Ga0068862_100008263
454 Ga0068862_100070719
455 Ga0068862_100077449
456 Ga0068862_101033302
457 Ga0068862_101792636
458 Ga0075365_10044861
459 Ga0075365_10089040
460 Ga0075365_10951731
461 Ga0075368_10030956
462 Ga0075368_10045800
463 Ga0075368_10072845
464 Ga0075368_10086393
465 Ga0075368_10100629
466 Ga0075368_10120429
467 Ga0075368_10423857
468 Ga0075363_100087378
469 Ga0075363_100317697
470 Ga0075363_100873067
471 Ga0075364_10005285
472 Ga0075364_10029158
473 Ga0075364_10029453
474 Ga0075364_10046277
475 Ga0075364_10215928
476 Ga0075364_10246927
477 Ga0075364_10384315
478 Ga0075364_10445092
479 Ga0075362_10001264
480 Ga0075362_10086256
481 Ga0075362_10106660
482 Ga0075362_10251133
483 Ga0075367_10000860
484 Ga0075367_10006769
485 Ga0075367_10037435
486 Ga0075367_10041978
487 Ga0075367_10084417
488 Ga0075367_10231730
489 Ga0075367_10485869
490 Ga0075367_10865598
491 Ga0075369_10200476
492 Ga0075366_10000191
493 Ga0075366_10010359
494 Ga0075366_10017759
495 Ga0075366_10021097
496 Ga0075366_10025051
497 Ga0075366_10034223
498 Ga0075366_10087402
499 Ga0075366_10283251
500 Ga0075366_10411426
501 Ga0097621_100315832
502 Ga0075370_10162996
503 Ga0068871_100682918
504 Ga0075428_100111622
505 Ga0075428_100481044
506 Ga0075428_100544716
507 Ga0075428_100900300
508 Ga0075430_100073870
509 Ga0075430_100770688
510 Ga0075431_100118453
511 Ga0075433_10178053
512 Ga0075433_10186698
513 Ga0075433_10395318
514 Ga0075434_100028473
515 Ga0075434_101696647
516 Ga0068865_100023216
517 Ga0068865_100184634
518 Ga0097620_100014190
519 Ga0097620_100038108
520 Ga0097620_100153506
521 Ga0097620_102452128
522 Ga0075435_100006846
523 Ga0075435_100166131
524 Ga0111539_10000076
525 Ga0111539_10000997
526 Ga0111539_10005878
527 Ga0111539_10678563
528 Ga0105245_10196284
529 Ga0105247_10057674
530 Ga0114129_10566031
531 Ga0114129_11053808
532 Ga0114129_11239489
533 Ga0105243_10345345
534 Ga0105243_10807999
535 Ga0105243_11665572
536 Ga0105241_10781493
537 Ga0105242_10610894
538 Ga0105248_10032627
539 Ga0105248_10083107
540 Ga0105248_10445184
541 Ga0105237_10150734
542 Ga0105237_11276786
543 Ga0105238_10223531
544 Ga0105249_10154638
545 Ga0105239_11194479
546 Ga0105246_10622497
547 Ga0105246_11227707
548 Ga0157374_10916842
549 Ga0163162_10502295
550 Ga0157375_10431058
551 Ga0157375_10464675
552 Ga0163163_10057975
553 Ga0157380_10059106
554 Ga0157380_10135994
555 Ga0157377_10653977
556 Ga0157379_10377739
557 Ga0206356_10492373
558 Ga0207697_10070903
559 Ga0207642_10078126
560 Ga0207680_10265584
561 Ga0207643_10035200
562 Ga0207684_10259384
563 Ga0207671_10763285
564 Ga0207660_10398723
565 Ga0207660_11112047
566 Ga0207662_10003245
567 Ga0207649_10041680
568 Ga0207681_10169247
569 Ga0207694_10825051
570 Ga0207650_10111304
571 Ga0207659_10043775
572 Ga0207659_11032702
573 Ga0207687_10425616
574 Ga0207644_10184971
575 Ga0207644_10267917
576 Ga0207690_10070552
577 Ga0207706_10065988
578 Ga0207706_10189297
579 Ga0207686_11103958
580 Ga0207669_10016716
581 Ga0207704_10098931
582 Ga0207704_10539596
583 Ga0207691_10051710
584 Ga0207711_10077890
585 Ga0207689_10033876
586 Ga0207689_10195518
587 Ga0207689_10377323
588 Ga0207679_10400925
589 Ga0207679_10438454
590 Ga0207712_10029589
591 Ga0207712_11825674
592 Ga0207668_10042948
593 Ga0207668_10160816
594 Ga0207668_10271247
595 Ga0207668_10718127
596 Ga0207640_10281034
597 Ga0207640_11920689
598 Ga0207658_10220246
599 Ga0207658_10340371
600 Ga0207658_10487833
601 Ga0207677_10236431
602 Ga0207678_10015641
603 Ga0207678_10143179
604 Ga0207708_10011439
605 Ga0207641_10085717
606 Ga0207641_10174763
607 Ga0207648_10014802
608 Ga0207676_10253554
609 Ga0207674_10891935
610 Ga0207674_11152756
611 Ga0207675_100033277
612 Ga0207675_100036796
613 Ga0207675_100089261
614 Ga0207675_100221721
615 Ga0207683_10230176
616 Ga0207683_10498687
617 Ga0209813_10048242
618 Ga0209813_10090558
619 Ga0207428_10000660
620 Ga0207428_10002618
621 Ga0207428_10092266
622 Ga0268266_10110585
623 Ga0268266_11000614
624 Ga0268266_11899046
625 Ga0268265_10053228
626 Ga0268265_10055792
627 Ga0268265_10074862
628 Ga0268264_10193538
629 Ga0307509_10010497
630 Ga0307509_10199947
631 Ga0307409_102022405
632 Ga0307411_11428133
633 Ga0373959_0112974
634 Ga0373931_0760652
635 Ga0242420_150953
636 Ga0451797_0032928
637 Ga0451800_1146580
638 Ga0450894_001212
639 Ga0450896_002091
640 Ga0450906_022009
641 Ga0495638_0070227
642 Ga0496101_0168605
643 Ga0496108_0106204
644 Ga0496109_1112537
645 Ga0501031_0724614
646 Ga0501036_0784915
647 Ga0501040_0878546
648 Ga0501040_1386252
649 Ga0501041_1140820
650 Ga0501076_1578286
651 Ga0501081_0362799
652 Ga0501035_0463592
653 Ga0501045_0593885
654 nmdc:mga03683_134123_c1
655 nmdc:mga03683_205387_c1
656 nmdc:mga03683_52666_c1
657 nmdc:mga03n38_283907_c1
658 nmdc:mga03n38_30850_c1
659 nmdc:mga03n38_309000_c1
660 nmdc:mga00v17_107389_c1
661 nmdc:mga00v17_133713_c1
662 nmdc:mga00v17_156846_c1
663 nmdc:mga00v17_190877_c1
664 nmdc:mga00v17_24094_c1
665 nmdc:mga00v17_250061_c1
666 nmdc:mga00v17_43701_c1
667 nmdc:mga00v17_74906_c1
668 nmdc:mga00v17_988790_c1
669 nmdc:mga0yw44_26700_c1
670 nmdc:mga0yw44_663772_c1
671 nmdc:mga0k408_115292_c1
672 nmdc:mga0k408_12742_c1
673 nmdc:mga0k408_13654_c1
674 nmdc:mga0k408_192563_c1
675 nmdc:mga0k408_22236_c1
676 nmdc:mga0k408_339049_c1
677 nmdc:mga0k408_5396_c1
678 nmdc:mga0k408_54234_c1
679 nmdc:mga0k408_7126_c1
680 nmdc:mga06z11_13730_c1
681 nmdc:mga06z11_43705_c1
682 nmdc:mga06z11_483131_c1
683 nmdc:mga06z11_68737_c1
684 nmdc:mga04h51_106948_c1
685 nmdc:mga04h51_54166_c1
686 nmdc:mga04h51_81047_c1
687 nmdc:mga07m45_24798_c1
688 nmdc:mga07m45_26848_c1
689 nmdc:mga07m45_402388_c1
690 nmdc:mga07m45_564902_c1
691 nmdc:mga07m45_752890_c1
692 nmdc:mga05p37_802416_c1
693 nmdc:mga09592_69168_c1
694 nmdc:mga0qj67_1511511_c1
695 nmdc:mga0qj67_63339_c1
696 nmdc:mga0qj67_85582_c1
697 nmdc:mga06r32_35261_c1
698 nmdc:mga08y16_16033_c1
699 nmdc:mga08y16_5852_c1
700 nmdc:mga08y16_6354_c1
701 nmdc:mga0n895_1120104_c1
702 nmdc:mga0n895_349430_c1
703 nmdc:mga0rr50_33578_c1
704 nmdc:mga0rr50_603591_c1
705 nmdc:mga0a205_211994_c1
706 nmdc:mga0a205_292419_c1
707 nmdc:mga0a205_298268_c1
708 nmdc:mga0a205_801182_c1
709 nmdc:mga0sz30_121457_c1
710 Ga0500583_0499323
711 Ga0500555_000156
712 Ga0500616_0000099
713 Ga0500645_000254
714 Ga0501084_0191931
715 Ga0590075_037076
716 Ga0501082_0429410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07110

EthD

EthD domain

43

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.897 24 121
3bf4-assembly1.cif.gz_B crystal structure of an ethd-like protein (reut_b5694) from ralstonia eutropha jmp134 at 2.10 a resolution 0.7921 24 121
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7791 26 124
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7656 26 124
1si9-assembly1.cif.gz_A boiling stable protein isolated from populus tremula 0.6891 26 124
ID Description Score Start End Superfamily
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8361 28 119 3.30.70.100
3bf4B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7963 28 119 3.30.70.100
5y02I00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6985 25 124 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6963 24 124 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6887 26 124 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1S6FIN9-F1-model_v4 EthD domain-containing protein 0.9909 27 124 GO:0016491
AF-A0A1S6FIN9-F1-model_v4 EthD domain-containing protein 0.9712 27 124 GO:0016491
AF-A0A245ZQD6-F1-model_v4 EthD protein 0.9609 28 124 GO:0016491
AF-A0A842Z5R7-F1-model_v4 deleted 0.9424 27 123
AF-A0A245ZQD6-F1-model_v4 EthD protein 0.942 28 124 GO:0016491

Map