F421064

General Info

Members Datasets Scaffolds Average Seq Length
358 233 716 160

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101643857|Ga0070683_1016438571
Length 174
Sequence MEYGFTPRNPKEETLTMARNLICLWYNGTAEEAARFYAETFPDSAVTAVHHAPGDYPNGKQGQVLTVSFTVVGIPCLGLNGGPMFTHSEAFSFQILTEDQAETDRYWNAIVRNGGAESQCGWCKDRWGVSWQITPRALTDALSDRDPAAAKRAFEAMMKMKKIDIAAIEAARRG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
211 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
212 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
213 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 2516143018 Ensifer sp. BR816 Isolate Nodule
231 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
232 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
233 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0.56
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 0.28
Rhizoplane 6.98
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101643857 3300005329 Bacteria 618
2 Ga0058863_11832995 3300004799 Bacteria 614
3 Ga0065715_10471790 3300005293 Bacteria 805
4 Ga0070658_10056499 3300005327 Bacteria 3190
5 Ga0070658_10452641 3300005327 Bacteria 1106
6 Ga0070676_10048703 3300005328 Bacteria 2478
7 Ga0070683_100077260 3300005329 Bacteria 3113
8 Ga0070690_100029459 3300005330 Bacteria 3405
9 Ga0070670_100502928 3300005331 Bacteria 1078
10 Ga0068869_100300961 3300005334 Bacteria 1295
11 Ga0070666_10001027 3300005335 Bacteria 17099
12 Ga0070666_10058328 3300005335 Bacteria 2610
13 Ga0070666_10561723 3300005335 Bacteria 830
14 Ga0070680_100116930 3300005336 Bacteria 2223
15 Ga0070680_100417630 3300005336 Bacteria 1144
16 Ga0068868_100083699 3300005338 Bacteria 2562
17 Ga0068868_100110465 3300005338 Bacteria 2233
18 Ga0070689_101005418 3300005340 Bacteria 742
19 Ga0070661_100039927 3300005344 Bacteria 3421
20 Ga0070669_100003565 3300005353 Bacteria 11238
21 Ga0070671_100021620 3300005355 Bacteria 5255
22 Ga0070659_100472684 3300005366 Bacteria 1066
23 Ga0070667_100000176 3300005367 Bacteria 79346
24 Ga0070667_100014209 3300005367 Bacteria 6577
25 Ga0070667_100069768 3300005367 Bacteria 2991
26 Ga0070667_100396820 3300005367 Bacteria 1255
27 Ga0070713_100676904 3300005436 Bacteria 984
28 Ga0070713_101076390 3300005436 Bacteria 777
29 Ga0070710_10035185 3300005437 Bacteria 2730
30 Ga0070711_100036024 3300005439 Bacteria 3313
31 Ga0070705_100102848 3300005440 Bacteria 1807
32 Ga0070700_100016515 3300005441 Bacteria 4206
33 Ga0070694_100081594 3300005444 Bacteria 2250
34 Ga0070678_100684108 3300005456 Bacteria 923
35 Ga0070662_100002329 3300005457 Bacteria 11676
36 Ga0070681_10026195 3300005458 Bacteria 5862
37 Ga0070681_10103672 3300005458 Bacteria 2788
38 Ga0070679_100019743 3300005530 Bacteria 6559
39 Ga0070679_100118856 3300005530 Bacteria 2628
40 Ga0070679_100535092 3300005530 Bacteria 1115
41 Ga0070684_100033735 3300005535 Bacteria 4373
42 Ga0070684_100071785 3300005535 Bacteria 3046
43 Ga0070684_100985019 3300005535 Bacteria 791
44 Ga0070686_100013646 3300005544 Bacteria 4659
45 Ga0070693_100012636 3300005547 Bacteria 4277
46 Ga0070665_100005770 3300005548 Bacteria 12715
47 Ga0070665_100084971 3300005548 Bacteria 3170
48 Ga0070665_100093390 3300005548 Bacteria 3014
49 Ga0070665_100121861 3300005548 Bacteria 2609
50 Ga0070665_100155700 3300005548 Bacteria 2287
51 Ga0070665_101021193 3300005548 Bacteria 839
52 Ga0068855_100061090 3300005563 Bacteria 4404
53 Ga0068855_100086285 3300005563 Bacteria 3629
54 Ga0068855_100596891 3300005563 Bacteria 1191
55 Ga0070664_100334666 3300005564 Bacteria 1374
56 Ga0070664_100665143 3300005564 Bacteria 968
57 Ga0068857_100206849 3300005577 Bacteria 1790
58 Ga0068857_100219680 3300005577 Bacteria 1736
59 Ga0068854_100339437 3300005578 Bacteria 1226
60 Ga0068856_100019031 3300005614 Bacteria 6663
61 Ga0068856_100027123 3300005614 Bacteria 5588
62 Ga0068856_100102125 3300005614 Bacteria 2861
63 Ga0070702_101129335 3300005615 Bacteria 628
64 Ga0068852_100023002 3300005616 Bacteria 5008
65 Ga0068859_100000248 3300005617 Bacteria 53199
66 Ga0068859_100429284 3300005617 Bacteria 1418
67 Ga0068864_100015429 3300005618 Bacteria 6352
68 Ga0068866_10348147 3300005718 Bacteria 940
69 Ga0068866_10730805 3300005718 Bacteria 682
70 Ga0068861_100001422 3300005719 Bacteria 15079
71 Ga0068861_100043534 3300005719 Bacteria 3371
72 Ga0068851_10008325 3300005834 Bacteria 4794
73 Ga0068863_100016067 3300005841 Bacteria 7178
74 Ga0068863_100060526 3300005841 Bacteria 3581
75 Ga0068858_100036322 3300005842 Bacteria 4568
76 Ga0068858_100242820 3300005842 Bacteria 1709
77 Ga0068860_100005932 3300005843 Bacteria 12294
78 Ga0068860_100034525 3300005843 Bacteria 4852
79 Ga0068862_100000981 3300005844 Bacteria 27298
80 Ga0081455_10721053 3300005937 Bacteria 633
81 Ga0081540_1063176 3300005983 Bacteria 1754
82 Ga0081539_10000004 3300005985 Bacteria 555600
83 Ga0070716_100258073 3300006173 Bacteria 1191
84 Ga0070712_100034457 3300006175 Bacteria 3431
85 Ga0075366_10001024 3300006195 Bacteria 13705
86 Ga0097621_100001309 3300006237 Bacteria 17131
87 Ga0075370_10051809 3300006353 Bacteria 2328
88 Ga0068871_100005027 3300006358 Bacteria 9238
89 Ga0068871_100501082 3300006358 Bacteria 1094
90 Ga0075428_100083574 3300006844 Bacteria 3484
91 Ga0075430_100425376 3300006846 Bacteria 1096
92 Ga0075431_100261768 3300006847 Bacteria 1755
93 Ga0075431_100788280 3300006847 Bacteria 924
94 Ga0068865_100010533 3300006881 Bacteria 5759
95 Ga0068865_100012653 3300006881 Bacteria 5317
96 Ga0097620_100000248 3300006931 Bacteria 53199
97 Ga0097620_100429300 3300006931 Bacteria 1418
98 Ga0105240_10005331 3300009093 Bacteria 19184
99 Ga0105240_10016411 3300009093 Bacteria 10027
100 Ga0105240_10042125 3300009093 Bacteria 5821
101 Ga0105240_10053469 3300009093 Bacteria 5068
102 Ga0105240_10209540 3300009093 Bacteria 2278
103 Ga0105240_11426873 3300009093 Bacteria 727
104 Ga0111539_10063295 3300009094 Bacteria 4378
105 Ga0105245_10001367 3300009098 Bacteria 22086
106 Ga0105245_10113269 3300009098 Bacteria 2525
107 Ga0105247_10000222 3300009101 Bacteria 54538
108 Ga0105247_10827917 3300009101 Bacteria 708
109 Ga0114129_10199568 3300009147 Bacteria 2710
110 Ga0105243_10569991 3300009148 Bacteria 1085
111 Ga0105241_10018699 3300009174 Bacteria 5101
112 Ga0105242_10159146 3300009176 Bacteria 1975
113 Ga0105242_10769769 3300009176 Bacteria 950
114 Ga0105248_10051390 3300009177 Bacteria 4625
115 Ga0105248_10332150 3300009177 Bacteria 1712
116 Ga0105248_10642654 3300009177 Bacteria 1197
117 Ga0105248_11316666 3300009177 Bacteria 817
118 Ga0105237_10452940 3300009545 Bacteria 1289
119 Ga0105238_10027607 3300009551 Bacteria 5785
120 Ga0105238_10055897 3300009551 Bacteria 3960
121 Ga0105238_10076611 3300009551 Bacteria 3336
122 Ga0105238_10090919 3300009551 Bacteria 3040
123 Ga0105238_11955794 3300009551 Bacteria 620
124 Ga0105238_12015484 3300009551 Bacteria 611
125 Ga0105249_10012721 3300009553 Bacteria 7417
126 Ga0105239_10031358 3300010375 Bacteria 5847
127 Ga0105246_10229546 3300011119 Bacteria 1461
128 Ga0157373_10272557 3300013100 Bacteria 1198
129 Ga0157370_10174639 3300013104 Bacteria 1997
130 Ga0157370_10500637 3300013104 Bacteria 1116
131 Ga0157369_10002424 3300013105 Bacteria 22421
132 Ga0157369_10024097 3300013105 Bacteria 6773
133 Ga0157369_10045791 3300013105 Bacteria 4756
134 Ga0157369_10081004 3300013105 Bacteria 3475
135 Ga0157369_10284477 3300013105 Bacteria 1722
136 Ga0157369_10373572 3300013105 Bacteria 1480
137 Ga0157369_11905337 3300013105 Bacteria 603
138 Ga0157374_10054712 3300013296 Bacteria 3723
139 Ga0157374_10520751 3300013296 Bacteria 1195
140 Ga0157378_10486201 3300013297 Bacteria 1231
141 Ga0163162_10191861 3300013306 Bacteria 2171
142 Ga0163162_10669235 3300013306 Bacteria 1161
143 Ga0157372_10031010 3300013307 Bacteria 5852
144 Ga0157372_10413196 3300013307 Bacteria 1572
145 Ga0157375_11231415 3300013308 Bacteria 879
146 Ga0163163_10058647 3300014325 Bacteria 3806
147 Ga0163163_10745278 3300014325 Bacteria 1043
148 Ga0157379_10242001 3300014968 Bacteria 1637
149 Ga0157379_10327054 3300014968 Bacteria 1400
150 Ga0157376_10004036 3300014969 Bacteria 10152
151 Ga0157376_10515391 3300014969 Bacteria 1178
152 Ga0163161_10067262 3300017792 Bacteria 2617
153 Ga0206352_11261916 3300020078 Bacteria 808
154 Ga0207656_10050257 3300025321 Bacteria 1800
155 Ga0207642_10050845 3300025899 Bacteria 1872
156 Ga0207642_10466692 3300025899 Bacteria 767
157 Ga0207710_10000228 3300025900 Bacteria 48758
158 Ga0207710_10121735 3300025900 Bacteria 1247
159 Ga0207688_10231451 3300025901 Bacteria 1115
160 Ga0207685_10079459 3300025905 Bacteria 1353
161 Ga0207699_10969320 3300025906 Bacteria 628
162 Ga0207645_10024815 3300025907 Bacteria 3884
163 Ga0207705_10023435 3300025909 Bacteria 4403
164 Ga0207707_10009347 3300025912 Bacteria 8502
165 Ga0207707_10093098 3300025912 Bacteria 2633
166 Ga0207695_10039574 3300025913 Bacteria 5066
167 Ga0207695_10071173 3300025913 Bacteria 3552
168 Ga0207695_10199051 3300025913 Bacteria 1918
169 Ga0207695_10528047 3300025913 Bacteria 1062
170 Ga0207695_10619318 3300025913 Bacteria 963
171 Ga0207671_10116088 3300025914 Bacteria 2041
172 Ga0207671_10251426 3300025914 Bacteria 1389
173 Ga0207693_10001714 3300025915 Bacteria 19288
174 Ga0207663_10271147 3300025916 Bacteria 1257
175 Ga0207660_10370639 3300025917 Bacteria 1150
176 Ga0207660_11720607 3300025917 Bacteria 504
177 Ga0207649_10010631 3300025920 Bacteria 5060
178 Ga0207652_10045618 3300025921 Bacteria 3737
179 Ga0207694_10040693 3300025924 Bacteria 3580
180 Ga0207694_10056493 3300025924 Bacteria 3049
181 Ga0207650_10000307 3300025925 Bacteria 48369
182 Ga0207650_10145068 3300025925 Bacteria 1869
183 Ga0207650_10452694 3300025925 Bacteria 1068
184 Ga0207687_10104488 3300025927 Bacteria 2091
185 Ga0207700_10308020 3300025928 Bacteria 1369
186 Ga0207690_10522044 3300025932 Bacteria 963
187 Ga0207706_10005999 3300025933 Bacteria 11297
188 Ga0207709_10448314 3300025935 Bacteria 997
189 Ga0207704_10015930 3300025938 Bacteria 3847
190 Ga0207691_11218244 3300025940 Bacteria 624
191 Ga0207711_10002694 3300025941 Bacteria 15698
192 Ga0207689_10038630 3300025942 Bacteria 3953
193 Ga0207661_10252415 3300025944 Bacteria 1568
194 Ga0207679_10111691 3300025945 Bacteria 2158
195 Ga0207679_10548690 3300025945 Bacteria 1037
196 Ga0207667_10039394 3300025949 Bacteria 5037
197 Ga0207667_10425943 3300025949 Bacteria 1350
198 Ga0207712_10006969 3300025961 Bacteria 7130
199 Ga0207712_10058248 3300025961 Bacteria 2729
200 Ga0207712_10789527 3300025961 Bacteria 834
201 Ga0207658_10001423 3300025986 Bacteria 18665
202 Ga0207658_10016773 3300025986 Bacteria 5040
203 Ga0207658_10031433 3300025986 Bacteria 3769
204 Ga0207658_10994576 3300025986 Bacteria 765
205 Ga0207677_10066820 3300026023 Bacteria 2516
206 Ga0207677_10524604 3300026023 Bacteria 1028
207 Ga0207703_10097983 3300026035 Bacteria 2479
208 Ga0207639_10142682 3300026041 Bacteria 1997
209 Ga0207708_10032089 3300026075 Bacteria 3988
210 Ga0207702_10378594 3300026078 Bacteria 1361
211 Ga0207641_10009788 3300026088 Bacteria 7892
212 Ga0207641_10020013 3300026088 Bacteria 5495
213 Ga0207641_10253847 3300026088 Bacteria 1643
214 Ga0207641_11775677 3300026088 Bacteria 619
215 Ga0207676_10057166 3300026095 Bacteria 3071
216 Ga0207674_10148742 3300026116 Bacteria 2299
217 Ga0207674_10204280 3300026116 Bacteria 1925
218 Ga0207675_100005515 3300026118 Bacteria 12103
219 Ga0207675_100065428 3300026118 Bacteria 3398
220 Ga0207683_10027275 3300026121 Bacteria 4935
221 Ga0207698_10013837 3300026142 Bacteria 5341
222 Ga0207428_10082611 3300027907 Bacteria 2507
223 Ga0268266_10003586 3300028379 Bacteria 15365
224 Ga0268266_10065012 3300028379 Bacteria 3153
225 Ga0268266_10076692 3300028379 Bacteria 2905
226 Ga0268266_10189403 3300028379 Bacteria 1877
227 Ga0268265_10006626 3300028380 Bacteria 7839
228 Ga0268265_10036404 3300028380 Bacteria 3604
229 Ga0268265_10521121 3300028380 Bacteria 1124
230 Ga0268264_10018231 3300028381 Bacteria 5741
231 Ga0268264_10109228 3300028381 Bacteria 2419
232 Ga0268264_10591502 3300028381 Bacteria 1093
233 Ga0307515_10033937 3300028794 Bacteria 8379
234 Ga0307515_10308511 3300028794 Bacteria 1260
235 Ga0307515_10514550 3300028794 Bacteria 807
236 Ga0265328_10035370 3300031239 Bacteria 1847
237 Ga0307509_10000074 3300031507 Bacteria 140111
238 Ga0307509_10002247 3300031507 Bacteria 31612
239 Ga0307509_10489897 3300031507 Bacteria 916
240 Ga0307514_10196812 3300031649 Bacteria 1274
241 Ga0307413_10588538 3300031824 Bacteria 909
242 Ga0307410_10096857 3300031852 Bacteria 2107
243 Ga0307406_10012030 3300031901 Bacteria 4923
244 Ga0307407_10023499 3300031903 Bacteria 3218
245 Ga0307416_100162143 3300032002 Bacteria 2068
246 Ga0307411_10448356 3300032005 Bacteria 1079
247 Ga0307510_10000017 3300033180 Bacteria 195521
248 Ga0373944_0210228 3300035089 Bacteria 707
249 Ga0373923_0065075 3300035111 Bacteria 1556
250 Ga0373936_0205013 3300035113 Bacteria 871
251 Ga0373956_0086515 3300035119 Bacteria 1443
252 Ga0373927_0372514 3300035695 Bacteria 941
253 Ga0373925_0051285 3300037068 Bacteria 3080
254 Ga0395900_0278961 3300037418 Bacteria 1664
255 Ga0395900_0307044 3300037418 Bacteria 1571
256 Ga0395898_0039763 3300037466 Bacteria 4654
257 Ga0395898_0179588 3300037466 Bacteria 2023
258 Ga0436365_1567710 3300039437 Bacteria 657
259 Ga0436365_1820852 3300039437 Bacteria 2297
260 Ga0436361_0523597 3300039447 Bacteria 1475
261 Ga0451797_0026716 3300041453 Bacteria 983
262 Ga0466969_0017649 3300044656 Bacteria 3723
263 Ga0466972_0044354 3300044658 Bacteria 2157
264 Ga0466966_0004312 3300044684 Bacteria 9380
265 Ga0466966_0099595 3300044684 Bacteria 1798
266 Ga0466961_0019869 3300044693 Bacteria 4323
267 Ga0466963_0922630 3300044694 Bacteria 615
268 Ga0466971_0001167 3300044719 Bacteria 10920
269 Ga0466968_0181679 3300044735 Bacteria 978
270 Ga0466970_0001892 3300044765 Bacteria 10111
271 Ga0466970_0282697 3300044765 Bacteria 933
272 Ga0466957_0015125 3300044842 Bacteria 4504
273 Ga0466957_0376184 3300044842 Bacteria 968
274 Ga0466960_0106963 3300044901 Bacteria 1448
275 Ga0466959_0021171 3300045049 Bacteria 4793
276 Ga0466959_0035298 3300045049 Bacteria 3700
277 Ga0466959_0094627 3300045049 Bacteria 2143
278 Ga0495617_000949 3300046452 Bacteria 13451
279 Ga0495651_0627966 3300046462 Bacteria 675
280 Ga0495653_0067590 3300046463 Bacteria 2683
281 Ga0495650_0007093 3300046471 Bacteria 6805
282 Ga0495580_0000404 3300046472 Bacteria 35481
283 Ga0495585_0000406 3300046492 Bacteria 41715
284 Ga0495630_0360251 3300046517 Bacteria 1113
285 Ga0495632_0371405 3300046519 Bacteria 627
286 Ga0495648_0000057 3300046524 Bacteria 157446
287 Ga0495586_0298362 3300046535 Bacteria 923
288 Ga0495597_0000160 3300046542 Bacteria 59617
289 Ga0495671_0006909 3300046692 Bacteria 6513
290 Ga0495674_0694684 3300047319 Bacteria 799
291 Ga0495672_0024540 3300047320 Bacteria 3881
292 Ga0496100_0134468 3300048903 Bacteria 1745
293 Ga0496100_1546647 3300048903 Bacteria 524
294 Ga0496101_0293048 3300048904 Bacteria 1273
295 Ga0496101_0534928 3300048904 Bacteria 926
296 Ga0496102_0428634 3300048905 Bacteria 1242
297 Ga0496102_0609911 3300048905 Bacteria 1014
298 Ga0496105_0011743 3300048908 Bacteria 6931
299 Ga0496105_0037854 3300048908 Bacteria 3973
300 Ga0496106_0131076 3300048909 Bacteria 1966
301 Ga0496106_0135286 3300048909 Bacteria 1935
302 Ga0496108_0042938 3300048911 Bacteria 3775
303 Ga0496108_0090619 3300048911 Bacteria 2599
304 Ga0496108_0141050 3300048911 Bacteria 2076
305 Ga0496109_0034660 3300048912 Bacteria 4549
306 Ga0496109_0043807 3300048912 Bacteria 4057
307 Ga0496110_0131258 3300048913 Bacteria 2262
308 Ga0496110_1522619 3300048913 Bacteria 579
309 Ga0496111_0163309 3300048914 Bacteria 1654
310 Ga0496111_0301121 3300048914 Bacteria 1188
311 Ga0496112_0110142 3300048915 Bacteria 2724
312 Ga0496112_0120047 3300048915 Bacteria 2599
313 Ga0496113_0829716 3300048916 Bacteria 733
314 Ga0496113_0991879 3300048916 Bacteria 662
315 Ga0496115_0067922 3300048918 Bacteria 2884
316 Ga0496119_0000850 3300048922 Bacteria 40278
317 Ga0496119_0123702 3300048922 Bacteria 1418
318 Ga0496120_0000018 3300048923 Bacteria 263952
319 Ga0496120_0304543 3300048923 Bacteria 729
320 Ga0496121_0016710 3300048924 Bacteria 7551
321 Ga0496125_0048600 3300048928 Bacteria 3535
322 Ga0496126_0318091 3300048929 Bacteria 1280
323 Ga0501298_077777 3300049521 Bacteria 725
324 Ga0501032_0000071 3300049569 Bacteria 86150
325 Ga0501034_0000001 3300049571 Bacteria 2184493
326 Ga0501036_0030688 3300049572 Bacteria 4540
327 Ga0501039_0000001 3300049575 Bacteria 449008
328 Ga0501070_0279122 3300049586 Bacteria 1363
329 Ga0501072_0391476 3300049588 Bacteria 1103
330 Ga0501216_072293 3300049660 Bacteria 715
331 Ga0501217_238284 3300049661 Bacteria 582
332 Ga0501249_024113 3300049679 Bacteria 1339
333 Ga0501263_005709 3300049760 Bacteria 1414
334 Ga0501270_005444 3300049767 Bacteria 1480
335 Ga0501280_060327 3300049776 Bacteria 658
336 Ga0501283_008028 3300049779 Bacteria 1514
337 Ga0501226_038831 3300049853 Bacteria 547
338 nmdc:mga07m45_41201_c1 3300050496 Bacteria 2585
339 nmdc:mga07m45_70017_c1 3300050496 Bacteria 1995
340 nmdc:mga0qj67_226814_c1 3300050509 Bacteria 1516
341 nmdc:mga06r32_568028_c1 3300050510 Bacteria 1107
342 nmdc:mga06r32_850186_c1 3300050510 Bacteria 871
343 nmdc:mga08y16_49613_c1 3300050511 Bacteria 4393
344 Ga0500644_0009555 3300053088 Bacteria 2599
345 Ga0500583_0245547 3300053092 Bacteria 884
346 Ga0500651_0125223 3300053093 Bacteria 1557
347 Ga0500556_0159315 3300053104 Bacteria 891
348 Ga0500617_068569 3300053124 Bacteria 1558
349 Ga0500642_0066891 3300053130 Bacteria 1627
350 Ga0500588_0394589 3300053146 Bacteria 527
351 Ga0500622_0013524 3300053156 Bacteria 4403
352 Ga0500637_0017899 3300053178 Bacteria 3800
353 Ga0500656_029879 3300053732 Bacteria 720
354 Ga0501082_0365988 3300060353 Bacteria 1258
355 2516208139 2516143018 Bacteria 6951533
356 2587758564 2585428062 Bacteria 6842168
357 2939653602 2939651529 Bacteria 5895393
358 8056134939 8056131705 Bacteria 6107031
359 Ga0070683_101643857
360 Ga0058863_11832995
361 Ga0065715_10471790
362 Ga0070658_10056499
363 Ga0070658_10452641
364 Ga0070676_10048703
365 Ga0070683_100077260
366 Ga0070690_100029459
367 Ga0070670_100502928
368 Ga0068869_100300961
369 Ga0070666_10001027
370 Ga0070666_10058328
371 Ga0070666_10561723
372 Ga0070680_100116930
373 Ga0070680_100417630
374 Ga0068868_100083699
375 Ga0068868_100110465
376 Ga0070689_101005418
377 Ga0070661_100039927
378 Ga0070669_100003565
379 Ga0070671_100021620
380 Ga0070659_100472684
381 Ga0070667_100000176
382 Ga0070667_100014209
383 Ga0070667_100069768
384 Ga0070667_100396820
385 Ga0070713_100676904
386 Ga0070713_101076390
387 Ga0070710_10035185
388 Ga0070711_100036024
389 Ga0070705_100102848
390 Ga0070700_100016515
391 Ga0070694_100081594
392 Ga0070678_100684108
393 Ga0070662_100002329
394 Ga0070681_10026195
395 Ga0070681_10103672
396 Ga0070679_100019743
397 Ga0070679_100118856
398 Ga0070679_100535092
399 Ga0070684_100033735
400 Ga0070684_100071785
401 Ga0070684_100985019
402 Ga0070686_100013646
403 Ga0070693_100012636
404 Ga0070665_100005770
405 Ga0070665_100084971
406 Ga0070665_100093390
407 Ga0070665_100121861
408 Ga0070665_100155700
409 Ga0070665_101021193
410 Ga0068855_100061090
411 Ga0068855_100086285
412 Ga0068855_100596891
413 Ga0070664_100334666
414 Ga0070664_100665143
415 Ga0068857_100206849
416 Ga0068857_100219680
417 Ga0068854_100339437
418 Ga0068856_100019031
419 Ga0068856_100027123
420 Ga0068856_100102125
421 Ga0070702_101129335
422 Ga0068852_100023002
423 Ga0068859_100000248
424 Ga0068859_100429284
425 Ga0068864_100015429
426 Ga0068866_10348147
427 Ga0068866_10730805
428 Ga0068861_100001422
429 Ga0068861_100043534
430 Ga0068851_10008325
431 Ga0068863_100016067
432 Ga0068863_100060526
433 Ga0068858_100036322
434 Ga0068858_100242820
435 Ga0068860_100005932
436 Ga0068860_100034525
437 Ga0068862_100000981
438 Ga0081455_10721053
439 Ga0081540_1063176
440 Ga0081539_10000004
441 Ga0070716_100258073
442 Ga0070712_100034457
443 Ga0075366_10001024
444 Ga0097621_100001309
445 Ga0075370_10051809
446 Ga0068871_100005027
447 Ga0068871_100501082
448 Ga0075428_100083574
449 Ga0075430_100425376
450 Ga0075431_100261768
451 Ga0075431_100788280
452 Ga0068865_100010533
453 Ga0068865_100012653
454 Ga0097620_100000248
455 Ga0097620_100429300
456 Ga0105240_10005331
457 Ga0105240_10016411
458 Ga0105240_10042125
459 Ga0105240_10053469
460 Ga0105240_10209540
461 Ga0105240_11426873
462 Ga0111539_10063295
463 Ga0105245_10001367
464 Ga0105245_10113269
465 Ga0105247_10000222
466 Ga0105247_10827917
467 Ga0114129_10199568
468 Ga0105243_10569991
469 Ga0105241_10018699
470 Ga0105242_10159146
471 Ga0105242_10769769
472 Ga0105248_10051390
473 Ga0105248_10332150
474 Ga0105248_10642654
475 Ga0105248_11316666
476 Ga0105237_10452940
477 Ga0105238_10027607
478 Ga0105238_10055897
479 Ga0105238_10076611
480 Ga0105238_10090919
481 Ga0105238_11955794
482 Ga0105238_12015484
483 Ga0105249_10012721
484 Ga0105239_10031358
485 Ga0105246_10229546
486 Ga0157373_10272557
487 Ga0157370_10174639
488 Ga0157370_10500637
489 Ga0157369_10002424
490 Ga0157369_10024097
491 Ga0157369_10045791
492 Ga0157369_10081004
493 Ga0157369_10284477
494 Ga0157369_10373572
495 Ga0157369_11905337
496 Ga0157374_10054712
497 Ga0157374_10520751
498 Ga0157378_10486201
499 Ga0163162_10191861
500 Ga0163162_10669235
501 Ga0157372_10031010
502 Ga0157372_10413196
503 Ga0157375_11231415
504 Ga0163163_10058647
505 Ga0163163_10745278
506 Ga0157379_10242001
507 Ga0157379_10327054
508 Ga0157376_10004036
509 Ga0157376_10515391
510 Ga0163161_10067262
511 Ga0206352_11261916
512 Ga0207656_10050257
513 Ga0207642_10050845
514 Ga0207642_10466692
515 Ga0207710_10000228
516 Ga0207710_10121735
517 Ga0207688_10231451
518 Ga0207685_10079459
519 Ga0207699_10969320
520 Ga0207645_10024815
521 Ga0207705_10023435
522 Ga0207707_10009347
523 Ga0207707_10093098
524 Ga0207695_10039574
525 Ga0207695_10071173
526 Ga0207695_10199051
527 Ga0207695_10528047
528 Ga0207695_10619318
529 Ga0207671_10116088
530 Ga0207671_10251426
531 Ga0207693_10001714
532 Ga0207663_10271147
533 Ga0207660_10370639
534 Ga0207660_11720607
535 Ga0207649_10010631
536 Ga0207652_10045618
537 Ga0207694_10040693
538 Ga0207694_10056493
539 Ga0207650_10000307
540 Ga0207650_10145068
541 Ga0207650_10452694
542 Ga0207687_10104488
543 Ga0207700_10308020
544 Ga0207690_10522044
545 Ga0207706_10005999
546 Ga0207709_10448314
547 Ga0207704_10015930
548 Ga0207691_11218244
549 Ga0207711_10002694
550 Ga0207689_10038630
551 Ga0207661_10252415
552 Ga0207679_10111691
553 Ga0207679_10548690
554 Ga0207667_10039394
555 Ga0207667_10425943
556 Ga0207712_10006969
557 Ga0207712_10058248
558 Ga0207712_10789527
559 Ga0207658_10001423
560 Ga0207658_10016773
561 Ga0207658_10031433
562 Ga0207658_10994576
563 Ga0207677_10066820
564 Ga0207677_10524604
565 Ga0207703_10097983
566 Ga0207639_10142682
567 Ga0207708_10032089
568 Ga0207702_10378594
569 Ga0207641_10009788
570 Ga0207641_10020013
571 Ga0207641_10253847
572 Ga0207641_11775677
573 Ga0207676_10057166
574 Ga0207674_10148742
575 Ga0207674_10204280
576 Ga0207675_100005515
577 Ga0207675_100065428
578 Ga0207683_10027275
579 Ga0207698_10013837
580 Ga0207428_10082611
581 Ga0268266_10003586
582 Ga0268266_10065012
583 Ga0268266_10076692
584 Ga0268266_10189403
585 Ga0268265_10006626
586 Ga0268265_10036404
587 Ga0268265_10521121
588 Ga0268264_10018231
589 Ga0268264_10109228
590 Ga0268264_10591502
591 Ga0307515_10033937
592 Ga0307515_10308511
593 Ga0307515_10514550
594 Ga0265328_10035370
595 Ga0307509_10000074
596 Ga0307509_10002247
597 Ga0307509_10489897
598 Ga0307514_10196812
599 Ga0307413_10588538
600 Ga0307410_10096857
601 Ga0307406_10012030
602 Ga0307407_10023499
603 Ga0307416_100162143
604 Ga0307411_10448356
605 Ga0307510_10000017
606 Ga0373944_0210228
607 Ga0373923_0065075
608 Ga0373936_0205013
609 Ga0373956_0086515
610 Ga0373927_0372514
611 Ga0373925_0051285
612 Ga0395900_0278961
613 Ga0395900_0307044
614 Ga0395898_0039763
615 Ga0395898_0179588
616 Ga0436365_1567710
617 Ga0436365_1820852
618 Ga0436361_0523597
619 Ga0451797_0026716
620 Ga0466969_0017649
621 Ga0466972_0044354
622 Ga0466966_0004312
623 Ga0466966_0099595
624 Ga0466961_0019869
625 Ga0466963_0922630
626 Ga0466971_0001167
627 Ga0466968_0181679
628 Ga0466970_0001892
629 Ga0466970_0282697
630 Ga0466957_0015125
631 Ga0466957_0376184
632 Ga0466960_0106963
633 Ga0466959_0021171
634 Ga0466959_0035298
635 Ga0466959_0094627
636 Ga0495617_000949
637 Ga0495651_0627966
638 Ga0495653_0067590
639 Ga0495650_0007093
640 Ga0495580_0000404
641 Ga0495585_0000406
642 Ga0495630_0360251
643 Ga0495632_0371405
644 Ga0495648_0000057
645 Ga0495586_0298362
646 Ga0495597_0000160
647 Ga0495671_0006909
648 Ga0495674_0694684
649 Ga0495672_0024540
650 Ga0496100_0134468
651 Ga0496100_1546647
652 Ga0496101_0293048
653 Ga0496101_0534928
654 Ga0496102_0428634
655 Ga0496102_0609911
656 Ga0496105_0011743
657 Ga0496105_0037854
658 Ga0496106_0131076
659 Ga0496106_0135286
660 Ga0496108_0042938
661 Ga0496108_0090619
662 Ga0496108_0141050
663 Ga0496109_0034660
664 Ga0496109_0043807
665 Ga0496110_0131258
666 Ga0496110_1522619
667 Ga0496111_0163309
668 Ga0496111_0301121
669 Ga0496112_0110142
670 Ga0496112_0120047
671 Ga0496113_0829716
672 Ga0496113_0991879
673 Ga0496115_0067922
674 Ga0496119_0000850
675 Ga0496119_0123702
676 Ga0496120_0000018
677 Ga0496120_0304543
678 Ga0496121_0016710
679 Ga0496125_0048600
680 Ga0496126_0318091
681 Ga0501298_077777
682 Ga0501032_0000071
683 Ga0501034_0000001
684 Ga0501036_0030688
685 Ga0501039_0000001
686 Ga0501070_0279122
687 Ga0501072_0391476
688 Ga0501216_072293
689 Ga0501217_238284
690 Ga0501249_024113
691 Ga0501263_005709
692 Ga0501270_005444
693 Ga0501280_060327
694 Ga0501283_008028
695 Ga0501226_038831
696 nmdc:mga07m45_41201_c1
697 nmdc:mga07m45_70017_c1
698 nmdc:mga0qj67_226814_c1
699 nmdc:mga06r32_568028_c1
700 nmdc:mga06r32_850186_c1
701 nmdc:mga08y16_49613_c1
702 Ga0500644_0009555
703 Ga0500583_0245547
704 Ga0500651_0125223
705 Ga0500556_0159315
706 Ga0500617_068569
707 Ga0500642_0066891
708 Ga0500588_0394589
709 Ga0500622_0013524
710 Ga0500637_0017899
711 Ga0500656_029879
712 Ga0501082_0365988
713 2516208139
714 2587758564
715 2939653602
716 8056134939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

18

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9824 2 156
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9805 2 156
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.978 2 156
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9693 2 156
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9675 2 156
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9773 2 156 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9639 2 156 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7696 7 65 3.30.720.100
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7448 8 115 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.6878 7 65 3.30.720.100
ID Description Score Start End GO Terms
AF-A0A7Y5I041-F1-model_v4 VOC family protein 0.994 8 158
AF-A0A4Q3P670-F1-model_v4 deleted 0.994 82 158
AF-A0A7W8SVY4-F1-model_v4 2-polyprenyl-6-hydroxyphenyl methylase/3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.222, EC 2.1.1.64) 0.9912 31 158 GO:0032259
GO:0061542
GO:0102208
AF-A0A5C6C2W8-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9892 1 158
AF-A0A351VGI1-F1-model_v4 PhnB-like domain-containing protein 0.9892 2 115

Map