F420967

General Info

Members Datasets Scaffolds Average Seq Length
357 278 714 370

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0010192|Ga0496102_0010192_3115_4467
Length 450
Sequence MAATSAPKLDRFLNGFPANILSPPVTAGTLAVFCFTRVHNSAGWFFVQSFDGRRQRSQRIRPRRGGAGLYISGSIEYTRHMATTQRLPASLTPLDTALAALLHGVEPVTPIELPLTEALRCIAAEMPPLNAHPPRDIAAADGFALRARDLVGASSYSPLLLAAPPVWVEAGDAIPDGCDCVLDSDSVDSSGPLVQALAETIPGQGVRRAGGDIAAGSRVVEPGRRVRPRDLLIVRVAGIARLRVRRPRLRIVNIPGGTLTADLIAESARSAGTDIIRVTAEGRDAASIAKALDGNACDLILAVGGSGVGRTDATVTALAGRGEVIAHGIALQPGRTAAVGRIGKTPAIVLPGAPDHAFAAWWTLVLPVLDRLSGRRPRKTLNLPLARKIASSVGIAEIVLLERKQGAWVTLAVGGLSLDAIARAEAWLAVPGGAEGFAAGAGVDAYMLRE

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
56 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
81 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
82 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
181 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
185 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
186 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
187 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
188 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
189 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
190 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
191 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
192 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
193 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
194 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
195 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
196 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
197 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
198 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
199 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
200 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
201 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
202 2791355199
203 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
204 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
205 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
206 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
207 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
208 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
209 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
210 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
211 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
212 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
213 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
214 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
215 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
216 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
217 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
218 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
219 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
220 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
221 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
222 2904699407
223 2906610324
224 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
225 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
226 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
227 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
228 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
229 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
230 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
231 2922425934
232 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
233 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
234 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
235 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
236 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
237 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
238 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
239 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
240 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
241 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
242 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
243 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
244 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
245 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
246 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
247 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
248 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
249 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
250 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
251 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
252 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
253 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
254 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
255 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
256 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
257 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
258 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
259 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
260 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
261 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
262 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
263 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
264 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
265 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
266 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
267 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
268 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
269 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
270 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
271 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
272 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
273 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
274 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
275 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
276 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
277 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
278 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.22
Metatranscriptomes 0
Isolates 25.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 23.53
Rhizoplane 9.52
Rhizosphere 51.54
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0010192 3300048905 Bacteria 8077
2 rootH1_10056470 3300003323 Bacteria 1765
3 JGI25404J52841_10015606 3300003659 Bacteria 1648
4 Ga0070658_10061027 3300005327 Bacteria 3071
5 Ga0070683_100125339 3300005329 Bacteria 2428
6 Ga0070668_100065711 3300005347 Bacteria 2813
7 Ga0070674_100198445 3300005356 Bacteria 1548
8 Ga0070673_100070128 3300005364 Bacteria 2811
9 Ga0070667_100177126 3300005367 Bacteria 1885
10 Ga0070714_100123019 3300005435 Bacteria 2310
11 Ga0070713_100005380 3300005436 Bacteria 8746
12 Ga0070713_100426161 3300005436 Bacteria 1243
13 Ga0070710_10004139 3300005437 Bacteria 6884
14 Ga0070711_100103175 3300005439 Bacteria 2078
15 Ga0070711_100121337 3300005439 Bacteria 1934
16 Ga0070678_100018864 3300005456 Bacteria 4480
17 Ga0070681_10039622 3300005458 Bacteria 4722
18 Ga0070681_10423066 3300005458 Bacteria 1244
19 Ga0070699_100215346 3300005518 Bacteria 1711
20 Ga0070679_100036015 3300005530 Bacteria 4910
21 Ga0068853_100099432 3300005539 Bacteria 2570
22 Ga0070665_100102319 3300005548 Bacteria 2868
23 Ga0068855_100058917 3300005563 Bacteria 4495
24 Ga0068855_100112413 3300005563 Bacteria 3125
25 Ga0068856_100018079 3300005614 Bacteria 6834
26 Ga0068852_100244702 3300005616 Bacteria 1716
27 Ga0068859_100120244 3300005617 Bacteria 2693
28 Ga0068858_100074060 3300005842 Bacteria 3161
29 Ga0068862_100093458 3300005844 Bacteria 2622
30 Ga0068862_100134600 3300005844 Bacteria 2189
31 Ga0081540_1001855 3300005983 Bacteria 17700
32 Ga0081540_1004234 3300005983 Bacteria 11021
33 Ga0081540_1024606 3300005983 Bacteria 3491
34 Ga0081540_1025204 3300005983 Bacteria 3430
35 Ga0081540_1068861 3300005983 Bacteria 1647
36 Ga0081539_10000945 3300005985 Bacteria 54444
37 Ga0081539_10011033 3300005985 Bacteria 7226
38 Ga0070717_10003388 3300006028 Bacteria 11396
39 Ga0075365_10042678 3300006038 Bacteria 2966
40 Ga0070716_100166240 3300006173 Bacteria 1435
41 Ga0070712_100145373 3300006175 Bacteria 1814
42 Ga0075362_10012783 3300006177 Bacteria 3343
43 Ga0075367_10078371 3300006178 Bacteria 1995
44 Ga0075428_100107397 3300006844 Bacteria 3042
45 Ga0075434_100002567 3300006871 Bacteria 16035
46 Ga0075436_100069137 3300006914 Bacteria 2440
47 Ga0097620_100120232 3300006931 Bacteria 2693
48 Ga0111539_10110998 3300009094 Bacteria 3218
49 Ga0105245_10464339 3300009098 Bacteria 1277
50 Ga0114129_10096554 3300009147 Bacteria 4091
51 Ga0105248_10110186 3300009177 Bacteria 3104
52 Ga0105238_10292113 3300009551 Bacteria 1612
53 Ga0105239_10303488 3300010375 Bacteria 1798
54 Ga0105246_10080046 3300011119 Bacteria 2324
55 Ga0105246_10133437 3300011119 Bacteria 1858
56 Ga0105246_10163007 3300011119 Bacteria 1700
57 Ga0157369_10004231 3300013105 Bacteria 17000
58 Ga0157378_10119915 3300013297 Bacteria 2423
59 Ga0163162_10044983 3300013306 Bacteria 4422
60 Ga0163162_10233932 3300013306 Bacteria 1968
61 Ga0163162_10280811 3300013306 Bacteria 1797
62 Ga0157372_10012961 3300013307 Bacteria 8890
63 Ga0157375_10126957 3300013308 Bacteria 2667
64 Ga0157375_10197791 3300013308 Bacteria 2165
65 Ga0157375_10382703 3300013308 Bacteria 1574
66 Ga0163163_10056315 3300014325 Bacteria 3886
67 Ga0163163_10138180 3300014325 Bacteria 2478
68 Ga0163163_10288556 3300014325 Bacteria 1693
69 Ga0157377_10136097 3300014745 Bacteria 1505
70 Ga0157379_10054913 3300014968 Bacteria 3559
71 Ga0157379_10083941 3300014968 Bacteria 2855
72 Ga0157376_10043505 3300014969 Bacteria 3686
73 Ga0214542_1000773 3300021321 Bacteria 61121
74 Ga0214545_1000546 3300021324 Bacteria 61121
75 Ga0214543_1000740 3300021327 Bacteria 57975
76 Ga0213876_10002512 3300021384 Bacteria 10762
77 Ga0209673_1022212 3300025273 Bacteria 2195
78 Ga0209564_1006085 3300025295 Bacteria 6637
79 Ga0209758_1003904 3300025297 Bacteria 13015
80 Ga0209758_1013413 3300025297 Bacteria 4469
81 Ga0207692_10155754 3300025898 Bacteria 1312
82 Ga0207643_10011229 3300025908 Bacteria 4836
83 Ga0207663_10091235 3300025916 Bacteria 2022
84 Ga0207657_10147281 3300025919 Bacteria 1920
85 Ga0207657_10312811 3300025919 Bacteria 1243
86 Ga0207681_10094677 3300025923 Bacteria 2140
87 Ga0207659_10265289 3300025926 Bacteria 1399
88 Ga0207700_10310230 3300025928 Bacteria 1364
89 Ga0207664_10365741 3300025929 Bacteria 1278
90 Ga0207644_10101406 3300025931 Bacteria 2163
91 Ga0207665_10064547 3300025939 Bacteria 2488
92 Ga0207689_10040014 3300025942 Bacteria 3880
93 Ga0207689_10302275 3300025942 Bacteria 1326
94 Ga0207667_10069895 3300025949 Bacteria 3655
95 Ga0207667_10191779 3300025949 Bacteria 2097
96 Ga0207668_10081798 3300025972 Bacteria 2344
97 Ga0207668_10272319 3300025972 Bacteria 1384
98 Ga0207658_10111250 3300025986 Bacteria 2166
99 Ga0207703_10036903 3300026035 Bacteria 3892
100 Ga0207703_10173171 3300026035 Bacteria 1900
101 Ga0207639_10120755 3300026041 Bacteria 2152
102 Ga0207639_10125578 3300026041 Bacteria 2115
103 Ga0207702_10000052 3300026078 Bacteria 137784
104 Ga0207702_10079210 3300026078 Bacteria 2847
105 Ga0207675_100064831 3300026118 Bacteria 3415
106 Ga0207675_100087723 3300026118 Bacteria 2922
107 Ga0207675_100121602 3300026118 Bacteria 2471
108 Ga0207683_10152794 3300026121 Bacteria 2084
109 Ga0209589_1000007 3300027357 Bacteria 425699
110 Ga0209489_100008 3300027361 Bacteria 425699
111 Ga0209700_100009 3300027363 Bacteria 425699
112 Ga0268266_10000519 3300028379 Bacteria 54346
113 Ga0268266_10018748 3300028379 Bacteria 5895
114 Ga0268265_10044157 3300028380 Bacteria 3317
115 Ga0268265_10439661 3300028380 Bacteria 1215
116 Ga0268264_10451935 3300028381 Bacteria 1245
117 Ga0307517_10173795 3300028786 Bacteria 1408
118 Ga0265339_10001704 3300031249 Bacteria 16196
119 Ga0265331_10043383 3300031250 Bacteria 2179
120 Ga0265331_10065463 3300031250 Bacteria 1709
121 Ga0307513_10108921 3300031456 Bacteria 2769
122 Ga0265314_10002700 3300031711 Bacteria 17767
123 Ga0307516_10042066 3300031730 Bacteria 4535
124 Ga0307412_10085854 3300031911 Bacteria 2189
125 Ga0307411_10115106 3300032005 Bacteria 1933
126 Ga0307510_10005609 3300033180 Bacteria 14962
127 Ga0315911_1000031 3300033442 Bacteria 74171
128 Ga0373927_0054958 3300035695 Bacteria 2575
129 Ga0373933_0000106 3300035724 Bacteria 53181
130 Ga0373947_0178216 3300035725 Bacteria 1382
131 Ga0373925_0167035 3300037068 Bacteria 1735
132 Ga0395898_0019871 3300037466 Bacteria 6832
133 Ga0395898_0022935 3300037466 Bacteria 6311
134 Ga0436365_0160289 3300039437 Bacteria 39593
135 Ga0436363_0520596 3300039450 Bacteria 6670
136 Ga0436363_0671926 3300039450 Bacteria 1278
137 Ga0436362_1000225 3300039453 Bacteria 8762
138 Ga0466972_0000110 3300044658 Bacteria 71304
139 Ga0466965_0057584 3300044683 Bacteria 1937
140 Ga0466959_0075448 3300045049 Bacteria 2436
141 Ga0466967_0106480 3300045976 Bacteria 2570
142 Ga0466967_0414848 3300045976 Bacteria 1311
143 Ga0495590_0013139 3300046457 Bacteria 3051
144 Ga0495590_0033919 3300046457 Bacteria 1784
145 Ga0495638_0035668 3300046460 Bacteria 3169
146 Ga0495651_0103098 3300046462 Bacteria 2120
147 Ga0495605_0065512 3300046474 Bacteria 1728
148 Ga0495585_0080834 3300046492 Bacteria 1761
149 Ga0495606_0001387 3300046507 Bacteria 32754
150 Ga0495606_0161580 3300046507 Bacteria 1306
151 Ga0495610_0044631 3300046512 Bacteria 2199
152 Ga0495628_0294539 3300046516 Bacteria 1202
153 Ga0495644_0011683 3300046523 Bacteria 3381
154 Ga0495648_0021682 3300046524 Bacteria 4445
155 Ga0495609_0073491 3300046538 Bacteria 1500
156 Ga0495656_0002929 3300046615 Bacteria 5723
157 Ga0495656_0026520 3300046615 Bacteria 2307
158 Ga0495656_0029964 3300046615 Bacteria 2195
159 Ga0495668_0043193 3300046616 Bacteria 2508
160 Ga0495668_0065373 3300046616 Bacteria 2002
161 Ga0495625_0026880 3300046660 Bacteria 4340
162 Ga0495659_0025955 3300046664 Bacteria 2009
163 Ga0495672_0016844 3300047320 Bacteria 4904
164 Ga0495673_0021009 3300047469 Bacteria 3234
165 Ga0495686_0031075 3300047472 Bacteria 3465
166 Ga0496100_0023080 3300048903 Bacteria 3774
167 Ga0496100_0174350 3300048903 Bacteria 1551
168 Ga0496101_0010462 3300048904 Bacteria 6126
169 Ga0496102_0099296 3300048905 Bacteria 2702
170 Ga0496104_0003679 3300048907 Bacteria 13243
171 Ga0496104_0019617 3300048907 Bacteria 6189
172 Ga0496104_0121245 3300048907 Bacteria 2510
173 Ga0496104_0169835 3300048907 Bacteria 2091
174 Ga0496105_0004451 3300048908 Bacteria 10549
175 Ga0496105_0024651 3300048908 Bacteria 4889
176 Ga0496106_0004764 3300048909 Bacteria 10028
177 Ga0496107_0005436 3300048910 Bacteria 8721
178 Ga0496107_0021943 3300048910 Bacteria 4510
179 Ga0496107_0067358 3300048910 Bacteria 2597
180 Ga0496108_0001980 3300048911 Bacteria 16402
181 Ga0496108_0076881 3300048911 Bacteria 2822
182 Ga0496109_0012968 3300048912 Bacteria 7204
183 Ga0496109_0014368 3300048912 Bacteria 6889
184 Ga0496110_0005352 3300048913 Bacteria 10053
185 Ga0496110_0026977 3300048913 Bacteria 4920
186 Ga0496110_0047998 3300048913 Bacteria 3741
187 Ga0496110_0108258 3300048913 Bacteria 2495
188 Ga0496111_0031833 3300048914 Bacteria 3759
189 Ga0496112_0000057 3300048915 Bacteria 77700
190 Ga0496112_0004485 3300048915 Bacteria 11845
191 Ga0496112_0028641 3300048915 Bacteria 5378
192 Ga0496113_0169530 3300048916 Bacteria 1728
193 Ga0496114_0131665 3300048917 Bacteria 2160
194 Ga0496114_0136003 3300048917 Bacteria 2125
195 Ga0496114_0204382 3300048917 Bacteria 1731
196 Ga0496115_0069459 3300048918 Bacteria 2853
197 Ga0496115_0255088 3300048918 Bacteria 1443
198 Ga0496116_0009062 3300048919 Bacteria 8534
199 Ga0496117_0076135 3300048920 Bacteria 2226
200 Ga0496119_0031611 3300048922 Bacteria 3545
201 Ga0496121_0011016 3300048924 Bacteria 10094
202 Ga0496121_0029051 3300048924 Bacteria 5127
203 Ga0496124_0036386 3300048927 Bacteria 4295
204 Ga0496125_0000654 3300048928 Bacteria 57851
205 Ga0496125_0007037 3300048928 Bacteria 12025
206 Ga0496126_0001378 3300048929 Bacteria 38419
207 Ga0496126_0025256 3300048929 Bacteria 5720
208 Ga0496126_0030165 3300048929 Bacteria 5141
209 Ga0496126_0037854 3300048929 Bacteria 4494
210 Ga0496126_0048461 3300048929 Bacteria 3882
211 Ga0496126_0286982 3300048929 Bacteria 1362
212 Ga0495682_0032509 3300049460 Bacteria 1927
213 Ga0501032_0039479 3300049569 Bacteria 3210
214 Ga0501032_0074457 3300049569 Bacteria 2262
215 Ga0501033_0037658 3300049570 Bacteria 3619
216 Ga0501033_0117642 3300049570 Bacteria 1930
217 Ga0501034_0175847 3300049571 Bacteria 2106
218 Ga0501036_0075215 3300049572 Bacteria 2856
219 Ga0501037_0096086 3300049573 Bacteria 2141
220 Ga0501038_0074128 3300049574 Bacteria 2880
221 Ga0501038_0102701 3300049574 Bacteria 2378
222 Ga0501039_0094891 3300049575 Bacteria 2325
223 Ga0501042_0055277 3300049578 Bacteria 2832
224 Ga0501043_0060100 3300049579 Bacteria 2982
225 Ga0501043_0113616 3300049579 Bacteria 2126
226 Ga0501043_0200063 3300049579 Unclassified 1551
227 Ga0501046_0082405 3300049580 Bacteria 2484
228 Ga0501047_0043098 3300049581 Bacteria 4360
229 Ga0501048_0068193 3300049582 Bacteria 2513
230 Ga0501067_0002207 3300049583 Bacteria 10761
231 Ga0501067_0054028 3300049583 Bacteria 2225
232 Ga0501070_0030089 3300049586 Bacteria 4549
233 Ga0501070_0152071 3300049586 Bacteria 1909
234 Ga0501072_0179183 3300049588 Bacteria 1690
235 Ga0501073_0019250 3300049589 Bacteria 4931
236 Ga0501080_0073775 3300049742 Bacteria 3174
237 Ga0501080_0104955 3300049742 Bacteria 2620
238 Ga0501080_0242799 3300049742 Bacteria 1644
239 Ga0501083_0018340 3300049744 Bacteria 4877
240 Ga0501035_0002405 3300049822 Bacteria 18344
241 Ga0501035_0081734 3300049822 Bacteria 2851
242 Ga0501035_0111463 3300049822 Bacteria 2398
243 Ga0501044_0058856 3300049823 Bacteria 3939
244 Ga0501044_0097640 3300049823 Bacteria 2958
245 Ga0501044_0112753 3300049823 Bacteria 2726
246 Ga0501044_0122456 3300049823 Bacteria 2600
247 Ga0501045_0065101 3300049824 Bacteria 2676
248 nmdc:mga00v17_79707_c1 3300050491 Bacteria 2042
249 nmdc:mga0yw44_24701_c1 3300050492 Bacteria 3405
250 nmdc:mga08y16_424256_c1 3300050511 Bacteria 1359
251 nmdc:mga0rr50_185040_c1 3300050513 Bacteria 1704
252 nmdc:mga0sz30_36664_c2 3300050516 Unclassified 1463
253 Ga0495601_0060279 3300053077 Bacteria 2408
254 Ga0495595_0041053 3300053084 Bacteria 2116
255 Ga0495619_0015040 3300053085 Bacteria 4891
256 Ga0500555_009678 3300053103 Bacteria 2756
257 Ga0500557_000117 3300053105 Bacteria 22427
258 Ga0500642_0001978 3300053130 Bacteria 5946
259 Ga0500603_042426 3300053150 Bacteria 1219
260 Ga0500625_004013 3300053729 Bacteria 5932
261 Ga0501084_0112379 3300054114 Bacteria 2289
262 Ga0501082_0109915 3300060353 Bacteria 2386
263 2507506854 2507262055 Bacteria 8048963
264 2508696817 2508501042 Bacteria 8719808
265 2513655225 2513237096 Bacteria 8722461
266 2513677641 2513237098 Bacteria 9902361
267 2513693437 2513237101 Bacteria 7952346
268 2513861475 2513237137 Bacteria 9558895
269 2513915751 2513237145 Bacteria 8979722
270 2515629686 2515154112 Bacteria 8294334
271 2517894943 2517572143 Bacteria 9484767
272 2524464946 2524023210 Bacteria 9029266
273 2524534723 2524023228 Bacteria 10118060
274 2528853114 2528768022 Bacteria 10457665
275 2617377578 2617270741 Bacteria 8201522
276 2671123050 2667528175 Bacteria 7532676
277 2723848331 2721755755 Bacteria 8322773
278 2728748829 2728368998 Bacteria 8720350
279 2745078099 2744054633 Bacteria 8678936
280 2793073965 2791355197 Bacteria 8420563
281 2793079567
282 2857510827 2857509624 Bacteria 7472071
283 2874593999 2874590934 Bacteria 8299676
284 2874607448 2874604998 Bacteria 7834745
285 2874647930 2874645413 Bacteria 8214782
286 2876774135 2876771140 Bacteria 8287509
287 2876814768 2876808645 Bacteria 8824342
288 2876821087 2876818435 Bacteria 8274608
289 2879078912 2879074833 Bacteria 8279565
290 2879086128 2879083081 Bacteria 8587928
291 2879104834 2879099564 Bacteria 10442239
292 2879111083 2879110137 Bacteria 8907982
293 2879127929 2879127579 Bacteria 8294491
294 2879147653 2879142872 Bacteria 8267021
295 2885375366 2885374607 Bacteria 8927485
296 2885388793 2885383462 Bacteria 9473874
297 2889037123 2889033259 Bacteria 9099371
298 2903753357 2903748898 Bacteria 9972761
299 2903771154 2903768456 Bacteria 9749579
300 2904698019 2904690495 Bacteria 9412302
301 2904700132
302 2906611675
303 2906639655 2906635258 Bacteria 8601019
304 2906660602 2906660503 Bacteria 8595048
305 2908745261 2908739725 Bacteria 8628932
306 2908763057 2908756301 Bacteria 8864324
307 2908782386 2908775508 Bacteria 8092255
308 2922361269 2922361189 Bacteria 7436256
309 2922392901 2922386360 Bacteria 7017218
310 2922427670
311 2929621416 2929615660 Bacteria 9193770
312 2929631770 2929624759 Bacteria 9339455
313 2932815367 2932809354 Bacteria 9135765
314 2932824354 2932818245 Bacteria 9955613
315 2933583559 2933577622 Bacteria 9116884
316 2935615864 2935608549 Bacteria 8203142
317 2935632379 2935630451 Bacteria 8169952
318 2935653881 2935648319 Bacteria 8801166
319 2935662630 2935656913 Bacteria 8965014
320 2935683162 2935675223 Bacteria 9928132
321 2935702491 2935694250 Bacteria 9291695
322 2935765990 2935760218 Bacteria 9817913
323 2935815445 2935810662 Bacteria 9401221
324 2935826811 2935819856 Bacteria 8261050
325 2935853991 2935847175 Bacteria 8228321
326 2935914919 2935908558 Bacteria 8568796
327 2935923126 2935916978 Bacteria 9113783
328 2935932402 2935926038 Bacteria 8601059
329 2935941000 2935934488 Bacteria 8602579
330 2935949107 2935942939 Bacteria 8599779
331 2935957802 2935951376 Bacteria 8602333
332 2935974077 2935967501 Bacteria 8603075
333 2935981368 2935975950 Bacteria 8347125
334 2935990265 2935984226 Bacteria 8302647
335 2936015369 2936011229 Bacteria 8801034
336 2936024003 2936019824 Bacteria 8804134
337 2936033018 2936028420 Bacteria 8965941
338 2936040683 2936037263 Bacteria 9446081
339 2936051111 2936046547 Bacteria 8903709
340 2941508326 2941507105 Bacteria 8166816
341 2941515168 2941515067 Bacteria 8166720
342 2941524257 2941523033 Bacteria 8169134
343 3005477385 3005474847 Bacteria 9259049
344 8006933878 8006933436 Bacteria 10410654
345 8006969644 8006964411 Bacteria 8966052
346 8006983551 8006973647 Bacteria 10679141
347 8006990637 8006984368 Bacteria 9651211
348 8006998719 8006994254 Bacteria 8309700
349 8019559782 8019555841 Bacteria 9642137
350 8019569888 8019565922 Bacteria 9639779
351 8019620662 8019619141 Bacteria 9218857
352 8019632467 8019629233 Bacteria 8687553
353 8019669803 8019668869 Bacteria 8791617
354 8019686290 8019678201 Bacteria 8863603
355 8055744381 8055742211 Bacteria 9226248
356 8056676645 8056673599 Bacteria 7871253
357 8056689643 8056681323 Bacteria 8472857
358 Ga0496102_0010192
359 rootH1_10056470
360 JGI25404J52841_10015606
361 Ga0070658_10061027
362 Ga0070683_100125339
363 Ga0070668_100065711
364 Ga0070674_100198445
365 Ga0070673_100070128
366 Ga0070667_100177126
367 Ga0070714_100123019
368 Ga0070713_100005380
369 Ga0070713_100426161
370 Ga0070710_10004139
371 Ga0070711_100103175
372 Ga0070711_100121337
373 Ga0070678_100018864
374 Ga0070681_10039622
375 Ga0070681_10423066
376 Ga0070699_100215346
377 Ga0070679_100036015
378 Ga0068853_100099432
379 Ga0070665_100102319
380 Ga0068855_100058917
381 Ga0068855_100112413
382 Ga0068856_100018079
383 Ga0068852_100244702
384 Ga0068859_100120244
385 Ga0068858_100074060
386 Ga0068862_100093458
387 Ga0068862_100134600
388 Ga0081540_1001855
389 Ga0081540_1004234
390 Ga0081540_1024606
391 Ga0081540_1025204
392 Ga0081540_1068861
393 Ga0081539_10000945
394 Ga0081539_10011033
395 Ga0070717_10003388
396 Ga0075365_10042678
397 Ga0070716_100166240
398 Ga0070712_100145373
399 Ga0075362_10012783
400 Ga0075367_10078371
401 Ga0075428_100107397
402 Ga0075434_100002567
403 Ga0075436_100069137
404 Ga0097620_100120232
405 Ga0111539_10110998
406 Ga0105245_10464339
407 Ga0114129_10096554
408 Ga0105248_10110186
409 Ga0105238_10292113
410 Ga0105239_10303488
411 Ga0105246_10080046
412 Ga0105246_10133437
413 Ga0105246_10163007
414 Ga0157369_10004231
415 Ga0157378_10119915
416 Ga0163162_10044983
417 Ga0163162_10233932
418 Ga0163162_10280811
419 Ga0157372_10012961
420 Ga0157375_10126957
421 Ga0157375_10197791
422 Ga0157375_10382703
423 Ga0163163_10056315
424 Ga0163163_10138180
425 Ga0163163_10288556
426 Ga0157377_10136097
427 Ga0157379_10054913
428 Ga0157379_10083941
429 Ga0157376_10043505
430 Ga0214542_1000773
431 Ga0214545_1000546
432 Ga0214543_1000740
433 Ga0213876_10002512
434 Ga0209673_1022212
435 Ga0209564_1006085
436 Ga0209758_1003904
437 Ga0209758_1013413
438 Ga0207692_10155754
439 Ga0207643_10011229
440 Ga0207663_10091235
441 Ga0207657_10147281
442 Ga0207657_10312811
443 Ga0207681_10094677
444 Ga0207659_10265289
445 Ga0207700_10310230
446 Ga0207664_10365741
447 Ga0207644_10101406
448 Ga0207665_10064547
449 Ga0207689_10040014
450 Ga0207689_10302275
451 Ga0207667_10069895
452 Ga0207667_10191779
453 Ga0207668_10081798
454 Ga0207668_10272319
455 Ga0207658_10111250
456 Ga0207703_10036903
457 Ga0207703_10173171
458 Ga0207639_10120755
459 Ga0207639_10125578
460 Ga0207702_10000052
461 Ga0207702_10079210
462 Ga0207675_100064831
463 Ga0207675_100087723
464 Ga0207675_100121602
465 Ga0207683_10152794
466 Ga0209589_1000007
467 Ga0209489_100008
468 Ga0209700_100009
469 Ga0268266_10000519
470 Ga0268266_10018748
471 Ga0268265_10044157
472 Ga0268265_10439661
473 Ga0268264_10451935
474 Ga0307517_10173795
475 Ga0265339_10001704
476 Ga0265331_10043383
477 Ga0265331_10065463
478 Ga0307513_10108921
479 Ga0265314_10002700
480 Ga0307516_10042066
481 Ga0307412_10085854
482 Ga0307411_10115106
483 Ga0307510_10005609
484 Ga0315911_1000031
485 Ga0373927_0054958
486 Ga0373933_0000106
487 Ga0373947_0178216
488 Ga0373925_0167035
489 Ga0395898_0019871
490 Ga0395898_0022935
491 Ga0436365_0160289
492 Ga0436363_0520596
493 Ga0436363_0671926
494 Ga0436362_1000225
495 Ga0466972_0000110
496 Ga0466965_0057584
497 Ga0466959_0075448
498 Ga0466967_0106480
499 Ga0466967_0414848
500 Ga0495590_0013139
501 Ga0495590_0033919
502 Ga0495638_0035668
503 Ga0495651_0103098
504 Ga0495605_0065512
505 Ga0495585_0080834
506 Ga0495606_0001387
507 Ga0495606_0161580
508 Ga0495610_0044631
509 Ga0495628_0294539
510 Ga0495644_0011683
511 Ga0495648_0021682
512 Ga0495609_0073491
513 Ga0495656_0002929
514 Ga0495656_0026520
515 Ga0495656_0029964
516 Ga0495668_0043193
517 Ga0495668_0065373
518 Ga0495625_0026880
519 Ga0495659_0025955
520 Ga0495672_0016844
521 Ga0495673_0021009
522 Ga0495686_0031075
523 Ga0496100_0023080
524 Ga0496100_0174350
525 Ga0496101_0010462
526 Ga0496102_0099296
527 Ga0496104_0003679
528 Ga0496104_0019617
529 Ga0496104_0121245
530 Ga0496104_0169835
531 Ga0496105_0004451
532 Ga0496105_0024651
533 Ga0496106_0004764
534 Ga0496107_0005436
535 Ga0496107_0021943
536 Ga0496107_0067358
537 Ga0496108_0001980
538 Ga0496108_0076881
539 Ga0496109_0012968
540 Ga0496109_0014368
541 Ga0496110_0005352
542 Ga0496110_0026977
543 Ga0496110_0047998
544 Ga0496110_0108258
545 Ga0496111_0031833
546 Ga0496112_0000057
547 Ga0496112_0004485
548 Ga0496112_0028641
549 Ga0496113_0169530
550 Ga0496114_0131665
551 Ga0496114_0136003
552 Ga0496114_0204382
553 Ga0496115_0069459
554 Ga0496115_0255088
555 Ga0496116_0009062
556 Ga0496117_0076135
557 Ga0496119_0031611
558 Ga0496121_0011016
559 Ga0496121_0029051
560 Ga0496124_0036386
561 Ga0496125_0000654
562 Ga0496125_0007037
563 Ga0496126_0001378
564 Ga0496126_0025256
565 Ga0496126_0030165
566 Ga0496126_0037854
567 Ga0496126_0048461
568 Ga0496126_0286982
569 Ga0495682_0032509
570 Ga0501032_0039479
571 Ga0501032_0074457
572 Ga0501033_0037658
573 Ga0501033_0117642
574 Ga0501034_0175847
575 Ga0501036_0075215
576 Ga0501037_0096086
577 Ga0501038_0074128
578 Ga0501038_0102701
579 Ga0501039_0094891
580 Ga0501042_0055277
581 Ga0501043_0060100
582 Ga0501043_0113616
583 Ga0501043_0200063
584 Ga0501046_0082405
585 Ga0501047_0043098
586 Ga0501048_0068193
587 Ga0501067_0002207
588 Ga0501067_0054028
589 Ga0501070_0030089
590 Ga0501070_0152071
591 Ga0501072_0179183
592 Ga0501073_0019250
593 Ga0501080_0073775
594 Ga0501080_0104955
595 Ga0501080_0242799
596 Ga0501083_0018340
597 Ga0501035_0002405
598 Ga0501035_0081734
599 Ga0501035_0111463
600 Ga0501044_0058856
601 Ga0501044_0097640
602 Ga0501044_0112753
603 Ga0501044_0122456
604 Ga0501045_0065101
605 nmdc:mga00v17_79707_c1
606 nmdc:mga0yw44_24701_c1
607 nmdc:mga08y16_424256_c1
608 nmdc:mga0rr50_185040_c1
609 nmdc:mga0sz30_36664_c2
610 Ga0495601_0060279
611 Ga0495595_0041053
612 Ga0495619_0015040
613 Ga0500555_009678
614 Ga0500557_000117
615 Ga0500642_0001978
616 Ga0500603_042426
617 Ga0500625_004013
618 Ga0501084_0112379
619 Ga0501082_0109915
620 2507506854
621 2508696817
622 2513655225
623 2513677641
624 2513693437
625 2513861475
626 2513915751
627 2515629686
628 2517894943
629 2524464946
630 2524534723
631 2528853114
632 2617377578
633 2671123050
634 2723848331
635 2728748829
636 2745078099
637 2793073965
638 2793079567
639 2857510827
640 2874593999
641 2874607448
642 2874647930
643 2876774135
644 2876814768
645 2876821087
646 2879078912
647 2879086128
648 2879104834
649 2879111083
650 2879127929
651 2879147653
652 2885375366
653 2885388793
654 2889037123
655 2903753357
656 2903771154
657 2904698019
658 2904700132
659 2906611675
660 2906639655
661 2906660602
662 2908745261
663 2908763057
664 2908782386
665 2922361269
666 2922392901
667 2922427670
668 2929621416
669 2929631770
670 2932815367
671 2932824354
672 2933583559
673 2935615864
674 2935632379
675 2935653881
676 2935662630
677 2935683162
678 2935702491
679 2935765990
680 2935815445
681 2935826811
682 2935853991
683 2935914919
684 2935923126
685 2935932402
686 2935941000
687 2935949107
688 2935957802
689 2935974077
690 2935981368
691 2935990265
692 2936015369
693 2936024003
694 2936033018
695 2936040683
696 2936051111
697 2941508326
698 2941515168
699 2941524257
700 3005477385
701 8006933878
702 8006969644
703 8006983551
704 8006990637
705 8006998719
706 8019559782
707 8019569888
708 8019620662
709 8019632467
710 8019669803
711 8019686290
712 8055744381
713 8056676645
714 8056689643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

259

371

0.91

PF03453

MoeA_N

MoeA N-terminal region (domain I and II)

92

238

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi8-assembly1.cif.gz_B molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.8143 11 367
1xi8-assembly1.cif.gz_A molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.807 11 367
1xi8-assembly1.cif.gz_B molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.8059 11 367
1xi8-assembly1.cif.gz_A molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.7988 11 367
5ig9-assembly3.cif.gz_H crystal structure of macrocyclase mdnc bound with precursor peptide mdna from microcystis aeruginosa mrc 0.796 168 200
ID Description Score Start End Superfamily
af_Q58080_327_398_2.40.340.10 Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV 0.9263 298 369 2.40.340.10
af_Q58080_327_398_2.40.340.10 Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV 0.9141 298 369 2.40.340.10
af_Q2G1F5_23_163_3.10.105.10 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.911 166 199 3.10.105.10
1uz5A03 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.8823 53 132 2.170.190.11
1xi8A03 Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV 0.8792 296 367 2.40.340.10
ID Description Score Start End GO Terms
AF-A0A509ECE1-F1-model_v4 Uncharacterized protein 0.9542 221 368 GO:0032324
GO:0061599
AF-A0A5C8U3E3-F1-model_v4 deleted 0.9468 251 368
AF-A0A509ECE1-F1-model_v4 Uncharacterized protein 0.9419 221 368 GO:0032324
GO:0061599
AF-A0A5C8U3E3-F1-model_v4 deleted 0.9317 251 368
AF-A0A2C9D4P6-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9276 1 370 GO:0005829
GO:0006777
GO:0046872
GO:0061599

Map