F420934

General Info

Members Datasets Scaffolds Average Seq Length
357 174 714 129

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0670863|Ga0451576_0670863_400_885
Length 152
Sequence MIIAVACLIAVRAKDLPAPEPESPFKHLDDRKAAIYENLRDLQFEYRLGKLSDADYQTTKKDLQKELAVVLAEVDRLKAEIAVSAPGGRAAQSGQAASRSTQPAPNREAQPASAVKHAAAGAPAFVCDSCGASFPQDLKFCGECGKPMKVAK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 37.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0670863 3300045051 Bacteria 1089
2 Ga0058862_12341698 3300004803 Bacteria 735
3 Ga0070658_10001077 3300005327 Bacteria 23305
4 Ga0070658_10343779 3300005327 Bacteria 1276
5 Ga0070676_10727459 3300005328 Unclassified 727
6 Ga0070683_100720006 3300005329 Unclassified 956
7 Ga0070683_101316595 3300005329 Unclassified 694
8 Ga0070666_10322972 3300005335 Unclassified 1101
9 Ga0070666_10408350 3300005335 Unclassified 977
10 Ga0070666_10573859 3300005335 Bacteria 822
11 Ga0070680_100248571 3300005336 Unclassified 1503
12 Ga0070680_100735300 3300005336 Unclassified 849
13 Ga0070680_101454674 3300005336 Unclassified 593
14 Ga0070682_101049541 3300005337 Bacteria 679
15 Ga0068868_100132461 3300005338 Bacteria 2041
16 Ga0068868_100393316 3300005338 Unclassified 1195
17 Ga0070660_100013530 3300005339 Bacteria 5855
18 Ga0070660_100298732 3300005339 Bacteria 1320
19 Ga0070660_100538885 3300005339 Bacteria 973
20 Ga0070691_10076157 3300005341 Bacteria 1635
21 Ga0070691_10339416 3300005341 Bacteria 831
22 Ga0070692_10280663 3300005345 Unclassified 1009
23 Ga0070671_100111421 3300005355 Bacteria 2299
24 Ga0070673_100071277 3300005364 Bacteria 2792
25 Ga0070673_101464891 3300005364 Unclassified 643
26 Ga0070688_100348076 3300005365 Bacteria 1084
27 Ga0070688_100437645 3300005365 Unclassified 975
28 Ga0070659_100008658 3300005366 Bacteria 7443
29 Ga0070659_100027384 3300005366 Bacteria 4392
30 Ga0070659_100280448 3300005366 Unclassified 1386
31 Ga0070709_10638746 3300005434 Bacteria 823
32 Ga0070709_10830409 3300005434 Unclassified 727
33 Ga0070714_100062452 3300005435 Bacteria 3202
34 Ga0070714_100168365 3300005435 Bacteria 1987
35 Ga0070713_100022496 3300005436 Bacteria 4873
36 Ga0070713_100024868 3300005436 Bacteria 4673
37 Ga0070713_100413069 3300005436 Bacteria 1262
38 Ga0070701_10942119 3300005438 Unclassified 599
39 Ga0070678_100434672 3300005456 Bacteria 1147
40 Ga0070662_100632974 3300005457 Bacteria 901
41 Ga0070681_10147398 3300005458 Bacteria 2282
42 Ga0070681_10366408 3300005458 Bacteria 1351
43 Ga0070681_10801509 3300005458 Unclassified 859
44 Ga0070685_10390735 3300005466 Unclassified 961
45 Ga0070679_100035196 3300005530 Bacteria 4968
46 Ga0070679_100265662 3300005530 Unclassified 1671
47 Ga0070679_100370201 3300005530 Bacteria 1380
48 Ga0070679_100660984 3300005530 Bacteria 988
49 Ga0070684_100087105 3300005535 Bacteria 2773
50 Ga0070684_100426101 3300005535 Bacteria 1225
51 Ga0070684_100598633 3300005535 Unclassified 1025
52 Ga0068853_100339696 3300005539 Bacteria 1395
53 Ga0068853_102222289 3300005539 Unclassified 532
54 Ga0070693_101541543 3300005547 Bacteria 520
55 Ga0070665_100026091 3300005548 Bacteria 5883
56 Ga0070665_100177339 3300005548 Unclassified 2132
57 Ga0070665_100695318 3300005548 Bacteria 1030
58 Ga0070665_101002176 3300005548 Bacteria 848
59 Ga0068855_100002025 3300005563 Bacteria 25127
60 Ga0068855_100029190 3300005563 Bacteria 6596
61 Ga0068855_100075127 3300005563 Bacteria 3924
62 Ga0068855_100083108 3300005563 Bacteria 3710
63 Ga0068855_100197004 3300005563 Bacteria 2269
64 Ga0068855_100373820 3300005563 Bacteria 1566
65 Ga0070664_100052417 3300005564 Bacteria 3456
66 Ga0068856_100007803 3300005614 Bacteria 10452
67 Ga0068856_100011251 3300005614 Bacteria 8686
68 Ga0068856_100106002 3300005614 Bacteria 2805
69 Ga0068856_100389594 3300005614 Unclassified 1413
70 Ga0068856_100480068 3300005614 Bacteria 1264
71 Ga0068852_100040388 3300005616 Bacteria 3936
72 Ga0068852_100052676 3300005616 Bacteria 3498
73 Ga0068864_101259128 3300005618 Bacteria 739
74 Ga0068866_10417355 3300005718 Bacteria 870
75 Ga0068866_10962892 3300005718 Unclassified 604
76 Ga0068851_10155081 3300005834 Bacteria 1254
77 Ga0068863_100117714 3300005841 Bacteria 2532
78 Ga0068863_100652515 3300005841 Unclassified 1044
79 Ga0068863_100753008 3300005841 Unclassified 970
80 Ga0068863_101001185 3300005841 Unclassified 838
81 Ga0068858_100342891 3300005842 Unclassified 1430
82 Ga0068858_101434412 3300005842 Unclassified 680
83 Ga0068860_100232989 3300005843 Bacteria 1790
84 Ga0068860_100468138 3300005843 Unclassified 1255
85 Ga0068862_101194139 3300005844 Unclassified 759
86 Ga0081455_10253954 3300005937 Bacteria 1284
87 Ga0081455_10527376 3300005937 Bacteria 786
88 Ga0070717_10026198 3300006028 Unclassified 4649
89 Ga0070717_10049839 3300006028 Bacteria 3439
90 Ga0070716_100810080 3300006173 Unclassified 726
91 Ga0097621_100223665 3300006237 Bacteria 1641
92 Ga0097621_100856368 3300006237 Unclassified 845
93 Ga0097621_101065666 3300006237 Bacteria 758
94 Ga0068871_100132403 3300006358 Bacteria 2115
95 Ga0068871_100218706 3300006358 Bacteria 1649
96 Ga0068871_100297039 3300006358 Unclassified 1417
97 Ga0068871_100996420 3300006358 Unclassified 780
98 Ga0075433_10842675 3300006852 Unclassified 800
99 Ga0068865_100053030 3300006881 Bacteria 2813
100 Ga0068865_101686639 3300006881 Bacteria 571
101 Ga0075435_101814848 3300007076 Unclassified 535
102 Ga0105240_10000510 3300009093 Bacteria 71648
103 Ga0105240_10003032 3300009093 Bacteria 26423
104 Ga0105240_10070807 3300009093 Bacteria 4313
105 Ga0105240_10165183 3300009093 Bacteria 2626
106 Ga0105240_10672878 3300009093 Unclassified 1132
107 Ga0105240_11815815 3300009093 Unclassified 635
108 Ga0111539_10878711 3300009094 Bacteria 1043
109 Ga0105245_12625365 3300009098 Unclassified 557
110 Ga0105245_12759124 3300009098 Unclassified 544
111 Ga0105247_10198435 3300009101 Unclassified 1347
112 Ga0114129_10836070 3300009147 Unclassified 1172
113 Ga0105243_10517260 3300009148 Unclassified 1134
114 Ga0105241_10073504 3300009174 Bacteria 2660
115 Ga0105241_10410496 3300009174 Unclassified 1190
116 Ga0105241_10766229 3300009174 Bacteria 886
117 Ga0105242_10034531 3300009176 Bacteria 4055
118 Ga0105242_12218585 3300009176 Bacteria 594
119 Ga0105248_10041601 3300009177 Bacteria 5152
120 Ga0105248_10385563 3300009177 Bacteria 1578
121 Ga0105248_10753870 3300009177 Unclassified 1098
122 Ga0105248_10983026 3300009177 Bacteria 953
123 Ga0105248_11850805 3300009177 Unclassified 685
124 Ga0105237_10032448 3300009545 Bacteria 5287
125 Ga0105237_10036498 3300009545 Bacteria 4974
126 Ga0105237_10196001 3300009545 Unclassified 2020
127 Ga0105237_10562075 3300009545 Bacteria 1147
128 Ga0105237_10868433 3300009545 Unclassified 909
129 Ga0105237_12028445 3300009545 Bacteria 584
130 Ga0105238_10003557 3300009551 Bacteria 15531
131 Ga0105238_10192738 3300009551 Bacteria 2014
132 Ga0105238_10317179 3300009551 Bacteria 1544
133 Ga0105238_11145695 3300009551 Unclassified 801
134 Ga0105249_10030746 3300009553 Bacteria 4854
135 Ga0105249_11545270 3300009553 Unclassified 736
136 Ga0105239_10097814 3300010375 Bacteria 3244
137 Ga0105239_10720006 3300010375 Unclassified 1141
138 Ga0105239_12726171 3300010375 Bacteria 577
139 Ga0105246_12534570 3300011119 Unclassified 505
140 Ga0157373_10120315 3300013100 Bacteria 1845
141 Ga0157370_10004440 3300013104 Bacteria 16076
142 Ga0157370_10005944 3300013104 Bacteria 13596
143 Ga0157370_10101517 3300013104 Bacteria 2695
144 Ga0157370_10911490 3300013104 Unclassified 797
145 Ga0157370_11602866 3300013104 Bacteria 585
146 Ga0157369_10002955 3300013105 Bacteria 20325
147 Ga0157369_10046753 3300013105 Unclassified 4703
148 Ga0157369_10118043 3300013105 Bacteria 2816
149 Ga0157369_10137155 3300013105 Unclassified 2590
150 Ga0157369_10293153 3300013105 Unclassified 1693
151 Ga0157374_11049993 3300013296 Unclassified 834
152 Ga0157374_11063439 3300013296 Unclassified 829
153 Ga0157374_11388601 3300013296 Unclassified 725
154 Ga0157374_11791025 3300013296 Bacteria 639
155 Ga0157378_10217686 3300013297 Bacteria 1814
156 Ga0157378_10642248 3300013297 Bacteria 1076
157 Ga0157378_11150843 3300013297 Unclassified 814
158 Ga0157378_12664029 3300013297 Unclassified 552
159 Ga0163162_10121344 3300013306 Bacteria 2718
160 Ga0163162_11432731 3300013306 Unclassified 786
161 Ga0163162_12980988 3300013306 Bacteria 544
162 Ga0157372_10014228 3300013307 Bacteria 8503
163 Ga0157372_10069381 3300013307 Bacteria 3964
164 Ga0157372_10139275 3300013307 Unclassified 2794
165 Ga0157372_10222837 3300013307 Bacteria 2186
166 Ga0157372_10445335 3300013307 Bacteria 1509
167 Ga0157372_10464586 3300013307 Bacteria 1475
168 Ga0157375_10781174 3300013308 Unclassified 1105
169 Ga0157375_10800355 3300013308 Bacteria 1091
170 Ga0163163_10450968 3300014325 Bacteria 1346
171 Ga0163163_10467944 3300014325 Unclassified 1321
172 Ga0163163_10733047 3300014325 Bacteria 1052
173 Ga0163163_11216380 3300014325 Unclassified 816
174 Ga0157379_11232303 3300014968 Bacteria 720
175 Ga0157376_10046160 3300014969 Bacteria 3591
176 Ga0157376_10154133 3300014969 Bacteria 2075
177 Ga0157376_11541657 3300014969 Unclassified 698
178 Ga0163161_10431865 3300017792 Bacteria 1061
179 Ga0213873_10055865 3300021358 Unclassified 1057
180 Ga0213872_10010853 3300021361 Bacteria 4322
181 Ga0213872_10154995 3300021361 Bacteria 999
182 Ga0213874_10337242 3300021377 Bacteria 575
183 Ga0213876_10346824 3300021384 Bacteria 790
184 Ga0213875_10000136 3300021388 Bacteria 81423
185 Ga0213875_10003283 3300021388 Bacteria 9264
186 Ga0213875_10076315 3300021388 Unclassified 1564
187 Ga0213875_10117543 3300021388 Unclassified 1242
188 Ga0207642_10386668 3300025899 Bacteria 834
189 Ga0207680_10275080 3300025903 Unclassified 1169
190 Ga0207680_10529347 3300025903 Unclassified 841
191 Ga0207699_10636193 3300025906 Bacteria 778
192 Ga0207705_10001516 3300025909 Bacteria 18433
193 Ga0207684_10154324 3300025910 Bacteria 1976
194 Ga0207684_11071709 3300025910 Bacteria 672
195 Ga0207707_10089085 3300025912 Bacteria 2696
196 Ga0207695_10002261 3300025913 Bacteria 28829
197 Ga0207695_10005509 3300025913 Bacteria 16757
198 Ga0207695_10380086 3300025913 Unclassified 1298
199 Ga0207695_11241672 3300025913 Unclassified 625
200 Ga0207671_10008455 3300025914 Bacteria 8726
201 Ga0207671_10219398 3300025914 Bacteria 1489
202 Ga0207671_10372318 3300025914 Unclassified 1134
203 Ga0207660_10058218 3300025917 Unclassified 2770
204 Ga0207660_10361099 3300025917 Unclassified 1165
205 Ga0207660_11329563 3300025917 Unclassified 583
206 Ga0207657_10226738 3300025919 Unclassified 1495
207 Ga0207657_10250505 3300025919 Unclassified 1412
208 Ga0207652_10467204 3300025921 Unclassified 1137
209 Ga0207652_11073785 3300025921 Unclassified 705
210 Ga0207694_10019270 3300025924 Bacteria 5158
211 Ga0207694_10348869 3300025924 Unclassified 1225
212 Ga0207694_10503690 3300025924 Bacteria 1014
213 Ga0207694_11360866 3300025924 Bacteria 600
214 Ga0207687_10406158 3300025927 Bacteria 1121
215 Ga0207700_10039728 3300025928 Bacteria 3427
216 Ga0207700_10089465 3300025928 Bacteria 2427
217 Ga0207700_10405717 3300025928 Unclassified 1195
218 Ga0207664_10446678 3300025929 Bacteria 1154
219 Ga0207690_10047433 3300025932 Bacteria 2851
220 Ga0207690_10155966 3300025932 Bacteria 1697
221 Ga0207686_10049602 3300025934 Bacteria 2606
222 Ga0207704_10100776 3300025938 Unclassified 1925
223 Ga0207691_10511488 3300025940 Bacteria 1019
224 Ga0207711_10039418 3300025941 Bacteria 4019
225 Ga0207711_10130853 3300025941 Bacteria 2250
226 Ga0207711_10212830 3300025941 Bacteria 1766
227 Ga0207661_10071561 3300025944 Bacteria 2834
228 Ga0207661_11691125 3300025944 Unclassified 578
229 Ga0207661_12119970 3300025944 Bacteria 508
230 Ga0207679_10116087 3300025945 Unclassified 2122
231 Ga0207667_10009978 3300025949 Bacteria 11140
232 Ga0207667_10014445 3300025949 Bacteria 9002
233 Ga0207667_10023682 3300025949 Bacteria 6759
234 Ga0207667_10029131 3300025949 Bacteria 5990
235 Ga0207667_10137740 3300025949 Bacteria 2513
236 Ga0207667_10701928 3300025949 Bacteria 1014
237 Ga0207667_10721912 3300025949 Bacteria 998
238 Ga0207651_10310252 3300025960 Unclassified 1315
239 Ga0207651_11860248 3300025960 Unclassified 541
240 Ga0207640_11529553 3300025981 Bacteria 600
241 Ga0207658_10428160 3300025986 Unclassified 1168
242 Ga0207658_10961277 3300025986 Unclassified 779
243 Ga0207677_10353004 3300026023 Unclassified 1233
244 Ga0207677_12155122 3300026023 Unclassified 518
245 Ga0207703_11225186 3300026035 Bacteria 721
246 Ga0207639_11229461 3300026041 Bacteria 703
247 Ga0207708_11020795 3300026075 Unclassified 719
248 Ga0207702_10006043 3300026078 Bacteria 10506
249 Ga0207702_10044372 3300026078 Unclassified 3736
250 Ga0207702_10103662 3300026078 Bacteria 2516
251 Ga0207702_10728305 3300026078 Bacteria 978
252 Ga0207641_10097722 3300026088 Bacteria 2581
253 Ga0207641_10994061 3300026088 Unclassified 835
254 Ga0207648_10037470 3300026089 Bacteria 4271
255 Ga0207674_11357313 3300026116 Bacteria 680
256 Ga0207683_10453589 3300026121 Unclassified 1182
257 Ga0207698_10177945 3300026142 Bacteria 1880
258 Ga0207698_12545667 3300026142 Bacteria 522
259 Ga0268266_10154764 3300028379 Unclassified 2070
260 Ga0268266_10327652 3300028379 Bacteria 1435
261 Ga0268266_10627625 3300028379 Unclassified 1033
262 Ga0268265_10126083 3300028380 Viruses 2119
263 Ga0268264_10007129 3300028381 Bacteria 9368
264 Ga0265323_10000589 3300028653 Bacteria 19976
265 Ga0265338_10077155 3300028800 Bacteria 2818
266 Ga0265760_10076530 3300031090 Unclassified 1032
267 Ga0265330_10086216 3300031235 Unclassified 1350
268 Ga0265330_10173526 3300031235 Bacteria 914
269 Ga0265325_10220762 3300031241 Bacteria 867
270 Ga0265340_10044992 3300031247 Bacteria 2158
271 Ga0265331_10174954 3300031250 Unclassified 970
272 Ga0265316_10014128 3300031344 Bacteria 7044
273 Ga0265316_10223412 3300031344 Bacteria 1389
274 Ga0265316_10321856 3300031344 Unclassified 1123
275 Ga0265316_10430680 3300031344 Unclassified 947
276 Ga0265313_10001799 3300031595 Bacteria 19597
277 Ga0265314_10001307 3300031711 Bacteria 28236
278 Ga0307416_101379349 3300032002 Bacteria 811
279 Ga0307416_102675890 3300032002 Unclassified 596
280 Ga0373954_0258505 3300035118 Bacteria 858
281 Ga0373931_0124692 3300035691 Bacteria 1476
282 Ga0373935_1137423 3300035692 Unclassified 581
283 Ga0373927_0411062 3300035695 Bacteria 893
284 Ga0373927_0700964 3300035695 Bacteria 669
285 Ga0373933_0236971 3300035724 Bacteria 1173
286 Ga0373947_0884153 3300035725 Bacteria 610
287 Ga0373937_0674354 3300036401 Unclassified 980
288 Ga0373937_1692668 3300036401 Bacteria 579
289 Ga0373925_0115843 3300037068 Bacteria 2075
290 Ga0373925_0227916 3300037068 Bacteria 1489
291 Ga0373925_1036731 3300037068 Bacteria 675
292 Ga0373925_1586236 3300037068 Unclassified 535
293 Ga0395900_0280943 3300037418 Bacteria 1657
294 Ga0395900_1035484 3300037418 Bacteria 740
295 Ga0436364_0182643 3300037853 Bacteria 5928
296 Ga0436364_0190449 3300037853 Unclassified 584
297 Ga0436364_0261139 3300037853 Bacteria 27311
298 Ga0436364_0265928 3300037853 Bacteria 82453
299 Ga0436364_0413048 3300037853 Bacteria 5712
300 Ga0436364_0760420 3300037853 Unclassified 859
301 Ga0436364_1187734 3300037853 Unclassified 1594
302 Ga0436364_1430014 3300037853 Bacteria 6097
303 Ga0436365_0873679 3300039437 Bacteria 4511
304 Ga0436361_0343205 3300039447 Bacteria 1019
305 Ga0436361_0508844 3300039447 Bacteria 1853
306 Ga0436361_0711323 3300039447 Bacteria 2698
307 Ga0436363_0302820 3300039450 Bacteria 1747
308 Ga0436363_0477181 3300039450 Bacteria 637
309 Ga0436363_0806835 3300039450 Bacteria 1316
310 Ga0436363_0845266 3300039450 Unclassified 676
311 Ga0436362_0937099 3300039453 Bacteria 1067
312 Ga0451577_0304096 3300042876 Bacteria 1445
313 Ga0466963_0251855 3300044694 Unclassified 1239
314 Ga0466963_0702056 3300044694 Bacteria 714
315 Ga0466963_1239979 3300044694 Unclassified 524
316 Ga0451576_0123485 3300045051 Bacteria 2697
317 Ga0451576_0764287 3300045051 Bacteria 1015
318 Ga0451576_1176822 3300045051 Unclassified 801
319 Ga0466967_0664490 3300045976 Unclassified 1031
320 Ga0466967_1039501 3300045976 Bacteria 816
321 Ga0495592_0142169 3300046454 Unclassified 1668
322 Ga0495651_0342239 3300046462 Bacteria 991
323 Ga0495653_0244879 3300046463 Unclassified 1193
324 Ga0495580_0042431 3300046472 Bacteria 3241
325 Ga0495580_0150385 3300046472 Unclassified 1613
326 Ga0495580_0150479 3300046472 Bacteria 1613
327 Ga0495580_0249221 3300046472 Bacteria 1216
328 Ga0495580_0434602 3300046472 Unclassified 882
329 Ga0495664_0362090 3300046477 Bacteria 873
330 Ga0495628_0197722 3300046516 Unclassified 1516
331 Ga0495628_0255814 3300046516 Bacteria 1306
332 Ga0495652_1158837 3300046529 Unclassified 500
333 Ga0495665_0479312 3300046531 Bacteria 628
334 Ga0495587_0001900 3300046536 Bacteria 13915
335 Ga0495667_0046260 3300046559 Bacteria 2878
336 Ga0495635_0913506 3300046663 Unclassified 562
337 Ga0495646_0408357 3300046680 Bacteria 705
338 Ga0495658_0224429 3300046683 Unclassified 1177
339 Ga0495669_0096832 3300046684 Bacteria 1367
340 Ga0495669_0666377 3300046684 Unclassified 506
341 Ga0495604_0403830 3300047317 Unclassified 899
342 Ga0495674_0079651 3300047319 Bacteria 2813
343 Ga0495674_0236057 3300047319 Unclassified 1508
344 Ga0495684_0030505 3300047471 Bacteria 4140
345 Ga0495602_0088487 3300048088 Bacteria 2578
346 Ga0495602_0267752 3300048088 Bacteria 1264
347 Ga0496104_0868734 3300048907 Bacteria 807
348 Ga0496104_1164625 3300048907 Bacteria 674
349 Ga0496112_0125671 3300048915 Bacteria 2536
350 Ga0496115_0733044 3300048918 Bacteria 774
351 Ga0501047_0377306 3300049581 Unclassified 1253
352 Ga0501045_0429445 3300049824 Bacteria 983
353 nmdc:mga05p37_1513374_c1 3300050507 Unclassified 667
354 nmdc:mga08y16_742667_c1 3300050511 Bacteria 978
355 nmdc:mga0rr50_1689744_c1 3300050513 Unclassified 534
356 nmdc:mga0a205_758036_c1 3300050515 Unclassified 819
357 Ga0466962_0296267 3300061719 Unclassified 800
358 Ga0451576_0670863
359 Ga0058862_12341698
360 Ga0070658_10001077
361 Ga0070658_10343779
362 Ga0070676_10727459
363 Ga0070683_100720006
364 Ga0070683_101316595
365 Ga0070666_10322972
366 Ga0070666_10408350
367 Ga0070666_10573859
368 Ga0070680_100248571
369 Ga0070680_100735300
370 Ga0070680_101454674
371 Ga0070682_101049541
372 Ga0068868_100132461
373 Ga0068868_100393316
374 Ga0070660_100013530
375 Ga0070660_100298732
376 Ga0070660_100538885
377 Ga0070691_10076157
378 Ga0070691_10339416
379 Ga0070692_10280663
380 Ga0070671_100111421
381 Ga0070673_100071277
382 Ga0070673_101464891
383 Ga0070688_100348076
384 Ga0070688_100437645
385 Ga0070659_100008658
386 Ga0070659_100027384
387 Ga0070659_100280448
388 Ga0070709_10638746
389 Ga0070709_10830409
390 Ga0070714_100062452
391 Ga0070714_100168365
392 Ga0070713_100022496
393 Ga0070713_100024868
394 Ga0070713_100413069
395 Ga0070701_10942119
396 Ga0070678_100434672
397 Ga0070662_100632974
398 Ga0070681_10147398
399 Ga0070681_10366408
400 Ga0070681_10801509
401 Ga0070685_10390735
402 Ga0070679_100035196
403 Ga0070679_100265662
404 Ga0070679_100370201
405 Ga0070679_100660984
406 Ga0070684_100087105
407 Ga0070684_100426101
408 Ga0070684_100598633
409 Ga0068853_100339696
410 Ga0068853_102222289
411 Ga0070693_101541543
412 Ga0070665_100026091
413 Ga0070665_100177339
414 Ga0070665_100695318
415 Ga0070665_101002176
416 Ga0068855_100002025
417 Ga0068855_100029190
418 Ga0068855_100075127
419 Ga0068855_100083108
420 Ga0068855_100197004
421 Ga0068855_100373820
422 Ga0070664_100052417
423 Ga0068856_100007803
424 Ga0068856_100011251
425 Ga0068856_100106002
426 Ga0068856_100389594
427 Ga0068856_100480068
428 Ga0068852_100040388
429 Ga0068852_100052676
430 Ga0068864_101259128
431 Ga0068866_10417355
432 Ga0068866_10962892
433 Ga0068851_10155081
434 Ga0068863_100117714
435 Ga0068863_100652515
436 Ga0068863_100753008
437 Ga0068863_101001185
438 Ga0068858_100342891
439 Ga0068858_101434412
440 Ga0068860_100232989
441 Ga0068860_100468138
442 Ga0068862_101194139
443 Ga0081455_10253954
444 Ga0081455_10527376
445 Ga0070717_10026198
446 Ga0070717_10049839
447 Ga0070716_100810080
448 Ga0097621_100223665
449 Ga0097621_100856368
450 Ga0097621_101065666
451 Ga0068871_100132403
452 Ga0068871_100218706
453 Ga0068871_100297039
454 Ga0068871_100996420
455 Ga0075433_10842675
456 Ga0068865_100053030
457 Ga0068865_101686639
458 Ga0075435_101814848
459 Ga0105240_10000510
460 Ga0105240_10003032
461 Ga0105240_10070807
462 Ga0105240_10165183
463 Ga0105240_10672878
464 Ga0105240_11815815
465 Ga0111539_10878711
466 Ga0105245_12625365
467 Ga0105245_12759124
468 Ga0105247_10198435
469 Ga0114129_10836070
470 Ga0105243_10517260
471 Ga0105241_10073504
472 Ga0105241_10410496
473 Ga0105241_10766229
474 Ga0105242_10034531
475 Ga0105242_12218585
476 Ga0105248_10041601
477 Ga0105248_10385563
478 Ga0105248_10753870
479 Ga0105248_10983026
480 Ga0105248_11850805
481 Ga0105237_10032448
482 Ga0105237_10036498
483 Ga0105237_10196001
484 Ga0105237_10562075
485 Ga0105237_10868433
486 Ga0105237_12028445
487 Ga0105238_10003557
488 Ga0105238_10192738
489 Ga0105238_10317179
490 Ga0105238_11145695
491 Ga0105249_10030746
492 Ga0105249_11545270
493 Ga0105239_10097814
494 Ga0105239_10720006
495 Ga0105239_12726171
496 Ga0105246_12534570
497 Ga0157373_10120315
498 Ga0157370_10004440
499 Ga0157370_10005944
500 Ga0157370_10101517
501 Ga0157370_10911490
502 Ga0157370_11602866
503 Ga0157369_10002955
504 Ga0157369_10046753
505 Ga0157369_10118043
506 Ga0157369_10137155
507 Ga0157369_10293153
508 Ga0157374_11049993
509 Ga0157374_11063439
510 Ga0157374_11388601
511 Ga0157374_11791025
512 Ga0157378_10217686
513 Ga0157378_10642248
514 Ga0157378_11150843
515 Ga0157378_12664029
516 Ga0163162_10121344
517 Ga0163162_11432731
518 Ga0163162_12980988
519 Ga0157372_10014228
520 Ga0157372_10069381
521 Ga0157372_10139275
522 Ga0157372_10222837
523 Ga0157372_10445335
524 Ga0157372_10464586
525 Ga0157375_10781174
526 Ga0157375_10800355
527 Ga0163163_10450968
528 Ga0163163_10467944
529 Ga0163163_10733047
530 Ga0163163_11216380
531 Ga0157379_11232303
532 Ga0157376_10046160
533 Ga0157376_10154133
534 Ga0157376_11541657
535 Ga0163161_10431865
536 Ga0213873_10055865
537 Ga0213872_10010853
538 Ga0213872_10154995
539 Ga0213874_10337242
540 Ga0213876_10346824
541 Ga0213875_10000136
542 Ga0213875_10003283
543 Ga0213875_10076315
544 Ga0213875_10117543
545 Ga0207642_10386668
546 Ga0207680_10275080
547 Ga0207680_10529347
548 Ga0207699_10636193
549 Ga0207705_10001516
550 Ga0207684_10154324
551 Ga0207684_11071709
552 Ga0207707_10089085
553 Ga0207695_10002261
554 Ga0207695_10005509
555 Ga0207695_10380086
556 Ga0207695_11241672
557 Ga0207671_10008455
558 Ga0207671_10219398
559 Ga0207671_10372318
560 Ga0207660_10058218
561 Ga0207660_10361099
562 Ga0207660_11329563
563 Ga0207657_10226738
564 Ga0207657_10250505
565 Ga0207652_10467204
566 Ga0207652_11073785
567 Ga0207694_10019270
568 Ga0207694_10348869
569 Ga0207694_10503690
570 Ga0207694_11360866
571 Ga0207687_10406158
572 Ga0207700_10039728
573 Ga0207700_10089465
574 Ga0207700_10405717
575 Ga0207664_10446678
576 Ga0207690_10047433
577 Ga0207690_10155966
578 Ga0207686_10049602
579 Ga0207704_10100776
580 Ga0207691_10511488
581 Ga0207711_10039418
582 Ga0207711_10130853
583 Ga0207711_10212830
584 Ga0207661_10071561
585 Ga0207661_11691125
586 Ga0207661_12119970
587 Ga0207679_10116087
588 Ga0207667_10009978
589 Ga0207667_10014445
590 Ga0207667_10023682
591 Ga0207667_10029131
592 Ga0207667_10137740
593 Ga0207667_10701928
594 Ga0207667_10721912
595 Ga0207651_10310252
596 Ga0207651_11860248
597 Ga0207640_11529553
598 Ga0207658_10428160
599 Ga0207658_10961277
600 Ga0207677_10353004
601 Ga0207677_12155122
602 Ga0207703_11225186
603 Ga0207639_11229461
604 Ga0207708_11020795
605 Ga0207702_10006043
606 Ga0207702_10044372
607 Ga0207702_10103662
608 Ga0207702_10728305
609 Ga0207641_10097722
610 Ga0207641_10994061
611 Ga0207648_10037470
612 Ga0207674_11357313
613 Ga0207683_10453589
614 Ga0207698_10177945
615 Ga0207698_12545667
616 Ga0268266_10154764
617 Ga0268266_10327652
618 Ga0268266_10627625
619 Ga0268265_10126083
620 Ga0268264_10007129
621 Ga0265323_10000589
622 Ga0265338_10077155
623 Ga0265760_10076530
624 Ga0265330_10086216
625 Ga0265330_10173526
626 Ga0265325_10220762
627 Ga0265340_10044992
628 Ga0265331_10174954
629 Ga0265316_10014128
630 Ga0265316_10223412
631 Ga0265316_10321856
632 Ga0265316_10430680
633 Ga0265313_10001799
634 Ga0265314_10001307
635 Ga0307416_101379349
636 Ga0307416_102675890
637 Ga0373954_0258505
638 Ga0373931_0124692
639 Ga0373935_1137423
640 Ga0373927_0411062
641 Ga0373927_0700964
642 Ga0373933_0236971
643 Ga0373947_0884153
644 Ga0373937_0674354
645 Ga0373937_1692668
646 Ga0373925_0115843
647 Ga0373925_0227916
648 Ga0373925_1036731
649 Ga0373925_1586236
650 Ga0395900_0280943
651 Ga0395900_1035484
652 Ga0436364_0182643
653 Ga0436364_0190449
654 Ga0436364_0261139
655 Ga0436364_0265928
656 Ga0436364_0413048
657 Ga0436364_0760420
658 Ga0436364_1187734
659 Ga0436364_1430014
660 Ga0436365_0873679
661 Ga0436361_0343205
662 Ga0436361_0508844
663 Ga0436361_0711323
664 Ga0436363_0302820
665 Ga0436363_0477181
666 Ga0436363_0806835
667 Ga0436363_0845266
668 Ga0436362_0937099
669 Ga0451577_0304096
670 Ga0466963_0251855
671 Ga0466963_0702056
672 Ga0466963_1239979
673 Ga0451576_0123485
674 Ga0451576_0764287
675 Ga0451576_1176822
676 Ga0466967_0664490
677 Ga0466967_1039501
678 Ga0495592_0142169
679 Ga0495651_0342239
680 Ga0495653_0244879
681 Ga0495580_0042431
682 Ga0495580_0150385
683 Ga0495580_0150479
684 Ga0495580_0249221
685 Ga0495580_0434602
686 Ga0495664_0362090
687 Ga0495628_0197722
688 Ga0495628_0255814
689 Ga0495652_1158837
690 Ga0495665_0479312
691 Ga0495587_0001900
692 Ga0495667_0046260
693 Ga0495635_0913506
694 Ga0495646_0408357
695 Ga0495658_0224429
696 Ga0495669_0096832
697 Ga0495669_0666377
698 Ga0495604_0403830
699 Ga0495674_0079651
700 Ga0495674_0236057
701 Ga0495684_0030505
702 Ga0495602_0088487
703 Ga0495602_0267752
704 Ga0496104_0868734
705 Ga0496104_1164625
706 Ga0496112_0125671
707 Ga0496115_0733044
708 Ga0501047_0377306
709 Ga0501045_0429445
710 nmdc:mga05p37_1513374_c1
711 nmdc:mga08y16_742667_c1
712 nmdc:mga0rr50_1689744_c1
713 nmdc:mga0a205_758036_c1
714 Ga0466962_0296267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map