F420876

General Info

Members Datasets Scaffolds Average Seq Length
357 150 714 130

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10114584|Ga0265326_101145842
Length 147
Sequence MLANPRTGTGRTEYRWPVATSAKTFEYAVELDLGGRLTIPGGGQFVPPEGWSADHLLLAALVRCSIDSFTHHARRAGHEVAASGSAQGTITKSGDDGRYRFVEIDLRIDAQLTPRTNEPDDLIAKAERDCFVGASLVVKPEYEWHVS

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 2.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.73
Rhizosphere 84.31
Stem 0
Stem Tuber 0
Unclassified 17.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10114584 3300028558 Unclassified 766
2 Ga0065715_10190110 3300005293 Bacteria 1420
3 Ga0070658_10003997 3300005327 Bacteria 12087
4 Ga0070658_10045324 3300005327 Bacteria 3556
5 Ga0070683_100004803 3300005329 Bacteria 11186
6 Ga0070690_101301980 3300005330 Bacteria 582
7 Ga0070680_100002454 3300005336 Bacteria 13746
8 Ga0070680_100375298 3300005336 Bacteria 1210
9 Ga0070680_101929061 3300005336 Unclassified 512
10 Ga0070682_100373461 3300005337 Unclassified 1070
11 Ga0068868_101778281 3300005338 Bacteria 582
12 Ga0070660_100005410 3300005339 Bacteria 8840
13 Ga0070660_100005863 3300005339 Bacteria 8502
14 Ga0070661_100105439 3300005344 Bacteria 2101
15 Ga0070671_100035350 3300005355 Bacteria 4139
16 Ga0070671_100039141 3300005355 Bacteria 3936
17 Ga0070659_100545431 3300005366 Unclassified 992
18 Ga0070714_100176426 3300005435 Bacteria 1942
19 Ga0070714_100185168 3300005435 Bacteria 1897
20 Ga0070714_100967070 3300005435 Bacteria 828
21 Ga0070714_101077226 3300005435 Bacteria 783
22 Ga0070714_101729801 3300005435 Bacteria 611
23 Ga0070714_102320778 3300005435 Bacteria 522
24 Ga0070710_10134332 3300005437 Bacteria 1511
25 Ga0070711_100053918 3300005439 Bacteria 2773
26 Ga0070708_100779499 3300005445 Bacteria 899
27 Ga0070678_100271324 3300005456 Unclassified 1431
28 Ga0070681_10021806 3300005458 Bacteria 6423
29 Ga0070681_10032588 3300005458 Bacteria 5231
30 Ga0070681_10058105 3300005458 Bacteria 3848
31 Ga0070707_100945440 3300005468 Bacteria 827
32 Ga0070679_100052630 3300005530 Bacteria 4054
33 Ga0070679_100129527 3300005530 Bacteria 2505
34 Ga0070679_100155419 3300005530 Bacteria 2262
35 Ga0070679_101034316 3300005530 Bacteria 765
36 Ga0070684_100001780 3300005535 Bacteria 15732
37 Ga0070684_100233937 3300005535 Bacteria 1678
38 Ga0068853_100695058 3300005539 Unclassified 970
39 Ga0070695_100435778 3300005545 Unclassified 1001
40 Ga0068855_100036808 3300005563 Bacteria 5822
41 Ga0068855_100059854 3300005563 Bacteria 4455
42 Ga0068855_100062613 3300005563 Bacteria 4342
43 Ga0068855_100456287 3300005563 Bacteria 1394
44 Ga0068855_101734245 3300005563 Bacteria 636
45 Ga0068856_100244626 3300005614 Bacteria 1809
46 Ga0068856_100509357 3300005614 Bacteria 1225
47 Ga0068856_100639035 3300005614 Bacteria 1085
48 Ga0068856_101593742 3300005614 Unclassified 666
49 Ga0068852_100708507 3300005616 Unclassified 1017
50 Ga0068852_101954138 3300005616 Bacteria 609
51 Ga0070717_10804754 3300006028 Bacteria 855
52 Ga0070712_100061303 3300006175 Bacteria 2657
53 Ga0070712_100401051 3300006175 Bacteria 1133
54 Ga0070712_100405341 3300006175 Unclassified 1127
55 Ga0070712_102042874 3300006175 Unclassified 502
56 Ga0097621_100217058 3300006237 Bacteria 1665
57 Ga0097621_100342432 3300006237 Bacteria 1328
58 Ga0068871_101053126 3300006358 Bacteria 759
59 Ga0105240_10024799 3300009093 Bacteria 7897
60 Ga0105240_10223888 3300009093 Unclassified 2190
61 Ga0105240_10349416 3300009093 Bacteria 1678
62 Ga0105240_10938899 3300009093 Bacteria 929
63 Ga0105243_10014999 3300009148 Bacteria 5865
64 Ga0105241_11951205 3300009174 Bacteria 577
65 Ga0105242_10215078 3300009176 Bacteria 1715
66 Ga0157370_10009683 3300013104 Bacteria 10248
67 Ga0157370_10068099 3300013104 Bacteria 3364
68 Ga0157370_10337319 3300013104 Bacteria 1390
69 Ga0157370_10360633 3300013104 Unclassified 1339
70 Ga0157370_11530365 3300013104 Bacteria 600
71 Ga0157369_10028094 3300013105 Bacteria 6228
72 Ga0157369_10032786 3300013105 Bacteria 5709
73 Ga0157369_10064457 3300013105 Bacteria 3946
74 Ga0157369_10161813 3300013105 Bacteria 2363
75 Ga0157369_12336428 3300013105 Unclassified 542
76 Ga0157374_10719760 3300013296 Bacteria 1012
77 Ga0157378_10183651 3300013297 Bacteria 1969
78 Ga0157372_10030825 3300013307 Bacteria 5867
79 Ga0157372_11052481 3300013307 Unclassified 942
80 Ga0197907_11348676 3300020069 Bacteria 2486
81 Ga0206356_10015304 3300020070 Bacteria 2417
82 Ga0206356_10067278 3300020070 Bacteria 1631
83 Ga0206356_10104585 3300020070 Bacteria 550
84 Ga0206354_10052584 3300020081 Bacteria 2397
85 Ga0206354_11031714 3300020081 Bacteria 1238
86 Ga0206353_10546960 3300020082 Bacteria 1854
87 Ga0206353_10734195 3300020082 Unclassified 857
88 Ga0206353_10815333 3300020082 Bacteria 10780
89 Ga0206353_11449795 3300020082 Bacteria 6437
90 Ga0213876_10346316 3300021384 Unclassified 790
91 Ga0207692_10121733 3300025898 Bacteria 1462
92 Ga0207685_10213908 3300025905 Bacteria 913
93 Ga0207705_10215792 3300025909 Unclassified 1456
94 Ga0207707_10006587 3300025912 Bacteria 10132
95 Ga0207707_10013582 3300025912 Bacteria 7100
96 Ga0207707_10905409 3300025912 Bacteria 729
97 Ga0207695_10219136 3300025913 Unclassified 1811
98 Ga0207695_10851395 3300025913 Bacteria 792
99 Ga0207693_10080618 3300025915 Unclassified 2548
100 Ga0207693_10124435 3300025915 Bacteria 2026
101 Ga0207693_10217777 3300025915 Bacteria 1500
102 Ga0207663_10080025 3300025916 Bacteria 2135
103 Ga0207663_10132020 3300025916 Bacteria 1727
104 Ga0207663_10710202 3300025916 Bacteria 796
105 Ga0207660_10143553 3300025917 Bacteria 1827
106 Ga0207660_10158008 3300025917 Unclassified 1747
107 Ga0207660_10909071 3300025917 Bacteria 718
108 Ga0207657_10000150 3300025919 Bacteria 70716
109 Ga0207657_10015116 3300025919 Bacteria 7496
110 Ga0207649_10128776 3300025920 Bacteria 1716
111 Ga0207652_10169176 3300025921 Bacteria 1960
112 Ga0207652_10198558 3300025921 Bacteria 1805
113 Ga0207652_10242396 3300025921 Bacteria 1625
114 Ga0207646_10661077 3300025922 Unclassified 936
115 Ga0207687_11835798 3300025927 Unclassified 518
116 Ga0207664_10097593 3300025929 Bacteria 2421
117 Ga0207664_10147076 3300025929 Bacteria 1999
118 Ga0207664_10719199 3300025929 Bacteria 898
119 Ga0207664_11836863 3300025929 Bacteria 528
120 Ga0207644_10108724 3300025931 Unclassified 2094
121 Ga0207644_10491531 3300025931 Bacteria 1011
122 Ga0207690_10518067 3300025932 Unclassified 966
123 Ga0207665_10067911 3300025939 Unclassified 2428
124 Ga0207665_10697720 3300025939 Unclassified 798
125 Ga0207661_10255730 3300025944 Bacteria 1558
126 Ga0207667_10039229 3300025949 Bacteria 5049
127 Ga0207667_10206488 3300025949 Bacteria 2014
128 Ga0207667_10396644 3300025949 Bacteria 1405
129 Ga0207667_12019010 3300025949 Bacteria 537
130 Ga0207640_10990934 3300025981 Bacteria 739
131 Ga0207677_11895310 3300026023 Bacteria 554
132 Ga0207702_10622136 3300026078 Bacteria 1060
133 Ga0207702_12464456 3300026078 Bacteria 507
134 Ga0207683_10070091 3300026121 Bacteria 3097
135 Ga0207698_10023483 3300026142 Bacteria 4309
136 Ga0207698_10443239 3300026142 Bacteria 1252
137 Ga0207698_10891396 3300026142 Bacteria 896
138 Ga0207698_11015102 3300026142 Bacteria 841
139 Ga0265319_1010648 3300028563 Bacteria 3824
140 Ga0265319_1122565 3300028563 Unclassified 810
141 Ga0265334_10025744 3300028573 Unclassified 2380
142 Ga0265318_10004358 3300028577 Bacteria 6873
143 Ga0265322_10084626 3300028654 Unclassified 900
144 Ga0265338_10094963 3300028800 Unclassified 2451
145 Ga0265338_10124194 3300028800 Unclassified 2051
146 Ga0265324_10035462 3300029957 Bacteria 1737
147 Ga0265330_10041356 3300031235 Bacteria 2044
148 Ga0265332_10180030 3300031238 Bacteria 881
149 Ga0265328_10044486 3300031239 Unclassified 1633
150 Ga0265320_10090848 3300031240 Unclassified 1414
151 Ga0265325_10017608 3300031241 Bacteria 3971
152 Ga0265325_10113919 3300031241 Unclassified 1311
153 Ga0265329_10017922 3300031242 Bacteria 2429
154 Ga0265340_10085719 3300031247 Unclassified 1478
155 Ga0265340_10139447 3300031247 Unclassified 1109
156 Ga0265331_10049222 3300031250 Unclassified 2025
157 Ga0265327_10020153 3300031251 Bacteria 4073
158 Ga0265327_10060504 3300031251 Unclassified 1935
159 Ga0265327_10065179 3300031251 Bacteria 1843
160 Ga0265316_10020476 3300031344 Bacteria 5629
161 Ga0265316_10136990 3300031344 Bacteria 1841
162 Ga0265316_10957944 3300031344 Bacteria 596
163 Ga0265314_10008387 3300031711 Bacteria 8855
164 Ga0265314_10012265 3300031711 Bacteria 7008
165 Ga0265314_10315651 3300031711 Bacteria 871
166 Ga0265342_10049753 3300031712 Bacteria 2506
167 Ga0373945_0109090 3300035116 Bacteria 1090
168 Ga0373943_0002660 3300035170 Bacteria 8130
169 Ga0373943_0048345 3300035170 Unclassified 2084
170 Ga0373935_0281279 3300035692 Bacteria 1171
171 Ga0373927_0051116 3300035695 Bacteria 2673
172 Ga0373927_0559499 3300035695 Bacteria 756
173 Ga0373947_0027567 3300035725 Bacteria 3325
174 Ga0373947_0069425 3300035725 Bacteria 2156
175 Ga0373925_0001570 3300037068 Bacteria 19317
176 Ga0373925_0058806 3300037068 Bacteria 2883
177 Ga0395899_0118241 3300037312 Bacteria 1901
178 Ga0395899_0201116 3300037312 Bacteria 1389
179 Ga0395899_0387220 3300037312 Bacteria 928
180 Ga0395899_0431367 3300037312 Bacteria 866
181 Ga0395899_0537693 3300037312 Bacteria 753
182 Ga0395899_0711555 3300037312 Unclassified 629
183 Ga0395900_0018881 3300037418 Bacteria 7032
184 Ga0395900_0025043 3300037418 Bacteria 6108
185 Ga0395900_0042375 3300037418 Bacteria 4691
186 Ga0395900_0131394 3300037418 Bacteria 2566
187 Ga0395900_0184475 3300037418 Bacteria 2118
188 Ga0395900_0328059 3300037418 Archaea 1509
189 Ga0395900_0358636 3300037418 Bacteria 1430
190 Ga0395900_0386215 3300037418 Bacteria 1367
191 Ga0395900_0424648 3300037418 Bacteria 1290
192 Ga0395900_0459458 3300037418 Bacteria 1228
193 Ga0395900_0542695 3300037418 Bacteria 1108
194 Ga0395900_0569853 3300037418 Bacteria 1075
195 Ga0395900_1152285 3300037418 Bacteria 691
196 Ga0395900_1201461 3300037418 Bacteria 674
197 Ga0395898_0003505 3300037466 Bacteria 17509
198 Ga0395898_0003758 3300037466 Bacteria 16814
199 Ga0395898_0345999 3300037466 Archaea 1418
200 Ga0395898_0478062 3300037466 Bacteria 1185
201 Ga0395898_0494632 3300037466 Bacteria 1163
202 Ga0395898_0563958 3300037466 Bacteria 1081
203 Ga0395898_0958972 3300037466 Bacteria 792
204 Ga0395898_1077325 3300037466 Bacteria 738
205 Ga0395898_1302720 3300037466 Bacteria 656
206 Ga0395905_0003026 3300037471 Bacteria 18215
207 Ga0395905_0344921 3300037471 Bacteria 1381
208 Ga0395905_0551251 3300037471 Bacteria 1054
209 Ga0395905_1101555 3300037471 Bacteria 697
210 Ga0436364_1191660 3300037853 Bacteria 1308
211 Ga0395901_0001675 3300038443 Bacteria 22876
212 Ga0395901_0002561 3300038443 Bacteria 18423
213 Ga0395901_0026288 3300038443 Bacteria 5977
214 Ga0395901_0148623 3300038443 Bacteria 2462
215 Ga0395901_0180603 3300038443 Bacteria 2213
216 Ga0395901_0200137 3300038443 Bacteria 2094
217 Ga0395901_0509816 3300038443 Bacteria 1224
218 Ga0395901_0743849 3300038443 Bacteria 974
219 Ga0395901_0850807 3300038443 Bacteria 897
220 Ga0436365_0297332 3300039437 Bacteria 869
221 Ga0436365_1516477 3300039437 Bacteria 1897
222 Ga0436363_0686826 3300039450 Bacteria 894
223 Ga0436363_0709570 3300039450 Bacteria 1628
224 Ga0451853_3688126 3300041512 Unclassified 679
225 Ga0451577_1590467 3300042876 Bacteria 577
226 Ga0466969_0217917 3300044656 Unclassified 868
227 Ga0466965_0029662 3300044683 Bacteria 2662
228 Ga0466966_0037017 3300044684 Bacteria 3149
229 Ga0466966_0409206 3300044684 Bacteria 815
230 Ga0466961_0010653 3300044693 Bacteria 5868
231 Ga0466961_0048362 3300044693 Bacteria 2718
232 Ga0466961_0145817 3300044693 Bacteria 1480
233 Ga0466961_0240107 3300044693 Bacteria 1114
234 Ga0466961_0261022 3300044693 Bacteria 1062
235 Ga0466961_0975196 3300044693 Bacteria 504
236 Ga0466963_0000605 3300044694 Bacteria 17157
237 Ga0466963_0032745 3300044694 Bacteria 3368
238 Ga0466963_0040620 3300044694 Bacteria 3049
239 Ga0466963_0118280 3300044694 Unclassified 1822
240 Ga0466963_0230918 3300044694 Bacteria 1296
241 Ga0466964_0036954 3300044706 Bacteria 1960
242 Ga0466964_0066261 3300044706 Bacteria 1515
243 Ga0466964_0109511 3300044706 Archaea 1230
244 Ga0466971_0000533 3300044719 Bacteria 15074
245 Ga0466971_0014774 3300044719 Bacteria 3436
246 Ga0466968_0010498 3300044735 Bacteria 3593
247 Ga0466968_0062438 3300044735 Bacteria 1609
248 Ga0466970_0088305 3300044765 Bacteria 1681
249 Ga0466970_0202716 3300044765 Bacteria 1104
250 Ga0466957_0009517 3300044842 Bacteria 5548
251 Ga0466957_0018585 3300044842 Bacteria 4083
252 Ga0466957_0032383 3300044842 Bacteria 3130
253 Ga0466957_0042854 3300044842 Bacteria 2739
254 Ga0466957_0253138 3300044842 Bacteria 1172
255 Ga0466957_0313992 3300044842 Bacteria 1056
256 Ga0466960_0259204 3300044901 Bacteria 968
257 Ga0466960_0777584 3300044901 Bacteria 578
258 Ga0466959_0003855 3300045049 Bacteria 9948
259 Ga0466959_0043510 3300045049 Bacteria 3310
260 Ga0466959_0119108 3300045049 Bacteria 1878
261 Ga0466959_0163733 3300045049 Bacteria 1563
262 Ga0466958_0000693 3300045836 Bacteria 14666
263 Ga0466958_0012709 3300045836 Bacteria 4774
264 Ga0466958_0243062 3300045836 Bacteria 1150
265 Ga0466958_0250238 3300045836 Archaea 1133
266 Ga0466967_0000654 3300045976 Bacteria 17408
267 Ga0466967_0013839 3300045976 Bacteria 6255
268 Ga0466967_0021511 3300045976 Bacteria 5242
269 Ga0466967_0030236 3300045976 Bacteria 4543
270 Ga0466967_0037766 3300045976 Bacteria 4136
271 Ga0466967_0049362 3300045976 Bacteria 3680
272 Ga0466967_0125558 3300045976 Bacteria 2376
273 Ga0466967_0142696 3300045976 Bacteria 2232
274 Ga0466967_0182155 3300045976 Unclassified 1982
275 Ga0466967_0250092 3300045976 Bacteria 1693
276 Ga0466967_0268781 3300045976 Bacteria 1633
277 Ga0466967_0399317 3300045976 Bacteria 1337
278 Ga0466967_0413910 3300045976 Bacteria 1313
279 Ga0466967_0540630 3300045976 Unclassified 1146
280 Ga0466967_0844101 3300045976 Bacteria 910
281 Ga0466967_2181808 3300045976 Unclassified 550
282 Ga0495629_0209267 3300046459 Bacteria 1347
283 Ga0495641_0043125 3300046461 Bacteria 2087
284 Ga0495580_0528125 3300046472 Unclassified 786
285 Ga0495582_0407625 3300046473 Bacteria 784
286 Ga0495582_0432312 3300046473 Bacteria 760
287 Ga0495582_0810030 3300046473 Unclassified 542
288 Ga0495630_0116033 3300046517 Bacteria 2029
289 Ga0495630_0266839 3300046517 Unclassified 1308
290 Ga0495630_0409713 3300046517 Bacteria 1039
291 Ga0495630_1298232 3300046517 Bacteria 549
292 Ga0495635_0919237 3300046663 Bacteria 560
293 Ga0495658_0052305 3300046683 Bacteria 2316
294 Ga0495658_0444521 3300046683 Unclassified 828
295 Ga0495581_0250267 3300047315 Bacteria 1036
296 Ga0495581_0467662 3300047315 Bacteria 734
297 Ga0495676_0083427 3300047321 Unclassified 2415
298 Ga0495676_0121203 3300047321 Bacteria 1902
299 Ga0495680_0259693 3300047322 Bacteria 1229
300 Ga0495593_0364806 3300047673 Bacteria 722
301 Ga0495614_0436728 3300048089 Unclassified 618
302 Ga0496100_0001055 3300048903 Bacteria 13288
303 Ga0496100_0374464 3300048903 Bacteria 1080
304 Ga0496100_0393756 3300048903 Unclassified 1054
305 Ga0496101_0044705 3300048904 Bacteria 3170
306 Ga0496101_0135619 3300048904 Bacteria 1872
307 Ga0496101_0195724 3300048904 Bacteria 1561
308 Ga0496101_0226271 3300048904 Bacteria 1453
309 Ga0496102_0004720 3300048905 Bacteria 11537
310 Ga0496102_0028267 3300048905 Bacteria 5007
311 Ga0496102_0047167 3300048905 Bacteria 3914
312 Ga0496102_0405261 3300048905 Bacteria 1282
313 Ga0496102_1027736 3300048905 Bacteria 744
314 Ga0496103_0018903 3300048906 Bacteria 4138
315 Ga0496103_0075690 3300048906 Bacteria 2111
316 Ga0496103_0131342 3300048906 Bacteria 1599
317 Ga0496103_0299567 3300048906 Bacteria 1034
318 Ga0496103_0657366 3300048906 Unclassified 666
319 Ga0496104_0005229 3300048907 Bacteria 11353
320 Ga0496105_0000406 3300048908 Bacteria 28366
321 Ga0496106_0000263 3300048909 Bacteria 36905
322 Ga0496106_0015556 3300048909 Bacteria 5627
323 Ga0496106_0038005 3300048909 Bacteria 3601
324 Ga0496106_0824112 3300048909 Unclassified 735
325 Ga0496107_0007491 3300048910 Bacteria 7525
326 Ga0496107_0054919 3300048910 Bacteria 2875
327 Ga0496107_0205064 3300048910 Bacteria 1466
328 Ga0496108_0017688 3300048911 Bacteria 5832
329 Ga0496108_0166388 3300048911 Bacteria 1907
330 Ga0496109_0001107 3300048912 Bacteria 22340
331 Ga0496109_0110975 3300048912 Bacteria 2550
332 Ga0496110_0384256 3300048913 Bacteria 1279
333 Ga0496111_0084852 3300048914 Bacteria 2315
334 Ga0496111_0119228 3300048914 Bacteria 1948
335 Ga0496112_0007861 3300048915 Bacteria 9495
336 Ga0496112_0047557 3300048915 Bacteria 4209
337 Ga0496112_0139452 3300048915 Unclassified 2394
338 Ga0496112_0149219 3300048915 Bacteria 2305
339 Ga0496112_0237921 3300048915 Unclassified 1774
340 Ga0496112_0274137 3300048915 Bacteria 1635
341 Ga0496112_0431657 3300048915 Unclassified 1256
342 Ga0496112_1316552 3300048915 Bacteria 638
343 Ga0496113_0332409 3300048916 Bacteria 1218
344 Ga0496113_0372125 3300048916 Bacteria 1147
345 Ga0496113_0745525 3300048916 Unclassified 780
346 Ga0496114_0000444 3300048917 Bacteria 30383
347 Ga0496114_0258644 3300048917 Bacteria 1532
348 Ga0496114_0543328 3300048917 Unclassified 1027
349 Ga0496114_0904923 3300048917 Bacteria 764
350 Ga0496115_0000415 3300048918 Bacteria 34771
351 Ga0501046_0810793 3300049580 Unclassified 656
352 Ga0501070_0562938 3300049586 Bacteria 911
353 Ga0501074_0227539 3300049590 Bacteria 1328
354 Ga0501080_0361545 3300049742 Unclassified 1310
355 Ga0495619_0192282 3300053085 Bacteria 1412
356 Ga0466962_0001101 3300061719 Bacteria 12437
357 Ga0466962_0032903 3300061719 Bacteria 2481
358 Ga0265326_10114584
359 Ga0065715_10190110
360 Ga0070658_10003997
361 Ga0070658_10045324
362 Ga0070683_100004803
363 Ga0070690_101301980
364 Ga0070680_100002454
365 Ga0070680_100375298
366 Ga0070680_101929061
367 Ga0070682_100373461
368 Ga0068868_101778281
369 Ga0070660_100005410
370 Ga0070660_100005863
371 Ga0070661_100105439
372 Ga0070671_100035350
373 Ga0070671_100039141
374 Ga0070659_100545431
375 Ga0070714_100176426
376 Ga0070714_100185168
377 Ga0070714_100967070
378 Ga0070714_101077226
379 Ga0070714_101729801
380 Ga0070714_102320778
381 Ga0070710_10134332
382 Ga0070711_100053918
383 Ga0070708_100779499
384 Ga0070678_100271324
385 Ga0070681_10021806
386 Ga0070681_10032588
387 Ga0070681_10058105
388 Ga0070707_100945440
389 Ga0070679_100052630
390 Ga0070679_100129527
391 Ga0070679_100155419
392 Ga0070679_101034316
393 Ga0070684_100001780
394 Ga0070684_100233937
395 Ga0068853_100695058
396 Ga0070695_100435778
397 Ga0068855_100036808
398 Ga0068855_100059854
399 Ga0068855_100062613
400 Ga0068855_100456287
401 Ga0068855_101734245
402 Ga0068856_100244626
403 Ga0068856_100509357
404 Ga0068856_100639035
405 Ga0068856_101593742
406 Ga0068852_100708507
407 Ga0068852_101954138
408 Ga0070717_10804754
409 Ga0070712_100061303
410 Ga0070712_100401051
411 Ga0070712_100405341
412 Ga0070712_102042874
413 Ga0097621_100217058
414 Ga0097621_100342432
415 Ga0068871_101053126
416 Ga0105240_10024799
417 Ga0105240_10223888
418 Ga0105240_10349416
419 Ga0105240_10938899
420 Ga0105243_10014999
421 Ga0105241_11951205
422 Ga0105242_10215078
423 Ga0157370_10009683
424 Ga0157370_10068099
425 Ga0157370_10337319
426 Ga0157370_10360633
427 Ga0157370_11530365
428 Ga0157369_10028094
429 Ga0157369_10032786
430 Ga0157369_10064457
431 Ga0157369_10161813
432 Ga0157369_12336428
433 Ga0157374_10719760
434 Ga0157378_10183651
435 Ga0157372_10030825
436 Ga0157372_11052481
437 Ga0197907_11348676
438 Ga0206356_10015304
439 Ga0206356_10067278
440 Ga0206356_10104585
441 Ga0206354_10052584
442 Ga0206354_11031714
443 Ga0206353_10546960
444 Ga0206353_10734195
445 Ga0206353_10815333
446 Ga0206353_11449795
447 Ga0213876_10346316
448 Ga0207692_10121733
449 Ga0207685_10213908
450 Ga0207705_10215792
451 Ga0207707_10006587
452 Ga0207707_10013582
453 Ga0207707_10905409
454 Ga0207695_10219136
455 Ga0207695_10851395
456 Ga0207693_10080618
457 Ga0207693_10124435
458 Ga0207693_10217777
459 Ga0207663_10080025
460 Ga0207663_10132020
461 Ga0207663_10710202
462 Ga0207660_10143553
463 Ga0207660_10158008
464 Ga0207660_10909071
465 Ga0207657_10000150
466 Ga0207657_10015116
467 Ga0207649_10128776
468 Ga0207652_10169176
469 Ga0207652_10198558
470 Ga0207652_10242396
471 Ga0207646_10661077
472 Ga0207687_11835798
473 Ga0207664_10097593
474 Ga0207664_10147076
475 Ga0207664_10719199
476 Ga0207664_11836863
477 Ga0207644_10108724
478 Ga0207644_10491531
479 Ga0207690_10518067
480 Ga0207665_10067911
481 Ga0207665_10697720
482 Ga0207661_10255730
483 Ga0207667_10039229
484 Ga0207667_10206488
485 Ga0207667_10396644
486 Ga0207667_12019010
487 Ga0207640_10990934
488 Ga0207677_11895310
489 Ga0207702_10622136
490 Ga0207702_12464456
491 Ga0207683_10070091
492 Ga0207698_10023483
493 Ga0207698_10443239
494 Ga0207698_10891396
495 Ga0207698_11015102
496 Ga0265319_1010648
497 Ga0265319_1122565
498 Ga0265334_10025744
499 Ga0265318_10004358
500 Ga0265322_10084626
501 Ga0265338_10094963
502 Ga0265338_10124194
503 Ga0265324_10035462
504 Ga0265330_10041356
505 Ga0265332_10180030
506 Ga0265328_10044486
507 Ga0265320_10090848
508 Ga0265325_10017608
509 Ga0265325_10113919
510 Ga0265329_10017922
511 Ga0265340_10085719
512 Ga0265340_10139447
513 Ga0265331_10049222
514 Ga0265327_10020153
515 Ga0265327_10060504
516 Ga0265327_10065179
517 Ga0265316_10020476
518 Ga0265316_10136990
519 Ga0265316_10957944
520 Ga0265314_10008387
521 Ga0265314_10012265
522 Ga0265314_10315651
523 Ga0265342_10049753
524 Ga0373945_0109090
525 Ga0373943_0002660
526 Ga0373943_0048345
527 Ga0373935_0281279
528 Ga0373927_0051116
529 Ga0373927_0559499
530 Ga0373947_0027567
531 Ga0373947_0069425
532 Ga0373925_0001570
533 Ga0373925_0058806
534 Ga0395899_0118241
535 Ga0395899_0201116
536 Ga0395899_0387220
537 Ga0395899_0431367
538 Ga0395899_0537693
539 Ga0395899_0711555
540 Ga0395900_0018881
541 Ga0395900_0025043
542 Ga0395900_0042375
543 Ga0395900_0131394
544 Ga0395900_0184475
545 Ga0395900_0328059
546 Ga0395900_0358636
547 Ga0395900_0386215
548 Ga0395900_0424648
549 Ga0395900_0459458
550 Ga0395900_0542695
551 Ga0395900_0569853
552 Ga0395900_1152285
553 Ga0395900_1201461
554 Ga0395898_0003505
555 Ga0395898_0003758
556 Ga0395898_0345999
557 Ga0395898_0478062
558 Ga0395898_0494632
559 Ga0395898_0563958
560 Ga0395898_0958972
561 Ga0395898_1077325
562 Ga0395898_1302720
563 Ga0395905_0003026
564 Ga0395905_0344921
565 Ga0395905_0551251
566 Ga0395905_1101555
567 Ga0436364_1191660
568 Ga0395901_0001675
569 Ga0395901_0002561
570 Ga0395901_0026288
571 Ga0395901_0148623
572 Ga0395901_0180603
573 Ga0395901_0200137
574 Ga0395901_0509816
575 Ga0395901_0743849
576 Ga0395901_0850807
577 Ga0436365_0297332
578 Ga0436365_1516477
579 Ga0436363_0686826
580 Ga0436363_0709570
581 Ga0451853_3688126
582 Ga0451577_1590467
583 Ga0466969_0217917
584 Ga0466965_0029662
585 Ga0466966_0037017
586 Ga0466966_0409206
587 Ga0466961_0010653
588 Ga0466961_0048362
589 Ga0466961_0145817
590 Ga0466961_0240107
591 Ga0466961_0261022
592 Ga0466961_0975196
593 Ga0466963_0000605
594 Ga0466963_0032745
595 Ga0466963_0040620
596 Ga0466963_0118280
597 Ga0466963_0230918
598 Ga0466964_0036954
599 Ga0466964_0066261
600 Ga0466964_0109511
601 Ga0466971_0000533
602 Ga0466971_0014774
603 Ga0466968_0010498
604 Ga0466968_0062438
605 Ga0466970_0088305
606 Ga0466970_0202716
607 Ga0466957_0009517
608 Ga0466957_0018585
609 Ga0466957_0032383
610 Ga0466957_0042854
611 Ga0466957_0253138
612 Ga0466957_0313992
613 Ga0466960_0259204
614 Ga0466960_0777584
615 Ga0466959_0003855
616 Ga0466959_0043510
617 Ga0466959_0119108
618 Ga0466959_0163733
619 Ga0466958_0000693
620 Ga0466958_0012709
621 Ga0466958_0243062
622 Ga0466958_0250238
623 Ga0466967_0000654
624 Ga0466967_0013839
625 Ga0466967_0021511
626 Ga0466967_0030236
627 Ga0466967_0037766
628 Ga0466967_0049362
629 Ga0466967_0125558
630 Ga0466967_0142696
631 Ga0466967_0182155
632 Ga0466967_0250092
633 Ga0466967_0268781
634 Ga0466967_0399317
635 Ga0466967_0413910
636 Ga0466967_0540630
637 Ga0466967_0844101
638 Ga0466967_2181808
639 Ga0495629_0209267
640 Ga0495641_0043125
641 Ga0495580_0528125
642 Ga0495582_0407625
643 Ga0495582_0432312
644 Ga0495582_0810030
645 Ga0495630_0116033
646 Ga0495630_0266839
647 Ga0495630_0409713
648 Ga0495630_1298232
649 Ga0495635_0919237
650 Ga0495658_0052305
651 Ga0495658_0444521
652 Ga0495581_0250267
653 Ga0495581_0467662
654 Ga0495676_0083427
655 Ga0495676_0121203
656 Ga0495680_0259693
657 Ga0495593_0364806
658 Ga0495614_0436728
659 Ga0496100_0001055
660 Ga0496100_0374464
661 Ga0496100_0393756
662 Ga0496101_0044705
663 Ga0496101_0135619
664 Ga0496101_0195724
665 Ga0496101_0226271
666 Ga0496102_0004720
667 Ga0496102_0028267
668 Ga0496102_0047167
669 Ga0496102_0405261
670 Ga0496102_1027736
671 Ga0496103_0018903
672 Ga0496103_0075690
673 Ga0496103_0131342
674 Ga0496103_0299567
675 Ga0496103_0657366
676 Ga0496104_0005229
677 Ga0496105_0000406
678 Ga0496106_0000263
679 Ga0496106_0015556
680 Ga0496106_0038005
681 Ga0496106_0824112
682 Ga0496107_0007491
683 Ga0496107_0054919
684 Ga0496107_0205064
685 Ga0496108_0017688
686 Ga0496108_0166388
687 Ga0496109_0001107
688 Ga0496109_0110975
689 Ga0496110_0384256
690 Ga0496111_0084852
691 Ga0496111_0119228
692 Ga0496112_0007861
693 Ga0496112_0047557
694 Ga0496112_0139452
695 Ga0496112_0149219
696 Ga0496112_0237921
697 Ga0496112_0274137
698 Ga0496112_0431657
699 Ga0496112_1316552
700 Ga0496113_0332409
701 Ga0496113_0372125
702 Ga0496113_0745525
703 Ga0496114_0000444
704 Ga0496114_0258644
705 Ga0496114_0543328
706 Ga0496114_0904923
707 Ga0496115_0000415
708 Ga0501046_0810793
709 Ga0501070_0562938
710 Ga0501074_0227539
711 Ga0501080_0361545
712 Ga0495619_0192282
713 Ga0466962_0001101
714 Ga0466962_0032903

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

46

145

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.7757 7 128
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.7441 4 129
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.727 7 128
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.7269 9 130
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.7253 5 130
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8441 33 129 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7859 33 129 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.737 35 129 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7133 25 128 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7094 35 129 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A537TP33-F1-model_v4 OsmC family peroxiredoxin 0.954 4 130
AF-A0A7W1R0W6-F1-model_v4 OsmC family peroxiredoxin 0.9446 60 130
AF-A0A538IDI8-F1-model_v4 OsmC family peroxiredoxin 0.942 1 130
AF-A0A538CZY7-F1-model_v4 OsmC family protein 0.94 1 130
AF-A0A7W0SZG2-F1-model_v4 OsmC family protein 0.9375 1 130

Map