F420876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 357 | 150 | 714 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300028558|Ga0265326_10114584|Ga0265326_101145842 |
| Length | 147 |
| Sequence | MLANPRTGTGRTEYRWPVATSAKTFEYAVELDLGGRLTIPGGGQFVPPEGWSADHLLLAALVRCSIDSFTHHARRAGHEVAASGSAQGTITKSGDDGRYRFVEIDLRIDAQLTPRTNEPDDLIAKAERDCFVGASLVVKPEYEWHVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 43 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 45 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 70 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 71 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 72 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 73 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 75 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 78 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 79 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 80 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 82 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 84 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 85 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 88 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 90 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 91 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 92 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 94 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 95 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 96 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 97 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 100 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 101 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 102 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 103 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 104 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 105 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 106 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 107 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 108 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 109 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 110 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 111 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 116 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 132 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 133 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 134 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 140 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 141 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 2.8 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 13.73 |
| Rhizosphere | 84.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265326_10114584 | 3300028558 | Unclassified | 766 |
| 2 | Ga0065715_10190110 | 3300005293 | Bacteria | 1420 |
| 3 | Ga0070658_10003997 | 3300005327 | Bacteria | 12087 |
| 4 | Ga0070658_10045324 | 3300005327 | Bacteria | 3556 |
| 5 | Ga0070683_100004803 | 3300005329 | Bacteria | 11186 |
| 6 | Ga0070690_101301980 | 3300005330 | Bacteria | 582 |
| 7 | Ga0070680_100002454 | 3300005336 | Bacteria | 13746 |
| 8 | Ga0070680_100375298 | 3300005336 | Bacteria | 1210 |
| 9 | Ga0070680_101929061 | 3300005336 | Unclassified | 512 |
| 10 | Ga0070682_100373461 | 3300005337 | Unclassified | 1070 |
| 11 | Ga0068868_101778281 | 3300005338 | Bacteria | 582 |
| 12 | Ga0070660_100005410 | 3300005339 | Bacteria | 8840 |
| 13 | Ga0070660_100005863 | 3300005339 | Bacteria | 8502 |
| 14 | Ga0070661_100105439 | 3300005344 | Bacteria | 2101 |
| 15 | Ga0070671_100035350 | 3300005355 | Bacteria | 4139 |
| 16 | Ga0070671_100039141 | 3300005355 | Bacteria | 3936 |
| 17 | Ga0070659_100545431 | 3300005366 | Unclassified | 992 |
| 18 | Ga0070714_100176426 | 3300005435 | Bacteria | 1942 |
| 19 | Ga0070714_100185168 | 3300005435 | Bacteria | 1897 |
| 20 | Ga0070714_100967070 | 3300005435 | Bacteria | 828 |
| 21 | Ga0070714_101077226 | 3300005435 | Bacteria | 783 |
| 22 | Ga0070714_101729801 | 3300005435 | Bacteria | 611 |
| 23 | Ga0070714_102320778 | 3300005435 | Bacteria | 522 |
| 24 | Ga0070710_10134332 | 3300005437 | Bacteria | 1511 |
| 25 | Ga0070711_100053918 | 3300005439 | Bacteria | 2773 |
| 26 | Ga0070708_100779499 | 3300005445 | Bacteria | 899 |
| 27 | Ga0070678_100271324 | 3300005456 | Unclassified | 1431 |
| 28 | Ga0070681_10021806 | 3300005458 | Bacteria | 6423 |
| 29 | Ga0070681_10032588 | 3300005458 | Bacteria | 5231 |
| 30 | Ga0070681_10058105 | 3300005458 | Bacteria | 3848 |
| 31 | Ga0070707_100945440 | 3300005468 | Bacteria | 827 |
| 32 | Ga0070679_100052630 | 3300005530 | Bacteria | 4054 |
| 33 | Ga0070679_100129527 | 3300005530 | Bacteria | 2505 |
| 34 | Ga0070679_100155419 | 3300005530 | Bacteria | 2262 |
| 35 | Ga0070679_101034316 | 3300005530 | Bacteria | 765 |
| 36 | Ga0070684_100001780 | 3300005535 | Bacteria | 15732 |
| 37 | Ga0070684_100233937 | 3300005535 | Bacteria | 1678 |
| 38 | Ga0068853_100695058 | 3300005539 | Unclassified | 970 |
| 39 | Ga0070695_100435778 | 3300005545 | Unclassified | 1001 |
| 40 | Ga0068855_100036808 | 3300005563 | Bacteria | 5822 |
| 41 | Ga0068855_100059854 | 3300005563 | Bacteria | 4455 |
| 42 | Ga0068855_100062613 | 3300005563 | Bacteria | 4342 |
| 43 | Ga0068855_100456287 | 3300005563 | Bacteria | 1394 |
| 44 | Ga0068855_101734245 | 3300005563 | Bacteria | 636 |
| 45 | Ga0068856_100244626 | 3300005614 | Bacteria | 1809 |
| 46 | Ga0068856_100509357 | 3300005614 | Bacteria | 1225 |
| 47 | Ga0068856_100639035 | 3300005614 | Bacteria | 1085 |
| 48 | Ga0068856_101593742 | 3300005614 | Unclassified | 666 |
| 49 | Ga0068852_100708507 | 3300005616 | Unclassified | 1017 |
| 50 | Ga0068852_101954138 | 3300005616 | Bacteria | 609 |
| 51 | Ga0070717_10804754 | 3300006028 | Bacteria | 855 |
| 52 | Ga0070712_100061303 | 3300006175 | Bacteria | 2657 |
| 53 | Ga0070712_100401051 | 3300006175 | Bacteria | 1133 |
| 54 | Ga0070712_100405341 | 3300006175 | Unclassified | 1127 |
| 55 | Ga0070712_102042874 | 3300006175 | Unclassified | 502 |
| 56 | Ga0097621_100217058 | 3300006237 | Bacteria | 1665 |
| 57 | Ga0097621_100342432 | 3300006237 | Bacteria | 1328 |
| 58 | Ga0068871_101053126 | 3300006358 | Bacteria | 759 |
| 59 | Ga0105240_10024799 | 3300009093 | Bacteria | 7897 |
| 60 | Ga0105240_10223888 | 3300009093 | Unclassified | 2190 |
| 61 | Ga0105240_10349416 | 3300009093 | Bacteria | 1678 |
| 62 | Ga0105240_10938899 | 3300009093 | Bacteria | 929 |
| 63 | Ga0105243_10014999 | 3300009148 | Bacteria | 5865 |
| 64 | Ga0105241_11951205 | 3300009174 | Bacteria | 577 |
| 65 | Ga0105242_10215078 | 3300009176 | Bacteria | 1715 |
| 66 | Ga0157370_10009683 | 3300013104 | Bacteria | 10248 |
| 67 | Ga0157370_10068099 | 3300013104 | Bacteria | 3364 |
| 68 | Ga0157370_10337319 | 3300013104 | Bacteria | 1390 |
| 69 | Ga0157370_10360633 | 3300013104 | Unclassified | 1339 |
| 70 | Ga0157370_11530365 | 3300013104 | Bacteria | 600 |
| 71 | Ga0157369_10028094 | 3300013105 | Bacteria | 6228 |
| 72 | Ga0157369_10032786 | 3300013105 | Bacteria | 5709 |
| 73 | Ga0157369_10064457 | 3300013105 | Bacteria | 3946 |
| 74 | Ga0157369_10161813 | 3300013105 | Bacteria | 2363 |
| 75 | Ga0157369_12336428 | 3300013105 | Unclassified | 542 |
| 76 | Ga0157374_10719760 | 3300013296 | Bacteria | 1012 |
| 77 | Ga0157378_10183651 | 3300013297 | Bacteria | 1969 |
| 78 | Ga0157372_10030825 | 3300013307 | Bacteria | 5867 |
| 79 | Ga0157372_11052481 | 3300013307 | Unclassified | 942 |
| 80 | Ga0197907_11348676 | 3300020069 | Bacteria | 2486 |
| 81 | Ga0206356_10015304 | 3300020070 | Bacteria | 2417 |
| 82 | Ga0206356_10067278 | 3300020070 | Bacteria | 1631 |
| 83 | Ga0206356_10104585 | 3300020070 | Bacteria | 550 |
| 84 | Ga0206354_10052584 | 3300020081 | Bacteria | 2397 |
| 85 | Ga0206354_11031714 | 3300020081 | Bacteria | 1238 |
| 86 | Ga0206353_10546960 | 3300020082 | Bacteria | 1854 |
| 87 | Ga0206353_10734195 | 3300020082 | Unclassified | 857 |
| 88 | Ga0206353_10815333 | 3300020082 | Bacteria | 10780 |
| 89 | Ga0206353_11449795 | 3300020082 | Bacteria | 6437 |
| 90 | Ga0213876_10346316 | 3300021384 | Unclassified | 790 |
| 91 | Ga0207692_10121733 | 3300025898 | Bacteria | 1462 |
| 92 | Ga0207685_10213908 | 3300025905 | Bacteria | 913 |
| 93 | Ga0207705_10215792 | 3300025909 | Unclassified | 1456 |
| 94 | Ga0207707_10006587 | 3300025912 | Bacteria | 10132 |
| 95 | Ga0207707_10013582 | 3300025912 | Bacteria | 7100 |
| 96 | Ga0207707_10905409 | 3300025912 | Bacteria | 729 |
| 97 | Ga0207695_10219136 | 3300025913 | Unclassified | 1811 |
| 98 | Ga0207695_10851395 | 3300025913 | Bacteria | 792 |
| 99 | Ga0207693_10080618 | 3300025915 | Unclassified | 2548 |
| 100 | Ga0207693_10124435 | 3300025915 | Bacteria | 2026 |
| 101 | Ga0207693_10217777 | 3300025915 | Bacteria | 1500 |
| 102 | Ga0207663_10080025 | 3300025916 | Bacteria | 2135 |
| 103 | Ga0207663_10132020 | 3300025916 | Bacteria | 1727 |
| 104 | Ga0207663_10710202 | 3300025916 | Bacteria | 796 |
| 105 | Ga0207660_10143553 | 3300025917 | Bacteria | 1827 |
| 106 | Ga0207660_10158008 | 3300025917 | Unclassified | 1747 |
| 107 | Ga0207660_10909071 | 3300025917 | Bacteria | 718 |
| 108 | Ga0207657_10000150 | 3300025919 | Bacteria | 70716 |
| 109 | Ga0207657_10015116 | 3300025919 | Bacteria | 7496 |
| 110 | Ga0207649_10128776 | 3300025920 | Bacteria | 1716 |
| 111 | Ga0207652_10169176 | 3300025921 | Bacteria | 1960 |
| 112 | Ga0207652_10198558 | 3300025921 | Bacteria | 1805 |
| 113 | Ga0207652_10242396 | 3300025921 | Bacteria | 1625 |
| 114 | Ga0207646_10661077 | 3300025922 | Unclassified | 936 |
| 115 | Ga0207687_11835798 | 3300025927 | Unclassified | 518 |
| 116 | Ga0207664_10097593 | 3300025929 | Bacteria | 2421 |
| 117 | Ga0207664_10147076 | 3300025929 | Bacteria | 1999 |
| 118 | Ga0207664_10719199 | 3300025929 | Bacteria | 898 |
| 119 | Ga0207664_11836863 | 3300025929 | Bacteria | 528 |
| 120 | Ga0207644_10108724 | 3300025931 | Unclassified | 2094 |
| 121 | Ga0207644_10491531 | 3300025931 | Bacteria | 1011 |
| 122 | Ga0207690_10518067 | 3300025932 | Unclassified | 966 |
| 123 | Ga0207665_10067911 | 3300025939 | Unclassified | 2428 |
| 124 | Ga0207665_10697720 | 3300025939 | Unclassified | 798 |
| 125 | Ga0207661_10255730 | 3300025944 | Bacteria | 1558 |
| 126 | Ga0207667_10039229 | 3300025949 | Bacteria | 5049 |
| 127 | Ga0207667_10206488 | 3300025949 | Bacteria | 2014 |
| 128 | Ga0207667_10396644 | 3300025949 | Bacteria | 1405 |
| 129 | Ga0207667_12019010 | 3300025949 | Bacteria | 537 |
| 130 | Ga0207640_10990934 | 3300025981 | Bacteria | 739 |
| 131 | Ga0207677_11895310 | 3300026023 | Bacteria | 554 |
| 132 | Ga0207702_10622136 | 3300026078 | Bacteria | 1060 |
| 133 | Ga0207702_12464456 | 3300026078 | Bacteria | 507 |
| 134 | Ga0207683_10070091 | 3300026121 | Bacteria | 3097 |
| 135 | Ga0207698_10023483 | 3300026142 | Bacteria | 4309 |
| 136 | Ga0207698_10443239 | 3300026142 | Bacteria | 1252 |
| 137 | Ga0207698_10891396 | 3300026142 | Bacteria | 896 |
| 138 | Ga0207698_11015102 | 3300026142 | Bacteria | 841 |
| 139 | Ga0265319_1010648 | 3300028563 | Bacteria | 3824 |
| 140 | Ga0265319_1122565 | 3300028563 | Unclassified | 810 |
| 141 | Ga0265334_10025744 | 3300028573 | Unclassified | 2380 |
| 142 | Ga0265318_10004358 | 3300028577 | Bacteria | 6873 |
| 143 | Ga0265322_10084626 | 3300028654 | Unclassified | 900 |
| 144 | Ga0265338_10094963 | 3300028800 | Unclassified | 2451 |
| 145 | Ga0265338_10124194 | 3300028800 | Unclassified | 2051 |
| 146 | Ga0265324_10035462 | 3300029957 | Bacteria | 1737 |
| 147 | Ga0265330_10041356 | 3300031235 | Bacteria | 2044 |
| 148 | Ga0265332_10180030 | 3300031238 | Bacteria | 881 |
| 149 | Ga0265328_10044486 | 3300031239 | Unclassified | 1633 |
| 150 | Ga0265320_10090848 | 3300031240 | Unclassified | 1414 |
| 151 | Ga0265325_10017608 | 3300031241 | Bacteria | 3971 |
| 152 | Ga0265325_10113919 | 3300031241 | Unclassified | 1311 |
| 153 | Ga0265329_10017922 | 3300031242 | Bacteria | 2429 |
| 154 | Ga0265340_10085719 | 3300031247 | Unclassified | 1478 |
| 155 | Ga0265340_10139447 | 3300031247 | Unclassified | 1109 |
| 156 | Ga0265331_10049222 | 3300031250 | Unclassified | 2025 |
| 157 | Ga0265327_10020153 | 3300031251 | Bacteria | 4073 |
| 158 | Ga0265327_10060504 | 3300031251 | Unclassified | 1935 |
| 159 | Ga0265327_10065179 | 3300031251 | Bacteria | 1843 |
| 160 | Ga0265316_10020476 | 3300031344 | Bacteria | 5629 |
| 161 | Ga0265316_10136990 | 3300031344 | Bacteria | 1841 |
| 162 | Ga0265316_10957944 | 3300031344 | Bacteria | 596 |
| 163 | Ga0265314_10008387 | 3300031711 | Bacteria | 8855 |
| 164 | Ga0265314_10012265 | 3300031711 | Bacteria | 7008 |
| 165 | Ga0265314_10315651 | 3300031711 | Bacteria | 871 |
| 166 | Ga0265342_10049753 | 3300031712 | Bacteria | 2506 |
| 167 | Ga0373945_0109090 | 3300035116 | Bacteria | 1090 |
| 168 | Ga0373943_0002660 | 3300035170 | Bacteria | 8130 |
| 169 | Ga0373943_0048345 | 3300035170 | Unclassified | 2084 |
| 170 | Ga0373935_0281279 | 3300035692 | Bacteria | 1171 |
| 171 | Ga0373927_0051116 | 3300035695 | Bacteria | 2673 |
| 172 | Ga0373927_0559499 | 3300035695 | Bacteria | 756 |
| 173 | Ga0373947_0027567 | 3300035725 | Bacteria | 3325 |
| 174 | Ga0373947_0069425 | 3300035725 | Bacteria | 2156 |
| 175 | Ga0373925_0001570 | 3300037068 | Bacteria | 19317 |
| 176 | Ga0373925_0058806 | 3300037068 | Bacteria | 2883 |
| 177 | Ga0395899_0118241 | 3300037312 | Bacteria | 1901 |
| 178 | Ga0395899_0201116 | 3300037312 | Bacteria | 1389 |
| 179 | Ga0395899_0387220 | 3300037312 | Bacteria | 928 |
| 180 | Ga0395899_0431367 | 3300037312 | Bacteria | 866 |
| 181 | Ga0395899_0537693 | 3300037312 | Bacteria | 753 |
| 182 | Ga0395899_0711555 | 3300037312 | Unclassified | 629 |
| 183 | Ga0395900_0018881 | 3300037418 | Bacteria | 7032 |
| 184 | Ga0395900_0025043 | 3300037418 | Bacteria | 6108 |
| 185 | Ga0395900_0042375 | 3300037418 | Bacteria | 4691 |
| 186 | Ga0395900_0131394 | 3300037418 | Bacteria | 2566 |
| 187 | Ga0395900_0184475 | 3300037418 | Bacteria | 2118 |
| 188 | Ga0395900_0328059 | 3300037418 | Archaea | 1509 |
| 189 | Ga0395900_0358636 | 3300037418 | Bacteria | 1430 |
| 190 | Ga0395900_0386215 | 3300037418 | Bacteria | 1367 |
| 191 | Ga0395900_0424648 | 3300037418 | Bacteria | 1290 |
| 192 | Ga0395900_0459458 | 3300037418 | Bacteria | 1228 |
| 193 | Ga0395900_0542695 | 3300037418 | Bacteria | 1108 |
| 194 | Ga0395900_0569853 | 3300037418 | Bacteria | 1075 |
| 195 | Ga0395900_1152285 | 3300037418 | Bacteria | 691 |
| 196 | Ga0395900_1201461 | 3300037418 | Bacteria | 674 |
| 197 | Ga0395898_0003505 | 3300037466 | Bacteria | 17509 |
| 198 | Ga0395898_0003758 | 3300037466 | Bacteria | 16814 |
| 199 | Ga0395898_0345999 | 3300037466 | Archaea | 1418 |
| 200 | Ga0395898_0478062 | 3300037466 | Bacteria | 1185 |
| 201 | Ga0395898_0494632 | 3300037466 | Bacteria | 1163 |
| 202 | Ga0395898_0563958 | 3300037466 | Bacteria | 1081 |
| 203 | Ga0395898_0958972 | 3300037466 | Bacteria | 792 |
| 204 | Ga0395898_1077325 | 3300037466 | Bacteria | 738 |
| 205 | Ga0395898_1302720 | 3300037466 | Bacteria | 656 |
| 206 | Ga0395905_0003026 | 3300037471 | Bacteria | 18215 |
| 207 | Ga0395905_0344921 | 3300037471 | Bacteria | 1381 |
| 208 | Ga0395905_0551251 | 3300037471 | Bacteria | 1054 |
| 209 | Ga0395905_1101555 | 3300037471 | Bacteria | 697 |
| 210 | Ga0436364_1191660 | 3300037853 | Bacteria | 1308 |
| 211 | Ga0395901_0001675 | 3300038443 | Bacteria | 22876 |
| 212 | Ga0395901_0002561 | 3300038443 | Bacteria | 18423 |
| 213 | Ga0395901_0026288 | 3300038443 | Bacteria | 5977 |
| 214 | Ga0395901_0148623 | 3300038443 | Bacteria | 2462 |
| 215 | Ga0395901_0180603 | 3300038443 | Bacteria | 2213 |
| 216 | Ga0395901_0200137 | 3300038443 | Bacteria | 2094 |
| 217 | Ga0395901_0509816 | 3300038443 | Bacteria | 1224 |
| 218 | Ga0395901_0743849 | 3300038443 | Bacteria | 974 |
| 219 | Ga0395901_0850807 | 3300038443 | Bacteria | 897 |
| 220 | Ga0436365_0297332 | 3300039437 | Bacteria | 869 |
| 221 | Ga0436365_1516477 | 3300039437 | Bacteria | 1897 |
| 222 | Ga0436363_0686826 | 3300039450 | Bacteria | 894 |
| 223 | Ga0436363_0709570 | 3300039450 | Bacteria | 1628 |
| 224 | Ga0451853_3688126 | 3300041512 | Unclassified | 679 |
| 225 | Ga0451577_1590467 | 3300042876 | Bacteria | 577 |
| 226 | Ga0466969_0217917 | 3300044656 | Unclassified | 868 |
| 227 | Ga0466965_0029662 | 3300044683 | Bacteria | 2662 |
| 228 | Ga0466966_0037017 | 3300044684 | Bacteria | 3149 |
| 229 | Ga0466966_0409206 | 3300044684 | Bacteria | 815 |
| 230 | Ga0466961_0010653 | 3300044693 | Bacteria | 5868 |
| 231 | Ga0466961_0048362 | 3300044693 | Bacteria | 2718 |
| 232 | Ga0466961_0145817 | 3300044693 | Bacteria | 1480 |
| 233 | Ga0466961_0240107 | 3300044693 | Bacteria | 1114 |
| 234 | Ga0466961_0261022 | 3300044693 | Bacteria | 1062 |
| 235 | Ga0466961_0975196 | 3300044693 | Bacteria | 504 |
| 236 | Ga0466963_0000605 | 3300044694 | Bacteria | 17157 |
| 237 | Ga0466963_0032745 | 3300044694 | Bacteria | 3368 |
| 238 | Ga0466963_0040620 | 3300044694 | Bacteria | 3049 |
| 239 | Ga0466963_0118280 | 3300044694 | Unclassified | 1822 |
| 240 | Ga0466963_0230918 | 3300044694 | Bacteria | 1296 |
| 241 | Ga0466964_0036954 | 3300044706 | Bacteria | 1960 |
| 242 | Ga0466964_0066261 | 3300044706 | Bacteria | 1515 |
| 243 | Ga0466964_0109511 | 3300044706 | Archaea | 1230 |
| 244 | Ga0466971_0000533 | 3300044719 | Bacteria | 15074 |
| 245 | Ga0466971_0014774 | 3300044719 | Bacteria | 3436 |
| 246 | Ga0466968_0010498 | 3300044735 | Bacteria | 3593 |
| 247 | Ga0466968_0062438 | 3300044735 | Bacteria | 1609 |
| 248 | Ga0466970_0088305 | 3300044765 | Bacteria | 1681 |
| 249 | Ga0466970_0202716 | 3300044765 | Bacteria | 1104 |
| 250 | Ga0466957_0009517 | 3300044842 | Bacteria | 5548 |
| 251 | Ga0466957_0018585 | 3300044842 | Bacteria | 4083 |
| 252 | Ga0466957_0032383 | 3300044842 | Bacteria | 3130 |
| 253 | Ga0466957_0042854 | 3300044842 | Bacteria | 2739 |
| 254 | Ga0466957_0253138 | 3300044842 | Bacteria | 1172 |
| 255 | Ga0466957_0313992 | 3300044842 | Bacteria | 1056 |
| 256 | Ga0466960_0259204 | 3300044901 | Bacteria | 968 |
| 257 | Ga0466960_0777584 | 3300044901 | Bacteria | 578 |
| 258 | Ga0466959_0003855 | 3300045049 | Bacteria | 9948 |
| 259 | Ga0466959_0043510 | 3300045049 | Bacteria | 3310 |
| 260 | Ga0466959_0119108 | 3300045049 | Bacteria | 1878 |
| 261 | Ga0466959_0163733 | 3300045049 | Bacteria | 1563 |
| 262 | Ga0466958_0000693 | 3300045836 | Bacteria | 14666 |
| 263 | Ga0466958_0012709 | 3300045836 | Bacteria | 4774 |
| 264 | Ga0466958_0243062 | 3300045836 | Bacteria | 1150 |
| 265 | Ga0466958_0250238 | 3300045836 | Archaea | 1133 |
| 266 | Ga0466967_0000654 | 3300045976 | Bacteria | 17408 |
| 267 | Ga0466967_0013839 | 3300045976 | Bacteria | 6255 |
| 268 | Ga0466967_0021511 | 3300045976 | Bacteria | 5242 |
| 269 | Ga0466967_0030236 | 3300045976 | Bacteria | 4543 |
| 270 | Ga0466967_0037766 | 3300045976 | Bacteria | 4136 |
| 271 | Ga0466967_0049362 | 3300045976 | Bacteria | 3680 |
| 272 | Ga0466967_0125558 | 3300045976 | Bacteria | 2376 |
| 273 | Ga0466967_0142696 | 3300045976 | Bacteria | 2232 |
| 274 | Ga0466967_0182155 | 3300045976 | Unclassified | 1982 |
| 275 | Ga0466967_0250092 | 3300045976 | Bacteria | 1693 |
| 276 | Ga0466967_0268781 | 3300045976 | Bacteria | 1633 |
| 277 | Ga0466967_0399317 | 3300045976 | Bacteria | 1337 |
| 278 | Ga0466967_0413910 | 3300045976 | Bacteria | 1313 |
| 279 | Ga0466967_0540630 | 3300045976 | Unclassified | 1146 |
| 280 | Ga0466967_0844101 | 3300045976 | Bacteria | 910 |
| 281 | Ga0466967_2181808 | 3300045976 | Unclassified | 550 |
| 282 | Ga0495629_0209267 | 3300046459 | Bacteria | 1347 |
| 283 | Ga0495641_0043125 | 3300046461 | Bacteria | 2087 |
| 284 | Ga0495580_0528125 | 3300046472 | Unclassified | 786 |
| 285 | Ga0495582_0407625 | 3300046473 | Bacteria | 784 |
| 286 | Ga0495582_0432312 | 3300046473 | Bacteria | 760 |
| 287 | Ga0495582_0810030 | 3300046473 | Unclassified | 542 |
| 288 | Ga0495630_0116033 | 3300046517 | Bacteria | 2029 |
| 289 | Ga0495630_0266839 | 3300046517 | Unclassified | 1308 |
| 290 | Ga0495630_0409713 | 3300046517 | Bacteria | 1039 |
| 291 | Ga0495630_1298232 | 3300046517 | Bacteria | 549 |
| 292 | Ga0495635_0919237 | 3300046663 | Bacteria | 560 |
| 293 | Ga0495658_0052305 | 3300046683 | Bacteria | 2316 |
| 294 | Ga0495658_0444521 | 3300046683 | Unclassified | 828 |
| 295 | Ga0495581_0250267 | 3300047315 | Bacteria | 1036 |
| 296 | Ga0495581_0467662 | 3300047315 | Bacteria | 734 |
| 297 | Ga0495676_0083427 | 3300047321 | Unclassified | 2415 |
| 298 | Ga0495676_0121203 | 3300047321 | Bacteria | 1902 |
| 299 | Ga0495680_0259693 | 3300047322 | Bacteria | 1229 |
| 300 | Ga0495593_0364806 | 3300047673 | Bacteria | 722 |
| 301 | Ga0495614_0436728 | 3300048089 | Unclassified | 618 |
| 302 | Ga0496100_0001055 | 3300048903 | Bacteria | 13288 |
| 303 | Ga0496100_0374464 | 3300048903 | Bacteria | 1080 |
| 304 | Ga0496100_0393756 | 3300048903 | Unclassified | 1054 |
| 305 | Ga0496101_0044705 | 3300048904 | Bacteria | 3170 |
| 306 | Ga0496101_0135619 | 3300048904 | Bacteria | 1872 |
| 307 | Ga0496101_0195724 | 3300048904 | Bacteria | 1561 |
| 308 | Ga0496101_0226271 | 3300048904 | Bacteria | 1453 |
| 309 | Ga0496102_0004720 | 3300048905 | Bacteria | 11537 |
| 310 | Ga0496102_0028267 | 3300048905 | Bacteria | 5007 |
| 311 | Ga0496102_0047167 | 3300048905 | Bacteria | 3914 |
| 312 | Ga0496102_0405261 | 3300048905 | Bacteria | 1282 |
| 313 | Ga0496102_1027736 | 3300048905 | Bacteria | 744 |
| 314 | Ga0496103_0018903 | 3300048906 | Bacteria | 4138 |
| 315 | Ga0496103_0075690 | 3300048906 | Bacteria | 2111 |
| 316 | Ga0496103_0131342 | 3300048906 | Bacteria | 1599 |
| 317 | Ga0496103_0299567 | 3300048906 | Bacteria | 1034 |
| 318 | Ga0496103_0657366 | 3300048906 | Unclassified | 666 |
| 319 | Ga0496104_0005229 | 3300048907 | Bacteria | 11353 |
| 320 | Ga0496105_0000406 | 3300048908 | Bacteria | 28366 |
| 321 | Ga0496106_0000263 | 3300048909 | Bacteria | 36905 |
| 322 | Ga0496106_0015556 | 3300048909 | Bacteria | 5627 |
| 323 | Ga0496106_0038005 | 3300048909 | Bacteria | 3601 |
| 324 | Ga0496106_0824112 | 3300048909 | Unclassified | 735 |
| 325 | Ga0496107_0007491 | 3300048910 | Bacteria | 7525 |
| 326 | Ga0496107_0054919 | 3300048910 | Bacteria | 2875 |
| 327 | Ga0496107_0205064 | 3300048910 | Bacteria | 1466 |
| 328 | Ga0496108_0017688 | 3300048911 | Bacteria | 5832 |
| 329 | Ga0496108_0166388 | 3300048911 | Bacteria | 1907 |
| 330 | Ga0496109_0001107 | 3300048912 | Bacteria | 22340 |
| 331 | Ga0496109_0110975 | 3300048912 | Bacteria | 2550 |
| 332 | Ga0496110_0384256 | 3300048913 | Bacteria | 1279 |
| 333 | Ga0496111_0084852 | 3300048914 | Bacteria | 2315 |
| 334 | Ga0496111_0119228 | 3300048914 | Bacteria | 1948 |
| 335 | Ga0496112_0007861 | 3300048915 | Bacteria | 9495 |
| 336 | Ga0496112_0047557 | 3300048915 | Bacteria | 4209 |
| 337 | Ga0496112_0139452 | 3300048915 | Unclassified | 2394 |
| 338 | Ga0496112_0149219 | 3300048915 | Bacteria | 2305 |
| 339 | Ga0496112_0237921 | 3300048915 | Unclassified | 1774 |
| 340 | Ga0496112_0274137 | 3300048915 | Bacteria | 1635 |
| 341 | Ga0496112_0431657 | 3300048915 | Unclassified | 1256 |
| 342 | Ga0496112_1316552 | 3300048915 | Bacteria | 638 |
| 343 | Ga0496113_0332409 | 3300048916 | Bacteria | 1218 |
| 344 | Ga0496113_0372125 | 3300048916 | Bacteria | 1147 |
| 345 | Ga0496113_0745525 | 3300048916 | Unclassified | 780 |
| 346 | Ga0496114_0000444 | 3300048917 | Bacteria | 30383 |
| 347 | Ga0496114_0258644 | 3300048917 | Bacteria | 1532 |
| 348 | Ga0496114_0543328 | 3300048917 | Unclassified | 1027 |
| 349 | Ga0496114_0904923 | 3300048917 | Bacteria | 764 |
| 350 | Ga0496115_0000415 | 3300048918 | Bacteria | 34771 |
| 351 | Ga0501046_0810793 | 3300049580 | Unclassified | 656 |
| 352 | Ga0501070_0562938 | 3300049586 | Bacteria | 911 |
| 353 | Ga0501074_0227539 | 3300049590 | Bacteria | 1328 |
| 354 | Ga0501080_0361545 | 3300049742 | Unclassified | 1310 |
| 355 | Ga0495619_0192282 | 3300053085 | Bacteria | 1412 |
| 356 | Ga0466962_0001101 | 3300061719 | Bacteria | 12437 |
| 357 | Ga0466962_0032903 | 3300061719 | Bacteria | 2481 |
| 358 | Ga0265326_10114584 | |||
| 359 | Ga0065715_10190110 | |||
| 360 | Ga0070658_10003997 | |||
| 361 | Ga0070658_10045324 | |||
| 362 | Ga0070683_100004803 | |||
| 363 | Ga0070690_101301980 | |||
| 364 | Ga0070680_100002454 | |||
| 365 | Ga0070680_100375298 | |||
| 366 | Ga0070680_101929061 | |||
| 367 | Ga0070682_100373461 | |||
| 368 | Ga0068868_101778281 | |||
| 369 | Ga0070660_100005410 | |||
| 370 | Ga0070660_100005863 | |||
| 371 | Ga0070661_100105439 | |||
| 372 | Ga0070671_100035350 | |||
| 373 | Ga0070671_100039141 | |||
| 374 | Ga0070659_100545431 | |||
| 375 | Ga0070714_100176426 | |||
| 376 | Ga0070714_100185168 | |||
| 377 | Ga0070714_100967070 | |||
| 378 | Ga0070714_101077226 | |||
| 379 | Ga0070714_101729801 | |||
| 380 | Ga0070714_102320778 | |||
| 381 | Ga0070710_10134332 | |||
| 382 | Ga0070711_100053918 | |||
| 383 | Ga0070708_100779499 | |||
| 384 | Ga0070678_100271324 | |||
| 385 | Ga0070681_10021806 | |||
| 386 | Ga0070681_10032588 | |||
| 387 | Ga0070681_10058105 | |||
| 388 | Ga0070707_100945440 | |||
| 389 | Ga0070679_100052630 | |||
| 390 | Ga0070679_100129527 | |||
| 391 | Ga0070679_100155419 | |||
| 392 | Ga0070679_101034316 | |||
| 393 | Ga0070684_100001780 | |||
| 394 | Ga0070684_100233937 | |||
| 395 | Ga0068853_100695058 | |||
| 396 | Ga0070695_100435778 | |||
| 397 | Ga0068855_100036808 | |||
| 398 | Ga0068855_100059854 | |||
| 399 | Ga0068855_100062613 | |||
| 400 | Ga0068855_100456287 | |||
| 401 | Ga0068855_101734245 | |||
| 402 | Ga0068856_100244626 | |||
| 403 | Ga0068856_100509357 | |||
| 404 | Ga0068856_100639035 | |||
| 405 | Ga0068856_101593742 | |||
| 406 | Ga0068852_100708507 | |||
| 407 | Ga0068852_101954138 | |||
| 408 | Ga0070717_10804754 | |||
| 409 | Ga0070712_100061303 | |||
| 410 | Ga0070712_100401051 | |||
| 411 | Ga0070712_100405341 | |||
| 412 | Ga0070712_102042874 | |||
| 413 | Ga0097621_100217058 | |||
| 414 | Ga0097621_100342432 | |||
| 415 | Ga0068871_101053126 | |||
| 416 | Ga0105240_10024799 | |||
| 417 | Ga0105240_10223888 | |||
| 418 | Ga0105240_10349416 | |||
| 419 | Ga0105240_10938899 | |||
| 420 | Ga0105243_10014999 | |||
| 421 | Ga0105241_11951205 | |||
| 422 | Ga0105242_10215078 | |||
| 423 | Ga0157370_10009683 | |||
| 424 | Ga0157370_10068099 | |||
| 425 | Ga0157370_10337319 | |||
| 426 | Ga0157370_10360633 | |||
| 427 | Ga0157370_11530365 | |||
| 428 | Ga0157369_10028094 | |||
| 429 | Ga0157369_10032786 | |||
| 430 | Ga0157369_10064457 | |||
| 431 | Ga0157369_10161813 | |||
| 432 | Ga0157369_12336428 | |||
| 433 | Ga0157374_10719760 | |||
| 434 | Ga0157378_10183651 | |||
| 435 | Ga0157372_10030825 | |||
| 436 | Ga0157372_11052481 | |||
| 437 | Ga0197907_11348676 | |||
| 438 | Ga0206356_10015304 | |||
| 439 | Ga0206356_10067278 | |||
| 440 | Ga0206356_10104585 | |||
| 441 | Ga0206354_10052584 | |||
| 442 | Ga0206354_11031714 | |||
| 443 | Ga0206353_10546960 | |||
| 444 | Ga0206353_10734195 | |||
| 445 | Ga0206353_10815333 | |||
| 446 | Ga0206353_11449795 | |||
| 447 | Ga0213876_10346316 | |||
| 448 | Ga0207692_10121733 | |||
| 449 | Ga0207685_10213908 | |||
| 450 | Ga0207705_10215792 | |||
| 451 | Ga0207707_10006587 | |||
| 452 | Ga0207707_10013582 | |||
| 453 | Ga0207707_10905409 | |||
| 454 | Ga0207695_10219136 | |||
| 455 | Ga0207695_10851395 | |||
| 456 | Ga0207693_10080618 | |||
| 457 | Ga0207693_10124435 | |||
| 458 | Ga0207693_10217777 | |||
| 459 | Ga0207663_10080025 | |||
| 460 | Ga0207663_10132020 | |||
| 461 | Ga0207663_10710202 | |||
| 462 | Ga0207660_10143553 | |||
| 463 | Ga0207660_10158008 | |||
| 464 | Ga0207660_10909071 | |||
| 465 | Ga0207657_10000150 | |||
| 466 | Ga0207657_10015116 | |||
| 467 | Ga0207649_10128776 | |||
| 468 | Ga0207652_10169176 | |||
| 469 | Ga0207652_10198558 | |||
| 470 | Ga0207652_10242396 | |||
| 471 | Ga0207646_10661077 | |||
| 472 | Ga0207687_11835798 | |||
| 473 | Ga0207664_10097593 | |||
| 474 | Ga0207664_10147076 | |||
| 475 | Ga0207664_10719199 | |||
| 476 | Ga0207664_11836863 | |||
| 477 | Ga0207644_10108724 | |||
| 478 | Ga0207644_10491531 | |||
| 479 | Ga0207690_10518067 | |||
| 480 | Ga0207665_10067911 | |||
| 481 | Ga0207665_10697720 | |||
| 482 | Ga0207661_10255730 | |||
| 483 | Ga0207667_10039229 | |||
| 484 | Ga0207667_10206488 | |||
| 485 | Ga0207667_10396644 | |||
| 486 | Ga0207667_12019010 | |||
| 487 | Ga0207640_10990934 | |||
| 488 | Ga0207677_11895310 | |||
| 489 | Ga0207702_10622136 | |||
| 490 | Ga0207702_12464456 | |||
| 491 | Ga0207683_10070091 | |||
| 492 | Ga0207698_10023483 | |||
| 493 | Ga0207698_10443239 | |||
| 494 | Ga0207698_10891396 | |||
| 495 | Ga0207698_11015102 | |||
| 496 | Ga0265319_1010648 | |||
| 497 | Ga0265319_1122565 | |||
| 498 | Ga0265334_10025744 | |||
| 499 | Ga0265318_10004358 | |||
| 500 | Ga0265322_10084626 | |||
| 501 | Ga0265338_10094963 | |||
| 502 | Ga0265338_10124194 | |||
| 503 | Ga0265324_10035462 | |||
| 504 | Ga0265330_10041356 | |||
| 505 | Ga0265332_10180030 | |||
| 506 | Ga0265328_10044486 | |||
| 507 | Ga0265320_10090848 | |||
| 508 | Ga0265325_10017608 | |||
| 509 | Ga0265325_10113919 | |||
| 510 | Ga0265329_10017922 | |||
| 511 | Ga0265340_10085719 | |||
| 512 | Ga0265340_10139447 | |||
| 513 | Ga0265331_10049222 | |||
| 514 | Ga0265327_10020153 | |||
| 515 | Ga0265327_10060504 | |||
| 516 | Ga0265327_10065179 | |||
| 517 | Ga0265316_10020476 | |||
| 518 | Ga0265316_10136990 | |||
| 519 | Ga0265316_10957944 | |||
| 520 | Ga0265314_10008387 | |||
| 521 | Ga0265314_10012265 | |||
| 522 | Ga0265314_10315651 | |||
| 523 | Ga0265342_10049753 | |||
| 524 | Ga0373945_0109090 | |||
| 525 | Ga0373943_0002660 | |||
| 526 | Ga0373943_0048345 | |||
| 527 | Ga0373935_0281279 | |||
| 528 | Ga0373927_0051116 | |||
| 529 | Ga0373927_0559499 | |||
| 530 | Ga0373947_0027567 | |||
| 531 | Ga0373947_0069425 | |||
| 532 | Ga0373925_0001570 | |||
| 533 | Ga0373925_0058806 | |||
| 534 | Ga0395899_0118241 | |||
| 535 | Ga0395899_0201116 | |||
| 536 | Ga0395899_0387220 | |||
| 537 | Ga0395899_0431367 | |||
| 538 | Ga0395899_0537693 | |||
| 539 | Ga0395899_0711555 | |||
| 540 | Ga0395900_0018881 | |||
| 541 | Ga0395900_0025043 | |||
| 542 | Ga0395900_0042375 | |||
| 543 | Ga0395900_0131394 | |||
| 544 | Ga0395900_0184475 | |||
| 545 | Ga0395900_0328059 | |||
| 546 | Ga0395900_0358636 | |||
| 547 | Ga0395900_0386215 | |||
| 548 | Ga0395900_0424648 | |||
| 549 | Ga0395900_0459458 | |||
| 550 | Ga0395900_0542695 | |||
| 551 | Ga0395900_0569853 | |||
| 552 | Ga0395900_1152285 | |||
| 553 | Ga0395900_1201461 | |||
| 554 | Ga0395898_0003505 | |||
| 555 | Ga0395898_0003758 | |||
| 556 | Ga0395898_0345999 | |||
| 557 | Ga0395898_0478062 | |||
| 558 | Ga0395898_0494632 | |||
| 559 | Ga0395898_0563958 | |||
| 560 | Ga0395898_0958972 | |||
| 561 | Ga0395898_1077325 | |||
| 562 | Ga0395898_1302720 | |||
| 563 | Ga0395905_0003026 | |||
| 564 | Ga0395905_0344921 | |||
| 565 | Ga0395905_0551251 | |||
| 566 | Ga0395905_1101555 | |||
| 567 | Ga0436364_1191660 | |||
| 568 | Ga0395901_0001675 | |||
| 569 | Ga0395901_0002561 | |||
| 570 | Ga0395901_0026288 | |||
| 571 | Ga0395901_0148623 | |||
| 572 | Ga0395901_0180603 | |||
| 573 | Ga0395901_0200137 | |||
| 574 | Ga0395901_0509816 | |||
| 575 | Ga0395901_0743849 | |||
| 576 | Ga0395901_0850807 | |||
| 577 | Ga0436365_0297332 | |||
| 578 | Ga0436365_1516477 | |||
| 579 | Ga0436363_0686826 | |||
| 580 | Ga0436363_0709570 | |||
| 581 | Ga0451853_3688126 | |||
| 582 | Ga0451577_1590467 | |||
| 583 | Ga0466969_0217917 | |||
| 584 | Ga0466965_0029662 | |||
| 585 | Ga0466966_0037017 | |||
| 586 | Ga0466966_0409206 | |||
| 587 | Ga0466961_0010653 | |||
| 588 | Ga0466961_0048362 | |||
| 589 | Ga0466961_0145817 | |||
| 590 | Ga0466961_0240107 | |||
| 591 | Ga0466961_0261022 | |||
| 592 | Ga0466961_0975196 | |||
| 593 | Ga0466963_0000605 | |||
| 594 | Ga0466963_0032745 | |||
| 595 | Ga0466963_0040620 | |||
| 596 | Ga0466963_0118280 | |||
| 597 | Ga0466963_0230918 | |||
| 598 | Ga0466964_0036954 | |||
| 599 | Ga0466964_0066261 | |||
| 600 | Ga0466964_0109511 | |||
| 601 | Ga0466971_0000533 | |||
| 602 | Ga0466971_0014774 | |||
| 603 | Ga0466968_0010498 | |||
| 604 | Ga0466968_0062438 | |||
| 605 | Ga0466970_0088305 | |||
| 606 | Ga0466970_0202716 | |||
| 607 | Ga0466957_0009517 | |||
| 608 | Ga0466957_0018585 | |||
| 609 | Ga0466957_0032383 | |||
| 610 | Ga0466957_0042854 | |||
| 611 | Ga0466957_0253138 | |||
| 612 | Ga0466957_0313992 | |||
| 613 | Ga0466960_0259204 | |||
| 614 | Ga0466960_0777584 | |||
| 615 | Ga0466959_0003855 | |||
| 616 | Ga0466959_0043510 | |||
| 617 | Ga0466959_0119108 | |||
| 618 | Ga0466959_0163733 | |||
| 619 | Ga0466958_0000693 | |||
| 620 | Ga0466958_0012709 | |||
| 621 | Ga0466958_0243062 | |||
| 622 | Ga0466958_0250238 | |||
| 623 | Ga0466967_0000654 | |||
| 624 | Ga0466967_0013839 | |||
| 625 | Ga0466967_0021511 | |||
| 626 | Ga0466967_0030236 | |||
| 627 | Ga0466967_0037766 | |||
| 628 | Ga0466967_0049362 | |||
| 629 | Ga0466967_0125558 | |||
| 630 | Ga0466967_0142696 | |||
| 631 | Ga0466967_0182155 | |||
| 632 | Ga0466967_0250092 | |||
| 633 | Ga0466967_0268781 | |||
| 634 | Ga0466967_0399317 | |||
| 635 | Ga0466967_0413910 | |||
| 636 | Ga0466967_0540630 | |||
| 637 | Ga0466967_0844101 | |||
| 638 | Ga0466967_2181808 | |||
| 639 | Ga0495629_0209267 | |||
| 640 | Ga0495641_0043125 | |||
| 641 | Ga0495580_0528125 | |||
| 642 | Ga0495582_0407625 | |||
| 643 | Ga0495582_0432312 | |||
| 644 | Ga0495582_0810030 | |||
| 645 | Ga0495630_0116033 | |||
| 646 | Ga0495630_0266839 | |||
| 647 | Ga0495630_0409713 | |||
| 648 | Ga0495630_1298232 | |||
| 649 | Ga0495635_0919237 | |||
| 650 | Ga0495658_0052305 | |||
| 651 | Ga0495658_0444521 | |||
| 652 | Ga0495581_0250267 | |||
| 653 | Ga0495581_0467662 | |||
| 654 | Ga0495676_0083427 | |||
| 655 | Ga0495676_0121203 | |||
| 656 | Ga0495680_0259693 | |||
| 657 | Ga0495593_0364806 | |||
| 658 | Ga0495614_0436728 | |||
| 659 | Ga0496100_0001055 | |||
| 660 | Ga0496100_0374464 | |||
| 661 | Ga0496100_0393756 | |||
| 662 | Ga0496101_0044705 | |||
| 663 | Ga0496101_0135619 | |||
| 664 | Ga0496101_0195724 | |||
| 665 | Ga0496101_0226271 | |||
| 666 | Ga0496102_0004720 | |||
| 667 | Ga0496102_0028267 | |||
| 668 | Ga0496102_0047167 | |||
| 669 | Ga0496102_0405261 | |||
| 670 | Ga0496102_1027736 | |||
| 671 | Ga0496103_0018903 | |||
| 672 | Ga0496103_0075690 | |||
| 673 | Ga0496103_0131342 | |||
| 674 | Ga0496103_0299567 | |||
| 675 | Ga0496103_0657366 | |||
| 676 | Ga0496104_0005229 | |||
| 677 | Ga0496105_0000406 | |||
| 678 | Ga0496106_0000263 | |||
| 679 | Ga0496106_0015556 | |||
| 680 | Ga0496106_0038005 | |||
| 681 | Ga0496106_0824112 | |||
| 682 | Ga0496107_0007491 | |||
| 683 | Ga0496107_0054919 | |||
| 684 | Ga0496107_0205064 | |||
| 685 | Ga0496108_0017688 | |||
| 686 | Ga0496108_0166388 | |||
| 687 | Ga0496109_0001107 | |||
| 688 | Ga0496109_0110975 | |||
| 689 | Ga0496110_0384256 | |||
| 690 | Ga0496111_0084852 | |||
| 691 | Ga0496111_0119228 | |||
| 692 | Ga0496112_0007861 | |||
| 693 | Ga0496112_0047557 | |||
| 694 | Ga0496112_0139452 | |||
| 695 | Ga0496112_0149219 | |||
| 696 | Ga0496112_0237921 | |||
| 697 | Ga0496112_0274137 | |||
| 698 | Ga0496112_0431657 | |||
| 699 | Ga0496112_1316552 | |||
| 700 | Ga0496113_0332409 | |||
| 701 | Ga0496113_0372125 | |||
| 702 | Ga0496113_0745525 | |||
| 703 | Ga0496114_0000444 | |||
| 704 | Ga0496114_0258644 | |||
| 705 | Ga0496114_0543328 | |||
| 706 | Ga0496114_0904923 | |||
| 707 | Ga0496115_0000415 | |||
| 708 | Ga0501046_0810793 | |||
| 709 | Ga0501070_0562938 | |||
| 710 | Ga0501074_0227539 | |||
| 711 | Ga0501080_0361545 | |||
| 712 | Ga0495619_0192282 | |||
| 713 | Ga0466962_0001101 | |||
| 714 | Ga0466962_0032903 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.7757 | 7 | 128 |
| 1lql-assembly4.cif.gz_G | crystal structure of osmc like protein from mycoplasma pneumoniae | 0.7441 | 4 | 129 |
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.727 | 7 | 128 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.7269 | 9 | 130 |
| 2e8c-assembly1.cif.gz_A | crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 | 0.7253 | 5 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lqlE02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8441 | 33 | 129 | 3.30.300.20 |
| 1lqlE02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7859 | 33 | 129 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.737 | 35 | 129 | 3.30.300.20 |
| af_Q57993_77_188_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7133 | 25 | 128 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7094 | 35 | 129 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537TP33-F1-model_v4 | OsmC family peroxiredoxin | 0.954 | 4 | 130 |
|
| AF-A0A7W1R0W6-F1-model_v4 | OsmC family peroxiredoxin | 0.9446 | 60 | 130 |
|
| AF-A0A538IDI8-F1-model_v4 | OsmC family peroxiredoxin | 0.942 | 1 | 130 |
|
| AF-A0A538CZY7-F1-model_v4 | OsmC family protein | 0.94 | 1 | 130 |
|
| AF-A0A7W0SZG2-F1-model_v4 | OsmC family protein | 0.9375 | 1 | 130 |
|