F420811

General Info

Members Datasets Scaffolds Average Seq Length
357 212 714 163

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10502040|Ga0105240_105020401
Length 200
Sequence MALNGARAFQASDCRSAWRSRSEEAEAGRRLSLALRSDGMAGETVVEKVREIAGRVAADRGLEVFDIQFRREAPGMVLRIQIDRPGPAASAEDSVSVEDCAHVSRDLSAILDVEDVVPTAYTLEVSSPGLDRPLRRPDDYRRFAGRLAKIVMRERIDGQGFFRGRLGGVDGGDVLIDGDDGKTHRVPIAVITRANLEVEF

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.16
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10502040 3300009093 Bacteria 1349
2 Ga0058860_10011532 3300004801 Unclassified 610
3 Ga0065715_10039950 3300005293 Bacteria 1231
4 Ga0065707_10118151 3300005295 Bacteria 2193
5 Ga0070683_100600707 3300005329 Unclassified 1053
6 Ga0070690_100051940 3300005330 Bacteria 2619
7 Ga0070670_100342019 3300005331 Bacteria 1313
8 Ga0070670_100625451 3300005331 Bacteria 964
9 Ga0070666_10023253 3300005335 Bacteria 4034
10 Ga0070680_100078201 3300005336 Bacteria 2725
11 Ga0070680_100308846 3300005336 Bacteria 1341
12 Ga0070682_100093581 3300005337 Bacteria 1971
13 Ga0068868_100101291 3300005338 Bacteria 2331
14 Ga0068868_101406952 3300005338 Bacteria 651
15 Ga0070689_101487839 3300005340 Bacteria 613
16 Ga0070687_100022708 3300005343 Bacteria 2970
17 Ga0070661_100324376 3300005344 Bacteria 1203
18 Ga0070668_101545319 3300005347 Unclassified 607
19 Ga0070675_100003629 3300005354 Bacteria 11733
20 Ga0070671_100512662 3300005355 Bacteria 1032
21 Ga0070671_100558319 3300005355 Bacteria 988
22 Ga0070674_101590317 3300005356 Bacteria 589
23 Ga0070673_100146632 3300005364 Bacteria 1995
24 Ga0070673_100481118 3300005364 Bacteria 1121
25 Ga0070673_102187462 3300005364 Unclassified 526
26 Ga0070688_100380590 3300005365 Bacteria 1040
27 Ga0070659_100564911 3300005366 Bacteria 975
28 Ga0070659_101316802 3300005366 Unclassified 641
29 Ga0070667_100599888 3300005367 Bacteria 1014
30 Ga0070714_100023699 3300005435 Bacteria 5046
31 Ga0070713_100047875 3300005436 Bacteria 3517
32 Ga0070701_10481832 3300005438 Bacteria 802
33 Ga0070711_100969695 3300005439 Bacteria 728
34 Ga0070705_100629275 3300005440 Bacteria 834
35 Ga0070705_100942285 3300005440 Bacteria 697
36 Ga0070681_10400109 3300005458 Unclassified 1285
37 Ga0070706_101752502 3300005467 Bacteria 565
38 Ga0070707_100082733 3300005468 Bacteria 3101
39 Ga0070707_100761114 3300005468 Unclassified 932
40 Ga0070698_100052624 3300005471 Bacteria 4141
41 Ga0070698_100417021 3300005471 Bacteria 1277
42 Ga0070698_100537161 3300005471 Bacteria 1108
43 Ga0070698_101306080 3300005471 Unclassified 676
44 Ga0070698_101790621 3300005471 Bacteria 567
45 Ga0070699_100083514 3300005518 Bacteria 2786
46 Ga0070699_100126793 3300005518 Bacteria 2247
47 Ga0070679_100133750 3300005530 Bacteria 2461
48 Ga0070684_100326126 3300005535 Bacteria 1411
49 Ga0070697_100043638 3300005536 Bacteria 3631
50 Ga0070697_100485186 3300005536 Bacteria 1079
51 Ga0070697_100709375 3300005536 Unclassified 888
52 Ga0068853_100369251 3300005539 Bacteria 1338
53 Ga0068853_101420189 3300005539 Bacteria 671
54 Ga0070672_100313643 3300005543 Bacteria 1332
55 Ga0070672_100547053 3300005543 Unclassified 1005
56 Ga0070672_100678407 3300005543 Bacteria 901
57 Ga0070686_100024367 3300005544 Bacteria 3626
58 Ga0070686_100052520 3300005544 Bacteria 2599
59 Ga0070686_100351509 3300005544 Bacteria 1108
60 Ga0070695_100025528 3300005545 Bacteria 3650
61 Ga0070696_100452970 3300005546 Unclassified 1013
62 Ga0070696_101293128 3300005546 Bacteria 619
63 Ga0070693_100590701 3300005547 Bacteria 800
64 Ga0070665_100269604 3300005548 Bacteria 1704
65 Ga0070704_100045731 3300005549 Bacteria 3047
66 Ga0070704_100120207 3300005549 Bacteria 2017
67 Ga0070704_100173183 3300005549 Bacteria 1719
68 Ga0068855_100023879 3300005563 Bacteria 7324
69 Ga0068855_100315902 3300005563 Bacteria 1728
70 Ga0068855_101007989 3300005563 Bacteria 875
71 Ga0068855_101342858 3300005563 Bacteria 738
72 Ga0070664_100103451 3300005564 Bacteria 2479
73 Ga0070664_100443873 3300005564 Bacteria 1190
74 Ga0068857_100691057 3300005577 Bacteria 969
75 Ga0068854_100025423 3300005578 Bacteria 4062
76 Ga0068854_100073401 3300005578 Bacteria 2507
77 Ga0068854_100192342 3300005578 Bacteria 1599
78 Ga0068854_100795675 3300005578 Bacteria 824
79 Ga0068856_100138418 3300005614 Bacteria 2441
80 Ga0068856_100357364 3300005614 Bacteria 1479
81 Ga0068852_100230897 3300005616 Bacteria 1764
82 Ga0068852_100317474 3300005616 Bacteria 1512
83 Ga0068859_100383110 3300005617 Bacteria 1502
84 Ga0068859_100416656 3300005617 Bacteria 1439
85 Ga0068859_100608196 3300005617 Unclassified 1186
86 Ga0068864_100088757 3300005618 Bacteria 2723
87 Ga0068864_100148707 3300005618 Bacteria 2120
88 Ga0068864_100487067 3300005618 Bacteria 1184
89 Ga0068861_100471958 3300005719 Bacteria 1128
90 Ga0068861_100521551 3300005719 Bacteria 1078
91 Ga0068861_100612656 3300005719 Bacteria 1001
92 Ga0068861_101758950 3300005719 Unclassified 614
93 Ga0068851_10318529 3300005834 Bacteria 898
94 Ga0068870_10208780 3300005840 Bacteria 1188
95 Ga0068863_100740080 3300005841 Bacteria 979
96 Ga0068863_101478060 3300005841 Bacteria 688
97 Ga0068858_100154105 3300005842 Bacteria 2161
98 Ga0068858_100598911 3300005842 Bacteria 1069
99 Ga0068860_100377154 3300005843 Bacteria 1400
100 Ga0068860_100430848 3300005843 Bacteria 1308
101 Ga0068860_100474887 3300005843 Bacteria 1246
102 Ga0070717_10290151 3300006028 Bacteria 1453
103 Ga0097621_100079857 3300006237 Bacteria 2720
104 Ga0097621_100190113 3300006237 Bacteria 1778
105 Ga0097621_100573878 3300006237 Bacteria 1029
106 Ga0068871_101125480 3300006358 Unclassified 735
107 Ga0068871_101796234 3300006358 Bacteria 582
108 Ga0075431_100109025 3300006847 Bacteria 2858
109 Ga0075433_10152934 3300006852 Bacteria 2052
110 Ga0075434_100007884 3300006871 Bacteria 9863
111 Ga0075434_100032976 3300006871 Bacteria 5109
112 Ga0075434_100142466 3300006871 Bacteria 2417
113 Ga0075434_100201191 3300006871 Bacteria 2012
114 Ga0068865_100267274 3300006881 Bacteria 1356
115 Ga0068865_100516877 3300006881 Bacteria 998
116 Ga0075436_100018393 3300006914 Bacteria 4784
117 Ga0075436_100044320 3300006914 Bacteria 3067
118 Ga0075436_100175958 3300006914 Bacteria 1511
119 Ga0075436_100928500 3300006914 Bacteria 651
120 Ga0097620_100383084 3300006931 Bacteria 1502
121 Ga0097620_100416642 3300006931 Bacteria 1439
122 Ga0097620_100608200 3300006931 Unclassified 1186
123 Ga0075435_100000417 3300007076 Bacteria 26219
124 Ga0075435_100009299 3300007076 Bacteria 7104
125 Ga0075435_100122764 3300007076 Bacteria 2168
126 Ga0075435_100134864 3300007076 Bacteria 2067
127 Ga0075435_100491526 3300007076 Bacteria 1061
128 Ga0105240_10070871 3300009093 Bacteria 4311
129 Ga0105240_10437480 3300009093 Bacteria 1466
130 Ga0105240_11179156 3300009093 Bacteria 812
131 Ga0111539_10569976 3300009094 Bacteria 1319
132 Ga0105245_10452148 3300009098 Bacteria 1293
133 Ga0105245_10546259 3300009098 Bacteria 1180
134 Ga0105247_10019032 3300009101 Bacteria 4124
135 Ga0105247_10323980 3300009101 Bacteria 1076
136 Ga0114129_10017677 3300009147 Bacteria 10151
137 Ga0114129_10159556 3300009147 Bacteria 3082
138 Ga0114129_10903468 3300009147 Unclassified 1119
139 Ga0114129_11259076 3300009147 Bacteria 919
140 Ga0105242_10738544 3300009176 Bacteria 967
141 Ga0105242_11904777 3300009176 Bacteria 635
142 Ga0105248_10086000 3300009177 Bacteria 3537
143 Ga0105248_10097087 3300009177 Bacteria 3320
144 Ga0105248_10321069 3300009177 Bacteria 1744
145 Ga0105248_10492527 3300009177 Unclassified 1382
146 Ga0105248_10524911 3300009177 Bacteria 1335
147 Ga0105248_11263601 3300009177 Bacteria 835
148 Ga0105238_10142937 3300009551 Bacteria 2369
149 Ga0105238_11160008 3300009551 Bacteria 796
150 Ga0105249_10940866 3300009553 Bacteria 932
151 Ga0105249_11120297 3300009553 Bacteria 857
152 Ga0105239_10283579 3300010375 Bacteria 1865
153 Ga0105239_10521687 3300010375 Bacteria 1351
154 Ga0105246_10808916 3300011119 Bacteria 832
155 Ga0105246_11978457 3300011119 Bacteria 562
156 Ga0157370_10434780 3300013104 Bacteria 1207
157 Ga0163162_11775531 3300013306 Bacteria 705
158 Ga0157372_11121006 3300013307 Bacteria 910
159 Ga0157375_10276664 3300013308 Bacteria 1841
160 Ga0157375_10993002 3300013308 Bacteria 979
161 Ga0157375_12561271 3300013308 Unclassified 609
162 Ga0163163_10002349 3300014325 Bacteria 16012
163 Ga0163163_10358788 3300014325 Bacteria 1514
164 Ga0157380_10232089 3300014326 Bacteria 1658
165 Ga0157380_10300861 3300014326 Bacteria 1478
166 Ga0157377_10353902 3300014745 Bacteria 986
167 Ga0157379_10225215 3300014968 Bacteria 1699
168 Ga0157379_10459923 3300014968 Bacteria 1176
169 Ga0157376_10349248 3300014969 Bacteria 1415
170 Ga0163161_11815391 3300017792 Bacteria 542
171 Ga0197907_10848522 3300020069 Bacteria 920
172 Ga0206356_11143131 3300020070 Bacteria 627
173 Ga0207697_10076475 3300025315 Bacteria 1407
174 Ga0207656_10196512 3300025321 Bacteria 973
175 Ga0207656_10283516 3300025321 Bacteria 817
176 Ga0207682_10246048 3300025893 Bacteria 832
177 Ga0207710_10018557 3300025900 Bacteria 2960
178 Ga0207680_11067214 3300025903 Bacteria 578
179 Ga0207645_10166934 3300025907 Bacteria 1441
180 Ga0207705_10054118 3300025909 Bacteria 2892
181 Ga0207684_10499717 3300025910 Bacteria 1042
182 Ga0207707_10890958 3300025912 Unclassified 736
183 Ga0207695_10180127 3300025913 Bacteria 2034
184 Ga0207695_10721848 3300025913 Bacteria 877
185 Ga0207663_10912526 3300025916 Bacteria 703
186 Ga0207660_10031054 3300025917 Bacteria 3676
187 Ga0207660_10100193 3300025917 Bacteria 2163
188 Ga0207662_10059790 3300025918 Bacteria 2284
189 Ga0207662_10157452 3300025918 Bacteria 1449
190 Ga0207649_10269244 3300025920 Bacteria 1234
191 Ga0207652_10184917 3300025921 Bacteria 1874
192 Ga0207681_10123632 3300025923 Bacteria 1902
193 Ga0207681_10838109 3300025923 Bacteria 769
194 Ga0207694_10125250 3300025924 Bacteria 2055
195 Ga0207650_11059122 3300025925 Bacteria 690
196 Ga0207659_10000196 3300025926 Bacteria 35986
197 Ga0207659_10123627 3300025926 Bacteria 1986
198 Ga0207659_10140799 3300025926 Bacteria 1872
199 Ga0207687_10257300 3300025927 Bacteria 1390
200 Ga0207700_10603740 3300025928 Bacteria 977
201 Ga0207664_10401061 3300025929 Bacteria 1220
202 Ga0207644_10168976 3300025931 Bacteria 1706
203 Ga0207644_10579356 3300025931 Bacteria 931
204 Ga0207690_10034399 3300025932 Bacteria 3266
205 Ga0207690_10071201 3300025932 Bacteria 2397
206 Ga0207690_11185727 3300025932 Unclassified 637
207 Ga0207686_10203892 3300025934 Bacteria 1418
208 Ga0207691_10278526 3300025940 Bacteria 1439
209 Ga0207691_10419500 3300025940 Unclassified 1140
210 Ga0207711_10010942 3300025941 Bacteria 7540
211 Ga0207711_10233143 3300025941 Bacteria 1686
212 Ga0207711_10526215 3300025941 Bacteria 1102
213 Ga0207711_10679081 3300025941 Bacteria 961
214 Ga0207689_10487053 3300025942 Bacteria 1033
215 Ga0207661_10505690 3300025944 Bacteria 1104
216 Ga0207679_10154595 3300025945 Bacteria 1872
217 Ga0207679_10615129 3300025945 Bacteria 980
218 Ga0207667_10430514 3300025949 Bacteria 1342
219 Ga0207667_10620881 3300025949 Bacteria 1088
220 Ga0207667_10647610 3300025949 Bacteria 1062
221 Ga0207651_10486437 3300025960 Bacteria 1065
222 Ga0207651_10624284 3300025960 Bacteria 944
223 Ga0207712_10198936 3300025961 Bacteria 1587
224 Ga0207668_11241355 3300025972 Unclassified 670
225 Ga0207640_10071639 3300025981 Bacteria 2335
226 Ga0207640_10813641 3300025981 Bacteria 810
227 Ga0207640_11791352 3300025981 Unclassified 555
228 Ga0207658_10169652 3300025986 Bacteria 1797
229 Ga0207677_10291781 3300026023 Bacteria 1344
230 Ga0207703_10378768 3300026035 Unclassified 1308
231 Ga0207703_11124493 3300026035 Bacteria 755
232 Ga0207702_10040123 3300026078 Bacteria 3924
233 Ga0207641_10066005 3300026088 Bacteria 3097
234 Ga0207641_10733472 3300026088 Bacteria 974
235 Ga0207676_10054094 3300026095 Bacteria 3144
236 Ga0207676_10141113 3300026095 Bacteria 2063
237 Ga0207676_10543170 3300026095 Bacteria 1109
238 Ga0207676_11855272 3300026095 Bacteria 601
239 Ga0207675_100309150 3300026118 Bacteria 1541
240 Ga0207675_100349957 3300026118 Bacteria 1448
241 Ga0207675_101377998 3300026118 Bacteria 726
242 Ga0207698_11298248 3300026142 Bacteria 742
243 Ga0268266_10261273 3300028379 Bacteria 1605
244 Ga0268265_10197360 3300028380 Bacteria 1743
245 Ga0268265_10307628 3300028380 Bacteria 1430
246 Ga0268264_10478317 3300028381 Bacteria 1211
247 Ga0268264_10818120 3300028381 Bacteria 931
248 Ga0268264_11736810 3300028381 Viruses 634
249 Ga0307409_101278023 3300031995 Unclassified 759
250 Ga0307416_102781152 3300032002 Unclassified 585
251 Ga0373948_0000850 3300034817 Bacteria 4055
252 Ga0373950_0001559 3300034818 Bacteria 3010
253 Ga0373959_0007423 3300034820 Bacteria 1842
254 Ga0373938_0000827 3300034957 Bacteria 5005
255 Ga0373929_0016012 3300035085 Bacteria 1464
256 Ga0373949_0002571 3300035090 Bacteria 4608
257 Ga0373951_0010429 3300035091 Bacteria 2085
258 Ga0373952_0001553 3300035092 Bacteria 4188
259 Ga0373932_0001699 3300035112 Bacteria 5985
260 Ga0373941_0004788 3300035115 Bacteria 3148
261 Ga0373953_0153708 3300035117 Bacteria 987
262 Ga0373956_0243701 3300035119 Bacteria 854
263 Ga0373960_0003598 3300035121 Bacteria 3512
264 Ga0373942_0003176 3300035207 Bacteria 3888
265 Ga0373961_0012858 3300035241 Bacteria 2101
266 Ga0373962_0002102 3300035242 Bacteria 4755
267 Ga0373924_0091926 3300035410 Bacteria 1299
268 Ga0373931_0025438 3300035691 Bacteria 3006
269 Ga0373931_0251817 3300035691 Bacteria 1074
270 Ga0373935_0609490 3300035692 Bacteria 799
271 Ga0373937_0027858 3300036401 Bacteria 5111
272 Ga0451804_0123851 3300041463 Unclassified 628
273 Ga0451577_0270635 3300042876 Bacteria 1539
274 Ga0453684_1444616 3300044712 Bacteria 712
275 Ga0451576_0019814 3300045051 Bacteria 7338
276 Ga0466967_1824739 3300045976 Bacteria 605
277 Ga0495629_0410250 3300046459 Bacteria 920
278 Ga0495582_0045814 3300046473 Bacteria 2409
279 Ga0495639_0290308 3300046475 Unclassified 814
280 Ga0495583_0187380 3300046506 Bacteria 845
281 Ga0495610_0328357 3300046512 Bacteria 582
282 Ga0495628_0313511 3300046516 Bacteria 1159
283 Ga0495640_0104528 3300046533 Bacteria 1856
284 Ga0495586_0431623 3300046535 Unclassified 759
285 Ga0495621_0178708 3300046539 Bacteria 846
286 Ga0495611_0191827 3300046648 Bacteria 954
287 Ga0495635_0242187 3300046663 Bacteria 1217
288 Ga0495659_0018540 3300046664 Bacteria 2320
289 Ga0495599_0275436 3300046678 Bacteria 1020
290 Ga0495647_0153375 3300046681 Bacteria 989
291 Ga0495647_0485981 3300046681 Bacteria 574
292 Ga0495658_0079240 3300046683 Bacteria 1924
293 Ga0495658_0092027 3300046683 Bacteria 1797
294 Ga0495669_0358323 3300046684 Unclassified 705
295 Ga0495613_0239159 3300046689 Bacteria 1270
296 Ga0495670_0112997 3300046691 Bacteria 1406
297 Ga0495674_0108445 3300047319 Bacteria 2356
298 Ga0495672_0191620 3300047320 Bacteria 1028
299 Ga0495684_0211244 3300047471 Bacteria 1427
300 Ga0496100_0598717 3300048903 Bacteria 856
301 Ga0496100_0672395 3300048903 Bacteria 807
302 Ga0496101_0774403 3300048904 Bacteria 757
303 Ga0496101_1266145 3300048904 Bacteria 577
304 Ga0496102_0819814 3300048905 Bacteria 853
305 Ga0496104_0116200 3300048907 Bacteria 2567
306 Ga0496105_0162283 3300048908 Bacteria 1835
307 Ga0496105_0380557 3300048908 Bacteria 1123
308 Ga0496106_0163526 3300048909 Bacteria 1761
309 Ga0496106_0200565 3300048909 Bacteria 1588
310 Ga0496106_0524935 3300048909 Unclassified 951
311 Ga0496107_0134984 3300048910 Bacteria 1823
312 Ga0496108_0010989 3300048911 Bacteria 7353
313 Ga0496108_0125460 3300048911 Bacteria 2204
314 Ga0496109_0393158 3300048912 Bacteria 1310
315 Ga0496110_0065485 3300048913 Bacteria 3213
316 Ga0496112_0002130 3300048915 Bacteria 15719
317 Ga0496112_0371657 3300048915 Bacteria 1371
318 Ga0496112_0494944 3300048915 Bacteria 1158
319 Ga0496112_0666275 3300048915 Bacteria 970
320 Ga0496113_0078111 3300048916 Bacteria 2532
321 Ga0501046_0718189 3300049580 Bacteria 703
322 Ga0501047_0210840 3300049581 Bacteria 1801
323 Ga0501077_0171340 3300049593 Bacteria 1379
324 Ga0501080_0654017 3300049742 Bacteria 930
325 Ga0501035_0473567 3300049822 Bacteria 1034
326 Ga0501044_0001973 3300049823 Bacteria 23738
327 Ga0501045_0409808 3300049824 Bacteria 1008
328 nmdc:mga05p37_25432_c1 3300050507 Bacteria 7200
329 nmdc:mga05p37_29417_c1 3300050507 Unclassified 2333
330 nmdc:mga05p37_385082_c1 3300050507 Bacteria 1642
331 nmdc:mga05p37_92848_c1 3300050507 Bacteria 3719
332 nmdc:mga0qj67_653464_c1 3300050509 Bacteria 839
333 nmdc:mga06r32_46802_c1 3300050510 Bacteria 4128
334 nmdc:mga0n895_1099459_c1 3300050512 Bacteria 772
335 nmdc:mga0n895_128982_c1 3300050512 Bacteria 2553
336 nmdc:mga0n895_182_c1 3300050512 Bacteria 38722
337 nmdc:mga0n895_205669_c1 3300050512 Bacteria 1999
338 nmdc:mga0n895_43951_c1 3300050512 Bacteria 4357
339 nmdc:mga0n895_822378_c1 3300050512 Bacteria 918
340 nmdc:mga0n895_85294_c1 3300050512 Bacteria 3153
341 nmdc:mga0rr50_1395_c1 3300050513 Bacteria 13224
342 nmdc:mga0rr50_388379_c1 3300050513 Bacteria 1178
343 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
344 nmdc:mga0rr50_55510_c1 3300050513 Bacteria 2956
345 nmdc:mga0rr50_611728_c1 3300050513 Unclassified 929
346 nmdc:mga08x19_10863_c1 3300050514 Bacteria 5476
347 nmdc:mga08x19_11705_c1 3300050514 Bacteria 5284
348 nmdc:mga08x19_23859_c1 3300050514 Bacteria 3797
349 nmdc:mga08x19_289727_c1 3300050514 Bacteria 1136
350 nmdc:mga0a205_1100964_c1 3300050515 Bacteria 642
351 nmdc:mga0a205_229160_c1 3300050515 Bacteria 1742
352 nmdc:mga0a205_476626_c1 3300050515 Bacteria 1106
353 Ga0495601_0224040 3300053077 Bacteria 1228
354 Ga0495595_0072910 3300053084 Bacteria 1625
355 Ga0495595_0599251 3300053084 Unclassified 563
356 Ga0495619_0044029 3300053085 Bacteria 2928
357 Ga0495619_0079426 3300053085 Bacteria 2207
358 Ga0105240_10502040
359 Ga0058860_10011532
360 Ga0065715_10039950
361 Ga0065707_10118151
362 Ga0070683_100600707
363 Ga0070690_100051940
364 Ga0070670_100342019
365 Ga0070670_100625451
366 Ga0070666_10023253
367 Ga0070680_100078201
368 Ga0070680_100308846
369 Ga0070682_100093581
370 Ga0068868_100101291
371 Ga0068868_101406952
372 Ga0070689_101487839
373 Ga0070687_100022708
374 Ga0070661_100324376
375 Ga0070668_101545319
376 Ga0070675_100003629
377 Ga0070671_100512662
378 Ga0070671_100558319
379 Ga0070674_101590317
380 Ga0070673_100146632
381 Ga0070673_100481118
382 Ga0070673_102187462
383 Ga0070688_100380590
384 Ga0070659_100564911
385 Ga0070659_101316802
386 Ga0070667_100599888
387 Ga0070714_100023699
388 Ga0070713_100047875
389 Ga0070701_10481832
390 Ga0070711_100969695
391 Ga0070705_100629275
392 Ga0070705_100942285
393 Ga0070681_10400109
394 Ga0070706_101752502
395 Ga0070707_100082733
396 Ga0070707_100761114
397 Ga0070698_100052624
398 Ga0070698_100417021
399 Ga0070698_100537161
400 Ga0070698_101306080
401 Ga0070698_101790621
402 Ga0070699_100083514
403 Ga0070699_100126793
404 Ga0070679_100133750
405 Ga0070684_100326126
406 Ga0070697_100043638
407 Ga0070697_100485186
408 Ga0070697_100709375
409 Ga0068853_100369251
410 Ga0068853_101420189
411 Ga0070672_100313643
412 Ga0070672_100547053
413 Ga0070672_100678407
414 Ga0070686_100024367
415 Ga0070686_100052520
416 Ga0070686_100351509
417 Ga0070695_100025528
418 Ga0070696_100452970
419 Ga0070696_101293128
420 Ga0070693_100590701
421 Ga0070665_100269604
422 Ga0070704_100045731
423 Ga0070704_100120207
424 Ga0070704_100173183
425 Ga0068855_100023879
426 Ga0068855_100315902
427 Ga0068855_101007989
428 Ga0068855_101342858
429 Ga0070664_100103451
430 Ga0070664_100443873
431 Ga0068857_100691057
432 Ga0068854_100025423
433 Ga0068854_100073401
434 Ga0068854_100192342
435 Ga0068854_100795675
436 Ga0068856_100138418
437 Ga0068856_100357364
438 Ga0068852_100230897
439 Ga0068852_100317474
440 Ga0068859_100383110
441 Ga0068859_100416656
442 Ga0068859_100608196
443 Ga0068864_100088757
444 Ga0068864_100148707
445 Ga0068864_100487067
446 Ga0068861_100471958
447 Ga0068861_100521551
448 Ga0068861_100612656
449 Ga0068861_101758950
450 Ga0068851_10318529
451 Ga0068870_10208780
452 Ga0068863_100740080
453 Ga0068863_101478060
454 Ga0068858_100154105
455 Ga0068858_100598911
456 Ga0068860_100377154
457 Ga0068860_100430848
458 Ga0068860_100474887
459 Ga0070717_10290151
460 Ga0097621_100079857
461 Ga0097621_100190113
462 Ga0097621_100573878
463 Ga0068871_101125480
464 Ga0068871_101796234
465 Ga0075431_100109025
466 Ga0075433_10152934
467 Ga0075434_100007884
468 Ga0075434_100032976
469 Ga0075434_100142466
470 Ga0075434_100201191
471 Ga0068865_100267274
472 Ga0068865_100516877
473 Ga0075436_100018393
474 Ga0075436_100044320
475 Ga0075436_100175958
476 Ga0075436_100928500
477 Ga0097620_100383084
478 Ga0097620_100416642
479 Ga0097620_100608200
480 Ga0075435_100000417
481 Ga0075435_100009299
482 Ga0075435_100122764
483 Ga0075435_100134864
484 Ga0075435_100491526
485 Ga0105240_10070871
486 Ga0105240_10437480
487 Ga0105240_11179156
488 Ga0111539_10569976
489 Ga0105245_10452148
490 Ga0105245_10546259
491 Ga0105247_10019032
492 Ga0105247_10323980
493 Ga0114129_10017677
494 Ga0114129_10159556
495 Ga0114129_10903468
496 Ga0114129_11259076
497 Ga0105242_10738544
498 Ga0105242_11904777
499 Ga0105248_10086000
500 Ga0105248_10097087
501 Ga0105248_10321069
502 Ga0105248_10492527
503 Ga0105248_10524911
504 Ga0105248_11263601
505 Ga0105238_10142937
506 Ga0105238_11160008
507 Ga0105249_10940866
508 Ga0105249_11120297
509 Ga0105239_10283579
510 Ga0105239_10521687
511 Ga0105246_10808916
512 Ga0105246_11978457
513 Ga0157370_10434780
514 Ga0163162_11775531
515 Ga0157372_11121006
516 Ga0157375_10276664
517 Ga0157375_10993002
518 Ga0157375_12561271
519 Ga0163163_10002349
520 Ga0163163_10358788
521 Ga0157380_10232089
522 Ga0157380_10300861
523 Ga0157377_10353902
524 Ga0157379_10225215
525 Ga0157379_10459923
526 Ga0157376_10349248
527 Ga0163161_11815391
528 Ga0197907_10848522
529 Ga0206356_11143131
530 Ga0207697_10076475
531 Ga0207656_10196512
532 Ga0207656_10283516
533 Ga0207682_10246048
534 Ga0207710_10018557
535 Ga0207680_11067214
536 Ga0207645_10166934
537 Ga0207705_10054118
538 Ga0207684_10499717
539 Ga0207707_10890958
540 Ga0207695_10180127
541 Ga0207695_10721848
542 Ga0207663_10912526
543 Ga0207660_10031054
544 Ga0207660_10100193
545 Ga0207662_10059790
546 Ga0207662_10157452
547 Ga0207649_10269244
548 Ga0207652_10184917
549 Ga0207681_10123632
550 Ga0207681_10838109
551 Ga0207694_10125250
552 Ga0207650_11059122
553 Ga0207659_10000196
554 Ga0207659_10123627
555 Ga0207659_10140799
556 Ga0207687_10257300
557 Ga0207700_10603740
558 Ga0207664_10401061
559 Ga0207644_10168976
560 Ga0207644_10579356
561 Ga0207690_10034399
562 Ga0207690_10071201
563 Ga0207690_11185727
564 Ga0207686_10203892
565 Ga0207691_10278526
566 Ga0207691_10419500
567 Ga0207711_10010942
568 Ga0207711_10233143
569 Ga0207711_10526215
570 Ga0207711_10679081
571 Ga0207689_10487053
572 Ga0207661_10505690
573 Ga0207679_10154595
574 Ga0207679_10615129
575 Ga0207667_10430514
576 Ga0207667_10620881
577 Ga0207667_10647610
578 Ga0207651_10486437
579 Ga0207651_10624284
580 Ga0207712_10198936
581 Ga0207668_11241355
582 Ga0207640_10071639
583 Ga0207640_10813641
584 Ga0207640_11791352
585 Ga0207658_10169652
586 Ga0207677_10291781
587 Ga0207703_10378768
588 Ga0207703_11124493
589 Ga0207702_10040123
590 Ga0207641_10066005
591 Ga0207641_10733472
592 Ga0207676_10054094
593 Ga0207676_10141113
594 Ga0207676_10543170
595 Ga0207676_11855272
596 Ga0207675_100309150
597 Ga0207675_100349957
598 Ga0207675_101377998
599 Ga0207698_11298248
600 Ga0268266_10261273
601 Ga0268265_10197360
602 Ga0268265_10307628
603 Ga0268264_10478317
604 Ga0268264_10818120
605 Ga0268264_11736810
606 Ga0307409_101278023
607 Ga0307416_102781152
608 Ga0373948_0000850
609 Ga0373950_0001559
610 Ga0373959_0007423
611 Ga0373938_0000827
612 Ga0373929_0016012
613 Ga0373949_0002571
614 Ga0373951_0010429
615 Ga0373952_0001553
616 Ga0373932_0001699
617 Ga0373941_0004788
618 Ga0373953_0153708
619 Ga0373956_0243701
620 Ga0373960_0003598
621 Ga0373942_0003176
622 Ga0373961_0012858
623 Ga0373962_0002102
624 Ga0373924_0091926
625 Ga0373931_0025438
626 Ga0373931_0251817
627 Ga0373935_0609490
628 Ga0373937_0027858
629 Ga0451804_0123851
630 Ga0451577_0270635
631 Ga0453684_1444616
632 Ga0451576_0019814
633 Ga0466967_1824739
634 Ga0495629_0410250
635 Ga0495582_0045814
636 Ga0495639_0290308
637 Ga0495583_0187380
638 Ga0495610_0328357
639 Ga0495628_0313511
640 Ga0495640_0104528
641 Ga0495586_0431623
642 Ga0495621_0178708
643 Ga0495611_0191827
644 Ga0495635_0242187
645 Ga0495659_0018540
646 Ga0495599_0275436
647 Ga0495647_0153375
648 Ga0495647_0485981
649 Ga0495658_0079240
650 Ga0495658_0092027
651 Ga0495669_0358323
652 Ga0495613_0239159
653 Ga0495670_0112997
654 Ga0495674_0108445
655 Ga0495672_0191620
656 Ga0495684_0211244
657 Ga0496100_0598717
658 Ga0496100_0672395
659 Ga0496101_0774403
660 Ga0496101_1266145
661 Ga0496102_0819814
662 Ga0496104_0116200
663 Ga0496105_0162283
664 Ga0496105_0380557
665 Ga0496106_0163526
666 Ga0496106_0200565
667 Ga0496106_0524935
668 Ga0496107_0134984
669 Ga0496108_0010989
670 Ga0496108_0125460
671 Ga0496109_0393158
672 Ga0496110_0065485
673 Ga0496112_0002130
674 Ga0496112_0371657
675 Ga0496112_0494944
676 Ga0496112_0666275
677 Ga0496113_0078111
678 Ga0501046_0718189
679 Ga0501047_0210840
680 Ga0501077_0171340
681 Ga0501080_0654017
682 Ga0501035_0473567
683 Ga0501044_0001973
684 Ga0501045_0409808
685 nmdc:mga05p37_25432_c1
686 nmdc:mga05p37_29417_c1
687 nmdc:mga05p37_385082_c1
688 nmdc:mga05p37_92848_c1
689 nmdc:mga0qj67_653464_c1
690 nmdc:mga06r32_46802_c1
691 nmdc:mga0n895_1099459_c1
692 nmdc:mga0n895_128982_c1
693 nmdc:mga0n895_182_c1
694 nmdc:mga0n895_205669_c1
695 nmdc:mga0n895_43951_c1
696 nmdc:mga0n895_822378_c1
697 nmdc:mga0n895_85294_c1
698 nmdc:mga0rr50_1395_c1
699 nmdc:mga0rr50_388379_c1
700 nmdc:mga0rr50_45_c1
701 nmdc:mga0rr50_55510_c1
702 nmdc:mga0rr50_611728_c1
703 nmdc:mga08x19_10863_c1
704 nmdc:mga08x19_11705_c1
705 nmdc:mga08x19_23859_c1
706 nmdc:mga08x19_289727_c1
707 nmdc:mga0a205_1100964_c1
708 nmdc:mga0a205_229160_c1
709 nmdc:mga0a205_476626_c1
710 Ga0495601_0224040
711 Ga0495595_0072910
712 Ga0495595_0599251
713 Ga0495619_0044029
714 Ga0495619_0079426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02576

RimP_N

RimP N-terminal domain

52

131

0.95

PF17384

DUF150_C

RimP C-terminal SH3 domain

134

200

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x4j-assembly1.cif.gz_A crystal structure of orf137 from pyrobaculum spherical virus 0.845 106 158
3hfo-assembly1.cif.gz_B crystal structure of an hfq protein from synechocystis sp. 0.8294 107 159
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.8115 103 156
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.8074 104 156
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 0.804 107 156
ID Description Score Start End Superfamily
af_Q2G2D3_1_80_3.30.300.70 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;RimP-like superfamily, N-terminal 0.958 7 90 3.30.300.70
af_P0A8A8_87_147_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9431 99 159 2.30.30.180
af_P0A8A8_1_79_3.30.300.70 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;RimP-like superfamily, N-terminal 0.934 7 90 3.30.300.70
af_P0A8A8_87_147_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9142 99 159 2.30.30.180
af_Q2G2D3_1_80_3.30.300.70 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;RimP-like superfamily, N-terminal 0.9122 7 90 3.30.300.70
ID Description Score Start End GO Terms
AF-A0A1F2SWM8-F1-model_v4 Ribosome maturation factor RimP 0.9517 7 162 GO:0000028
GO:0005829
GO:0006412
AF-A0A522UYE6-F1-model_v4 Ribosome maturation factor RimP 0.9377 5 162 GO:0000028
GO:0005829
GO:0006412
AF-A0A1F2SWM8-F1-model_v4 Ribosome maturation factor RimP 0.9344 7 162 GO:0000028
GO:0005829
GO:0006412
AF-A0A2W4MH60-F1-model_v4 Ribosome maturation factor RimP 0.9315 3 162 GO:0000028
GO:0005829
GO:0006412
AF-A0A7C4EHI8-F1-model_v4 Ribosome maturation factor RimP 0.9273 7 162 GO:0000028
GO:0005829
GO:0006412

Map