F420743

General Info

Members Datasets Scaffolds Average Seq Length
357 233 714 220

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100719314|Ga0070674_1007193141
Length 236
Sequence VPHRRASSLPDDHFDERHATTASIVIQLRQLRLVPVIVIDDPASAPALGRALSAGGLPCAEVTFRTAGGREALARLAGECPDVLAGAGTVLTPAQAKDARDAGAKFVVAPGFNPSVVDYCLEHDIPVFPGIATPSEIEAALSRGLNVLKFFPAEPLGGLGYLKAISAPYGGLSFMPTGGISLQNVGAYLSFSRVVACGGSWMAPAEWIAAGEFDRIAAEVAKAVAAVNPTNGASAQ

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
221 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.68
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 16.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100719314 3300005356 Bacteria 855
2 Ga0065712_10134040 3300005290 Unclassified 1517
3 Ga0070658_10029740 3300005327 Unclassified 4390
4 Ga0070658_10150063 3300005327 Bacteria 1951
5 Ga0070676_10295373 3300005328 Unclassified 1096
6 Ga0070683_100165280 3300005329 Bacteria 2099
7 Ga0070683_100290587 3300005329 Bacteria 1554
8 Ga0070683_100396380 3300005329 Unclassified 1316
9 Ga0070690_100007472 3300005330 Bacteria 6260
10 Ga0070670_100020794 3300005331 Bacteria 5643
11 Ga0068869_100014267 3300005334 Bacteria 5304
12 Ga0070680_100008038 3300005336 Bacteria 8056
13 Ga0070680_100240943 3300005336 Bacteria 1529
14 Ga0070680_100472350 3300005336 Bacteria 1072
15 Ga0070682_100048139 3300005337 Bacteria 2654
16 Ga0070660_100089603 3300005339 Bacteria 2424
17 Ga0070689_100123086 3300005340 Bacteria 2073
18 Ga0070687_100419770 3300005343 Bacteria 882
19 Ga0070661_100030678 3300005344 Bacteria 3884
20 Ga0070661_100096920 3300005344 Bacteria 2189
21 Ga0070675_100100389 3300005354 Unclassified 2437
22 Ga0070671_100496186 3300005355 Bacteria 1050
23 Ga0070688_100149759 3300005365 Bacteria 1594
24 Ga0070688_100439901 3300005365 Unclassified 973
25 Ga0070659_100009829 3300005366 Bacteria 7034
26 Ga0070659_100057309 3300005366 Unclassified 3072
27 Ga0070659_100057459 3300005366 Bacteria 3068
28 Ga0070667_100142963 3300005367 Bacteria 2097
29 Ga0070709_10002843 3300005434 Bacteria 9352
30 Ga0070709_10009296 3300005434 Bacteria 5417
31 Ga0070714_100006187 3300005435 Bacteria 9203
32 Ga0070714_100047280 3300005435 Unclassified 3655
33 Ga0070714_100451667 3300005435 Bacteria 1221
34 Ga0070713_100002078 3300005436 Bacteria 12941
35 Ga0070713_100066291 3300005436 Bacteria 3036
36 Ga0070713_100342603 3300005436 Bacteria 1385
37 Ga0070710_10584903 3300005437 Unclassified 775
38 Ga0070711_100053014 3300005439 Bacteria 2794
39 Ga0070711_100623671 3300005439 Bacteria 902
40 Ga0070705_100036616 3300005440 Bacteria 2761
41 Ga0070705_100067233 3300005440 Bacteria 2152
42 Ga0070705_100488028 3300005440 Bacteria 932
43 Ga0070700_100059312 3300005441 Bacteria 2408
44 Ga0070694_100354037 3300005444 Bacteria 1138
45 Ga0070708_100002609 3300005445 Bacteria 13949
46 Ga0070662_100044954 3300005457 Bacteria 3166
47 Ga0070662_100088069 3300005457 Bacteria 2326
48 Ga0070681_10000813 3300005458 Bacteria 26076
49 Ga0070681_10036694 3300005458 Bacteria 4922
50 Ga0070681_10058434 3300005458 Bacteria 3836
51 Ga0070681_10136594 3300005458 Bacteria 2382
52 Ga0070681_10245229 3300005458 Bacteria 1705
53 Ga0068867_100121653 3300005459 Bacteria 2018
54 Ga0070685_10088743 3300005466 Bacteria 1868
55 Ga0070706_100041355 3300005467 Bacteria 4256
56 Ga0070706_100177773 3300005467 Bacteria 1987
57 Ga0070706_100213490 3300005467 Bacteria 1801
58 Ga0070706_100215221 3300005467 Bacteria 1794
59 Ga0070706_100913863 3300005467 Unclassified 811
60 Ga0070707_100185014 3300005468 Bacteria 2031
61 Ga0070698_100012812 3300005471 Bacteria 8881
62 Ga0070698_100184040 3300005471 Bacteria 2027
63 Ga0070698_100834755 3300005471 Unclassified 866
64 Ga0070699_100274051 3300005518 Unclassified 1511
65 Ga0070679_100001855 3300005530 Bacteria 18997
66 Ga0070679_100003083 3300005530 Bacteria 15233
67 Ga0070679_100007230 3300005530 Bacteria 10363
68 Ga0070679_100658061 3300005530 Unclassified 990
69 Ga0070679_100913044 3300005530 Bacteria 822
70 Ga0070684_100019251 3300005535 Bacteria 5644
71 Ga0070684_100050502 3300005535 Bacteria 3613
72 Ga0070684_100089856 3300005535 Bacteria 2730
73 Ga0070684_100128984 3300005535 Bacteria 2280
74 Ga0070684_100218680 3300005535 Bacteria 1738
75 Ga0070697_100301834 3300005536 Bacteria 1376
76 Ga0068853_100098585 3300005539 Bacteria 2581
77 Ga0070672_100364036 3300005543 Bacteria 1235
78 Ga0070695_100013589 3300005545 Bacteria 4893
79 Ga0070693_100009289 3300005547 Bacteria 4886
80 Ga0070693_100364940 3300005547 Bacteria 992
81 Ga0068855_100039795 3300005563 Bacteria 5580
82 Ga0068855_100176762 3300005563 Bacteria 2415
83 Ga0068855_100798707 3300005563 Bacteria 1003
84 Ga0070664_100074175 3300005564 Bacteria 2920
85 Ga0068854_100512271 3300005578 Unclassified 1012
86 Ga0068856_100014050 3300005614 Bacteria 7742
87 Ga0068856_100213471 3300005614 Unclassified 1945
88 Ga0070702_100034743 3300005615 Bacteria 2780
89 Ga0068852_100151404 3300005616 Bacteria 2157
90 Ga0068859_100024055 3300005617 Bacteria 6112
91 Ga0068864_100348784 3300005618 Bacteria 1396
92 Ga0068863_100050180 3300005841 Bacteria 3956
93 Ga0068858_100111204 3300005842 Bacteria 2558
94 Ga0068858_100173366 3300005842 Bacteria 2035
95 Ga0068858_100175288 3300005842 Bacteria 2023
96 Ga0068858_100294568 3300005842 Bacteria 1547
97 Ga0068860_100147456 3300005843 Bacteria 2264
98 Ga0081539_10000206 3300005985 Bacteria 137177
99 Ga0070717_10030660 3300006028 Bacteria 4320
100 Ga0070716_100126120 3300006173 Bacteria 1610
101 Ga0070712_100035890 3300006175 Bacteria 3369
102 Ga0070712_100070019 3300006175 Bacteria 2504
103 Ga0070712_100073781 3300006175 Bacteria 2448
104 Ga0097621_100161893 3300006237 Bacteria 1924
105 Ga0068871_100040392 3300006358 Bacteria 3737
106 Ga0075428_100424865 3300006844 Bacteria 1424
107 Ga0075430_100138426 3300006846 Bacteria 2027
108 Ga0075431_100226743 3300006847 Bacteria 1905
109 Ga0075433_10078453 3300006852 Bacteria 2910
110 Ga0075429_100246741 3300006880 Unclassified 1563
111 Ga0097620_100024056 3300006931 Bacteria 6112
112 Ga0097620_101132918 3300006931 Bacteria 861
113 Ga0105240_10322619 3300009093 Bacteria 1760
114 Ga0111539_10608122 3300009094 Bacteria 1273
115 Ga0105245_10156687 3300009098 Bacteria 2157
116 Ga0105245_10589524 3300009098 Bacteria 1137
117 Ga0114129_10509439 3300009147 Bacteria 1571
118 Ga0105243_10145448 3300009148 Bacteria 2027
119 Ga0105241_10016137 3300009174 Bacteria 5475
120 Ga0105241_10298996 3300009174 Bacteria 1381
121 Ga0105242_10038258 3300009176 Bacteria 3857
122 Ga0105242_10038364 3300009176 Bacteria 3852
123 Ga0105248_10044066 3300009177 Bacteria 5003
124 Ga0105248_11749773 3300009177 Unclassified 705
125 Ga0105238_10090666 3300009551 Bacteria 3044
126 Ga0105249_10256889 3300009553 Bacteria 1734
127 Ga0105246_10015954 3300011119 Bacteria 4751
128 Ga0157373_10586476 3300013100 Bacteria 811
129 Ga0157371_10018279 3300013102 Bacteria 5185
130 Ga0157370_10001407 3300013104 Bacteria 29864
131 Ga0157370_10096366 3300013104 Bacteria 2776
132 Ga0157370_10192998 3300013104 Bacteria 1890
133 Ga0157370_10354300 3300013104 Unclassified 1353
134 Ga0157369_10131767 3300013105 Bacteria 2648
135 Ga0157369_10281366 3300013105 Bacteria 1732
136 Ga0157374_10003873 3300013296 Bacteria 12561
137 Ga0157374_10317013 3300013296 Bacteria 1544
138 Ga0157372_10003034 3300013307 Bacteria 18092
139 Ga0157372_10045805 3300013307 Bacteria 4854
140 Ga0157372_10061821 3300013307 Bacteria 4194
141 Ga0157372_10196933 3300013307 Bacteria 2334
142 Ga0157372_10974610 3300013307 Unclassified 982
143 Ga0157372_10978832 3300013307 Unclassified 980
144 Ga0157375_10081566 3300013308 Bacteria 3275
145 Ga0157375_10408098 3300013308 Unclassified 1525
146 Ga0157375_10561612 3300013308 Bacteria 1302
147 Ga0157375_10838570 3300013308 Bacteria 1066
148 Ga0163163_10014405 3300014325 Bacteria 7269
149 Ga0157380_10368978 3300014326 Bacteria 1350
150 Ga0182008_10122652 3300014497 Bacteria 1292
151 Ga0157377_10015549 3300014745 Bacteria 3897
152 Ga0157376_10761710 3300014969 Unclassified 978
153 Ga0213876_10015848 3300021384 Bacteria 3989
154 Ga0207697_10185240 3300025315 Bacteria 913
155 Ga0207682_10209938 3300025893 Unclassified 898
156 Ga0207692_10004968 3300025898 Bacteria 5293
157 Ga0207699_10047664 3300025906 Bacteria 2513
158 Ga0207699_10092139 3300025906 Bacteria 1904
159 Ga0207684_10010113 3300025910 Bacteria 8310
160 Ga0207684_10209953 3300025910 Bacteria 1680
161 Ga0207707_10002550 3300025912 Bacteria 16324
162 Ga0207707_10009819 3300025912 Bacteria 8300
163 Ga0207707_10132649 3300025912 Bacteria 2178
164 Ga0207707_10150437 3300025912 Bacteria 2035
165 Ga0207707_10182962 3300025912 Bacteria 1829
166 Ga0207695_10118859 3300025913 Bacteria 2614
167 Ga0207693_10041292 3300025915 Bacteria 3631
168 Ga0207693_10052164 3300025915 Bacteria 3208
169 Ga0207663_10293053 3300025916 Bacteria 1213
170 Ga0207660_10005700 3300025917 Bacteria 8080
171 Ga0207660_10450249 3300025917 Unclassified 1041
172 Ga0207660_10478920 3300025917 Bacteria 1008
173 Ga0207662_10019705 3300025918 Bacteria 3843
174 Ga0207657_10001808 3300025919 Bacteria 23067
175 Ga0207657_10284448 3300025919 Unclassified 1312
176 Ga0207649_10059199 3300025920 Bacteria 2402
177 Ga0207652_10000447 3300025921 Bacteria 42581
178 Ga0207652_10101922 3300025921 Unclassified 2536
179 Ga0207646_10233125 3300025922 Bacteria 1663
180 Ga0207681_10141560 3300025923 Bacteria 1792
181 Ga0207659_10061403 3300025926 Unclassified 2709
182 Ga0207659_10320566 3300025926 Bacteria 1278
183 Ga0207687_10013167 3300025927 Bacteria 5403
184 Ga0207687_10256903 3300025927 Unclassified 1391
185 Ga0207700_10001779 3300025928 Bacteria 12230
186 Ga0207700_10004100 3300025928 Bacteria 8546
187 Ga0207700_10551200 3300025928 Bacteria 1023
188 Ga0207664_10009430 3300025929 Bacteria 6849
189 Ga0207664_10171074 3300025929 Bacteria 1859
190 Ga0207664_10444553 3300025929 Unclassified 1156
191 Ga0207690_10093198 3300025932 Unclassified 2134
192 Ga0207690_10167978 3300025932 Bacteria 1641
193 Ga0207706_10031897 3300025933 Bacteria 4694
194 Ga0207706_10110395 3300025933 Bacteria 2420
195 Ga0207706_10713402 3300025933 Bacteria 856
196 Ga0207686_10094009 3300025934 Bacteria 1986
197 Ga0207686_10112853 3300025934 Bacteria 1836
198 Ga0207686_10173861 3300025934 Bacteria 1521
199 Ga0207670_10109019 3300025936 Bacteria 1992
200 Ga0207670_10510875 3300025936 Unclassified 977
201 Ga0207665_10086065 3300025939 Bacteria 2170
202 Ga0207665_10247770 3300025939 Bacteria 1315
203 Ga0207691_10314799 3300025940 Bacteria 1343
204 Ga0207711_10053678 3300025941 Bacteria 3456
205 Ga0207711_10427979 3300025941 Bacteria 1231
206 Ga0207689_10002340 3300025942 Bacteria 17720
207 Ga0207661_10003700 3300025944 Bacteria 10655
208 Ga0207661_10030872 3300025944 Bacteria 4132
209 Ga0207661_10146929 3300025944 Bacteria 2035
210 Ga0207661_10300061 3300025944 Unclassified 1440
211 Ga0207661_10412586 3300025944 Bacteria 1226
212 Ga0207661_10736649 3300025944 Unclassified 907
213 Ga0207679_10020726 3300025945 Bacteria 4441
214 Ga0207651_10251879 3300025960 Bacteria 1445
215 Ga0207640_10454843 3300025981 Unclassified 1056
216 Ga0207658_10190100 3300025986 Bacteria 1706
217 Ga0207703_10167137 3300026035 Bacteria 1932
218 Ga0207703_10398146 3300026035 Bacteria 1277
219 Ga0207639_10052145 3300026041 Bacteria 3116
220 Ga0207639_10175161 3300026041 Bacteria 1820
221 Ga0207678_10106506 3300026067 Unclassified 2392
222 Ga0207708_10376093 3300026075 Bacteria 1170
223 Ga0207702_10005704 3300026078 Bacteria 10857
224 Ga0207702_10058608 3300026078 Bacteria 3277
225 Ga0207702_10242399 3300026078 Unclassified 1689
226 Ga0207702_10757090 3300026078 Bacteria 959
227 Ga0207641_10044367 3300026088 Bacteria 3739
228 Ga0207676_10004038 3300026095 Bacteria 10347
229 Ga0207698_10058491 3300026142 Bacteria 2988
230 Ga0209983_1009236 3300027665 Bacteria 2015
231 Ga0209971_1017040 3300027682 Bacteria 1723
232 Ga0209998_10000422 3300027717 Bacteria 11977
233 Ga0209974_10014202 3300027876 Bacteria 2653
234 Ga0268265_10229005 3300028380 Unclassified 1632
235 Ga0268264_10025734 3300028381 Bacteria 4807
236 Ga0316576_10002685 3300031727 Bacteria 10171
237 Ga0307413_10139296 3300031824 Bacteria 1674
238 Ga0307410_10009884 3300031852 Bacteria 5377
239 Ga0307409_100024155 3300031995 Bacteria 4233
240 Ga0307409_100299306 3300031995 Bacteria 1496
241 Ga0307416_100167577 3300032002 Bacteria 2040
242 Ga0307416_100884490 3300032002 Bacteria 993
243 Ga0307414_10672960 3300032004 Bacteria 935
244 Ga0307411_10563371 3300032005 Bacteria 974
245 Ga0307415_100244887 3300032126 Bacteria 1453
246 Ga0373926_0138736 3300035083 Bacteria 923
247 Ga0373934_0002644 3300035086 Bacteria 6582
248 Ga0373934_0041800 3300035086 Bacteria 1810
249 Ga0373923_0157276 3300035111 Unclassified 1035
250 Ga0373932_0020487 3300035112 Bacteria 1735
251 Ga0373936_0203690 3300035113 Bacteria 874
252 Ga0373954_0019061 3300035118 Unclassified 3093
253 Ga0373954_0098087 3300035118 Unclassified 1412
254 Ga0373956_0018525 3300035119 Bacteria 2949
255 Ga0373957_0045581 3300035120 Bacteria 1662
256 Ga0373943_0016087 3300035170 Bacteria 3407
257 Ga0373955_0011643 3300035172 Bacteria 4201
258 Ga0373924_0054350 3300035410 Unclassified 1665
259 Ga0373931_0166829 3300035691 Bacteria 1294
260 Ga0373935_0312941 3300035692 Bacteria 1112
261 Ga0373927_0013739 3300035695 Bacteria 5376
262 Ga0373933_0021934 3300035724 Bacteria 3632
263 Ga0373947_0050677 3300035725 Bacteria 2496
264 Ga0373947_0107156 3300035725 Bacteria 1762
265 Ga0373947_0108853 3300035725 Unclassified 1749
266 Ga0373937_0003355 3300036401 Bacteria 13438
267 Ga0373937_0025488 3300036401 Bacteria 5337
268 Ga0395905_0091468 3300037471 Bacteria 2853
269 Ga0436365_0070205 3300039437 Bacteria 5047
270 Ga0436365_0963692 3300039437 Bacteria 1377
271 Ga0436365_1864035 3300039437 Unclassified 1114
272 Ga0451577_0000927 3300042876 Bacteria 43097
273 Ga0466966_0035250 3300044684 Bacteria 3234
274 Ga0451576_0351821 3300045051 Unclassified 1542
275 Ga0466958_0009766 3300045836 Bacteria 5354
276 Ga0495629_0018462 3300046459 Bacteria 4992
277 Ga0495651_0007395 3300046462 Bacteria 8398
278 Ga0495580_0016853 3300046472 Bacteria 5479
279 Ga0495582_0002310 3300046473 Bacteria 10685
280 Ga0495582_0220436 3300046473 Unclassified 1085
281 Ga0495639_0007202 3300046475 Bacteria 4775
282 Ga0495664_0012009 3300046477 Bacteria 4896
283 Ga0495594_0007906 3300046499 Bacteria 5466
284 Ga0495594_0010167 3300046499 Bacteria 4877
285 Ga0495608_0022836 3300046511 Bacteria 4292
286 Ga0495618_0168087 3300046514 Unclassified 1396
287 Ga0495628_0017798 3300046516 Bacteria 5901
288 Ga0495630_0012082 3300046517 Bacteria 6260
289 Ga0495666_0101522 3300046526 Bacteria 1355
290 Ga0495652_0069803 3300046529 Bacteria 2939
291 Ga0495652_0086470 3300046529 Unclassified 2574
292 Ga0495665_0156822 3300046531 Bacteria 1187
293 Ga0495640_0228912 3300046533 Bacteria 1170
294 Ga0495640_0373707 3300046533 Unclassified 878
295 Ga0495586_0019482 3300046535 Bacteria 3613
296 Ga0495587_0006484 3300046536 Bacteria 7623
297 Ga0495587_0060159 3300046536 Bacteria 2228
298 Ga0495645_0009088 3300046543 Bacteria 6943
299 Ga0495645_0021039 3300046543 Bacteria 4714
300 Ga0495645_0039359 3300046543 Bacteria 3449
301 Ga0495667_0059751 3300046559 Bacteria 2501
302 Ga0495667_0074666 3300046559 Unclassified 2207
303 Ga0495634_0251763 3300046642 Unclassified 1080
304 Ga0495659_0088945 3300046664 Bacteria 1183
305 Ga0495588_0044953 3300046674 Bacteria 2263
306 Ga0495657_0118001 3300046675 Bacteria 1674
307 Ga0495599_0030105 3300046678 Unclassified 3404
308 Ga0495599_0056931 3300046678 Bacteria 2446
309 Ga0495623_0006998 3300046679 Bacteria 7328
310 Ga0495658_0015598 3300046683 Bacteria 3899
311 Ga0495613_0148021 3300046689 Bacteria 1676
312 Ga0495600_0019945 3300046809 Bacteria 4286
313 Ga0495581_0093977 3300047315 Bacteria 1740
314 Ga0495604_0423576 3300047317 Bacteria 873
315 Ga0495674_0034000 3300047319 Bacteria 4613
316 Ga0495674_0042866 3300047319 Bacteria 4032
317 Ga0495675_0003902 3300047444 Bacteria 9031
318 Ga0495684_0004691 3300047471 Bacteria 10666
319 Ga0495684_0018605 3300047471 Bacteria 5352
320 Ga0495684_0193003 3300047471 Bacteria 1505
321 Ga0495602_0035308 3300048088 Bacteria 4663
322 Ga0496104_0173392 3300048907 Bacteria 2067
323 Ga0496104_0866057 3300048907 Unclassified 809
324 Ga0496105_0459744 3300048908 Unclassified 1004
325 Ga0496112_0003791 3300048915 Bacteria 12632
326 Ga0496113_0019021 3300048916 Bacteria 4797
327 Ga0496115_0534467 3300048918 Unclassified 939
328 Ga0501298_011836 3300049521 Bacteria 1521
329 Ga0501031_0235241 3300049568 Bacteria 1191
330 Ga0501032_0083116 3300049569 Unclassified 2130
331 Ga0501033_0003103 3300049570 Bacteria 13790
332 Ga0501033_0417611 3300049570 Unclassified 934
333 Ga0501034_0042525 3300049571 Bacteria 4600
334 Ga0501034_0269243 3300049571 Bacteria 1645
335 Ga0501034_0545512 3300049571 Bacteria 1069
336 Ga0501037_0055325 3300049573 Bacteria 2901
337 Ga0501047_0003125 3300049581 Bacteria 15710
338 Ga0501067_0005058 3300049583 Bacteria 7323
339 Ga0501070_0051714 3300049586 Bacteria 3410
340 Ga0501217_045168 3300049661 Unclassified 1134
341 Ga0501079_0297255 3300049741 Bacteria 1263
342 Ga0501080_0505354 3300049742 Bacteria 1080
343 Ga0501266_000774 3300049763 Bacteria 4138
344 Ga0501272_014682 3300049769 Unclassified 906
345 Ga0501035_0001399 3300049822 Bacteria 24774
346 Ga0501044_0000459 3300049823 Bacteria 49647
347 Ga0501044_0014354 3300049823 Bacteria 8553
348 nmdc:mga0qj67_90910_c1 3300050509 Bacteria 2453
349 nmdc:mga06r32_216743_c1 3300050510 Bacteria 1902
350 nmdc:mga0n895_8223_c1 3300050512 Bacteria 9019
351 nmdc:mga0rr50_587591_c1 3300050513 Unclassified 949
352 Ga0495601_0198922 3300053077 Bacteria 1310
353 Ga0495612_0018765 3300053078 Bacteria 2769
354 Ga0495595_0071085 3300053084 Bacteria 1645
355 Ga0590077_059910 3300059426 Unclassified 862
356 Ga0530510_0195641 3300061734 Bacteria 1501
357 2645723926 2643221962 Bacteria 3874254
358 Ga0070674_100719314
359 Ga0065712_10134040
360 Ga0070658_10029740
361 Ga0070658_10150063
362 Ga0070676_10295373
363 Ga0070683_100165280
364 Ga0070683_100290587
365 Ga0070683_100396380
366 Ga0070690_100007472
367 Ga0070670_100020794
368 Ga0068869_100014267
369 Ga0070680_100008038
370 Ga0070680_100240943
371 Ga0070680_100472350
372 Ga0070682_100048139
373 Ga0070660_100089603
374 Ga0070689_100123086
375 Ga0070687_100419770
376 Ga0070661_100030678
377 Ga0070661_100096920
378 Ga0070675_100100389
379 Ga0070671_100496186
380 Ga0070688_100149759
381 Ga0070688_100439901
382 Ga0070659_100009829
383 Ga0070659_100057309
384 Ga0070659_100057459
385 Ga0070667_100142963
386 Ga0070709_10002843
387 Ga0070709_10009296
388 Ga0070714_100006187
389 Ga0070714_100047280
390 Ga0070714_100451667
391 Ga0070713_100002078
392 Ga0070713_100066291
393 Ga0070713_100342603
394 Ga0070710_10584903
395 Ga0070711_100053014
396 Ga0070711_100623671
397 Ga0070705_100036616
398 Ga0070705_100067233
399 Ga0070705_100488028
400 Ga0070700_100059312
401 Ga0070694_100354037
402 Ga0070708_100002609
403 Ga0070662_100044954
404 Ga0070662_100088069
405 Ga0070681_10000813
406 Ga0070681_10036694
407 Ga0070681_10058434
408 Ga0070681_10136594
409 Ga0070681_10245229
410 Ga0068867_100121653
411 Ga0070685_10088743
412 Ga0070706_100041355
413 Ga0070706_100177773
414 Ga0070706_100213490
415 Ga0070706_100215221
416 Ga0070706_100913863
417 Ga0070707_100185014
418 Ga0070698_100012812
419 Ga0070698_100184040
420 Ga0070698_100834755
421 Ga0070699_100274051
422 Ga0070679_100001855
423 Ga0070679_100003083
424 Ga0070679_100007230
425 Ga0070679_100658061
426 Ga0070679_100913044
427 Ga0070684_100019251
428 Ga0070684_100050502
429 Ga0070684_100089856
430 Ga0070684_100128984
431 Ga0070684_100218680
432 Ga0070697_100301834
433 Ga0068853_100098585
434 Ga0070672_100364036
435 Ga0070695_100013589
436 Ga0070693_100009289
437 Ga0070693_100364940
438 Ga0068855_100039795
439 Ga0068855_100176762
440 Ga0068855_100798707
441 Ga0070664_100074175
442 Ga0068854_100512271
443 Ga0068856_100014050
444 Ga0068856_100213471
445 Ga0070702_100034743
446 Ga0068852_100151404
447 Ga0068859_100024055
448 Ga0068864_100348784
449 Ga0068863_100050180
450 Ga0068858_100111204
451 Ga0068858_100173366
452 Ga0068858_100175288
453 Ga0068858_100294568
454 Ga0068860_100147456
455 Ga0081539_10000206
456 Ga0070717_10030660
457 Ga0070716_100126120
458 Ga0070712_100035890
459 Ga0070712_100070019
460 Ga0070712_100073781
461 Ga0097621_100161893
462 Ga0068871_100040392
463 Ga0075428_100424865
464 Ga0075430_100138426
465 Ga0075431_100226743
466 Ga0075433_10078453
467 Ga0075429_100246741
468 Ga0097620_100024056
469 Ga0097620_101132918
470 Ga0105240_10322619
471 Ga0111539_10608122
472 Ga0105245_10156687
473 Ga0105245_10589524
474 Ga0114129_10509439
475 Ga0105243_10145448
476 Ga0105241_10016137
477 Ga0105241_10298996
478 Ga0105242_10038258
479 Ga0105242_10038364
480 Ga0105248_10044066
481 Ga0105248_11749773
482 Ga0105238_10090666
483 Ga0105249_10256889
484 Ga0105246_10015954
485 Ga0157373_10586476
486 Ga0157371_10018279
487 Ga0157370_10001407
488 Ga0157370_10096366
489 Ga0157370_10192998
490 Ga0157370_10354300
491 Ga0157369_10131767
492 Ga0157369_10281366
493 Ga0157374_10003873
494 Ga0157374_10317013
495 Ga0157372_10003034
496 Ga0157372_10045805
497 Ga0157372_10061821
498 Ga0157372_10196933
499 Ga0157372_10974610
500 Ga0157372_10978832
501 Ga0157375_10081566
502 Ga0157375_10408098
503 Ga0157375_10561612
504 Ga0157375_10838570
505 Ga0163163_10014405
506 Ga0157380_10368978
507 Ga0182008_10122652
508 Ga0157377_10015549
509 Ga0157376_10761710
510 Ga0213876_10015848
511 Ga0207697_10185240
512 Ga0207682_10209938
513 Ga0207692_10004968
514 Ga0207699_10047664
515 Ga0207699_10092139
516 Ga0207684_10010113
517 Ga0207684_10209953
518 Ga0207707_10002550
519 Ga0207707_10009819
520 Ga0207707_10132649
521 Ga0207707_10150437
522 Ga0207707_10182962
523 Ga0207695_10118859
524 Ga0207693_10041292
525 Ga0207693_10052164
526 Ga0207663_10293053
527 Ga0207660_10005700
528 Ga0207660_10450249
529 Ga0207660_10478920
530 Ga0207662_10019705
531 Ga0207657_10001808
532 Ga0207657_10284448
533 Ga0207649_10059199
534 Ga0207652_10000447
535 Ga0207652_10101922
536 Ga0207646_10233125
537 Ga0207681_10141560
538 Ga0207659_10061403
539 Ga0207659_10320566
540 Ga0207687_10013167
541 Ga0207687_10256903
542 Ga0207700_10001779
543 Ga0207700_10004100
544 Ga0207700_10551200
545 Ga0207664_10009430
546 Ga0207664_10171074
547 Ga0207664_10444553
548 Ga0207690_10093198
549 Ga0207690_10167978
550 Ga0207706_10031897
551 Ga0207706_10110395
552 Ga0207706_10713402
553 Ga0207686_10094009
554 Ga0207686_10112853
555 Ga0207686_10173861
556 Ga0207670_10109019
557 Ga0207670_10510875
558 Ga0207665_10086065
559 Ga0207665_10247770
560 Ga0207691_10314799
561 Ga0207711_10053678
562 Ga0207711_10427979
563 Ga0207689_10002340
564 Ga0207661_10003700
565 Ga0207661_10030872
566 Ga0207661_10146929
567 Ga0207661_10300061
568 Ga0207661_10412586
569 Ga0207661_10736649
570 Ga0207679_10020726
571 Ga0207651_10251879
572 Ga0207640_10454843
573 Ga0207658_10190100
574 Ga0207703_10167137
575 Ga0207703_10398146
576 Ga0207639_10052145
577 Ga0207639_10175161
578 Ga0207678_10106506
579 Ga0207708_10376093
580 Ga0207702_10005704
581 Ga0207702_10058608
582 Ga0207702_10242399
583 Ga0207702_10757090
584 Ga0207641_10044367
585 Ga0207676_10004038
586 Ga0207698_10058491
587 Ga0209983_1009236
588 Ga0209971_1017040
589 Ga0209998_10000422
590 Ga0209974_10014202
591 Ga0268265_10229005
592 Ga0268264_10025734
593 Ga0316576_10002685
594 Ga0307413_10139296
595 Ga0307410_10009884
596 Ga0307409_100024155
597 Ga0307409_100299306
598 Ga0307416_100167577
599 Ga0307416_100884490
600 Ga0307414_10672960
601 Ga0307411_10563371
602 Ga0307415_100244887
603 Ga0373926_0138736
604 Ga0373934_0002644
605 Ga0373934_0041800
606 Ga0373923_0157276
607 Ga0373932_0020487
608 Ga0373936_0203690
609 Ga0373954_0019061
610 Ga0373954_0098087
611 Ga0373956_0018525
612 Ga0373957_0045581
613 Ga0373943_0016087
614 Ga0373955_0011643
615 Ga0373924_0054350
616 Ga0373931_0166829
617 Ga0373935_0312941
618 Ga0373927_0013739
619 Ga0373933_0021934
620 Ga0373947_0050677
621 Ga0373947_0107156
622 Ga0373947_0108853
623 Ga0373937_0003355
624 Ga0373937_0025488
625 Ga0395905_0091468
626 Ga0436365_0070205
627 Ga0436365_0963692
628 Ga0436365_1864035
629 Ga0451577_0000927
630 Ga0466966_0035250
631 Ga0451576_0351821
632 Ga0466958_0009766
633 Ga0495629_0018462
634 Ga0495651_0007395
635 Ga0495580_0016853
636 Ga0495582_0002310
637 Ga0495582_0220436
638 Ga0495639_0007202
639 Ga0495664_0012009
640 Ga0495594_0007906
641 Ga0495594_0010167
642 Ga0495608_0022836
643 Ga0495618_0168087
644 Ga0495628_0017798
645 Ga0495630_0012082
646 Ga0495666_0101522
647 Ga0495652_0069803
648 Ga0495652_0086470
649 Ga0495665_0156822
650 Ga0495640_0228912
651 Ga0495640_0373707
652 Ga0495586_0019482
653 Ga0495587_0006484
654 Ga0495587_0060159
655 Ga0495645_0009088
656 Ga0495645_0021039
657 Ga0495645_0039359
658 Ga0495667_0059751
659 Ga0495667_0074666
660 Ga0495634_0251763
661 Ga0495659_0088945
662 Ga0495588_0044953
663 Ga0495657_0118001
664 Ga0495599_0030105
665 Ga0495599_0056931
666 Ga0495623_0006998
667 Ga0495658_0015598
668 Ga0495613_0148021
669 Ga0495600_0019945
670 Ga0495581_0093977
671 Ga0495604_0423576
672 Ga0495674_0034000
673 Ga0495674_0042866
674 Ga0495675_0003902
675 Ga0495684_0004691
676 Ga0495684_0018605
677 Ga0495684_0193003
678 Ga0495602_0035308
679 Ga0496104_0173392
680 Ga0496104_0866057
681 Ga0496105_0459744
682 Ga0496112_0003791
683 Ga0496113_0019021
684 Ga0496115_0534467
685 Ga0501298_011836
686 Ga0501031_0235241
687 Ga0501032_0083116
688 Ga0501033_0003103
689 Ga0501033_0417611
690 Ga0501034_0042525
691 Ga0501034_0269243
692 Ga0501034_0545512
693 Ga0501037_0055325
694 Ga0501047_0003125
695 Ga0501067_0005058
696 Ga0501070_0051714
697 Ga0501217_045168
698 Ga0501079_0297255
699 Ga0501080_0505354
700 Ga0501266_000774
701 Ga0501272_014682
702 Ga0501035_0001399
703 Ga0501044_0000459
704 Ga0501044_0014354
705 nmdc:mga0qj67_90910_c1
706 nmdc:mga06r32_216743_c1
707 nmdc:mga0n895_8223_c1
708 nmdc:mga0rr50_587591_c1
709 Ga0495601_0198922
710 Ga0495612_0018765
711 Ga0495595_0071085
712 Ga0590077_059910
713 Ga0530510_0195641
714 2645723926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

24

219

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e38-assembly1.cif.gz_C crystal structure of probable keto-hydroxyglutarate-aldolase from vibrionales bacterium swat-3 (target efi-502156) 0.9833 6 209
2c0a-assembly1.cif.gz_B mechanism of the class i kdpg aldolase 0.9818 6 209
1eua-assembly1.cif.gz_B schiff base intermediate in kdpg aldolase from escherichia coli 0.9806 6 209
5im5-assembly1.cif.gz_U crystal structure of designed two-component self-assembling icosahedral cage i53-40 0.9795 6 210
1fwr-assembly1.cif.gz_C crystal structure of kdpg aldolase double mutant k133q/t161k 0.9762 6 209
ID Description Score Start End Superfamily
1vhcB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9726 1 210 3.20.20.70
1mxsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9667 5 208 3.20.20.70
1vhcB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9588 1 210 3.20.20.70
4bk9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9586 8 203 3.20.20.70
3vcrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9541 7 203 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7V6TTR8-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9968 5 208 GO:0016829
AF-A0A359LIW7-F1-model_v4 2-dehydro-3-deoxyphosphogluconate aldolase 0.9961 5 208 GO:0016829
AF-D4M8Y2-F1-model_v4 deleted 0.9961 5 209
AF-X1F7N9-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase 0.9949 5 185 GO:0016829
AF-A0A7X1ZXJ0-F1-model_v4 deleted 0.9948 5 208

Map