F420723

General Info

Members Datasets Scaffolds Average Seq Length
357 195 714 216

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100133138|Ga0070690_1001331382
Length 224
Sequence MTDKGYEVAHIDELEELPINKGEFVWRPVRRRFGITAFGTNAYTANAGQRVIEEHSETGGHQELYVVLRGRATFTLDGEEVDAPAGTLVFARPGTKRGAIAAEDGTAVLGVGAKPGEVFEPSPWEESFAAGSYADQGQVEKAREIMDAALAARPDDWRAHYNYACLLALNDESEAAITELQRAYELEPKEVGDYAGGDSDLDSIRDDPRVSAIAGQTDAGGESA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
119 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
120 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
121 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
124 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 22.69
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 17.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100133138 3300005330 Bacteria 1681
2 rootL2_10186547 3300003322 Bacteria 2075
3 Ga0070676_10526249 3300005328 Bacteria 843
4 Ga0070683_100192171 3300005329 Unclassified 1939
5 Ga0070683_100765715 3300005329 Unclassified 925
6 Ga0068869_100393912 3300005334 Unclassified 1138
7 Ga0070680_100027904 3300005336 Bacteria 4524
8 Ga0070680_100766034 3300005336 Bacteria 831
9 Ga0070682_100238946 3300005337 Unclassified 1303
10 Ga0070682_100266165 3300005337 Bacteria 1243
11 Ga0068868_100767443 3300005338 Bacteria 867
12 Ga0070660_100294225 3300005339 Bacteria 1330
13 Ga0070687_100262062 3300005343 Bacteria 1079
14 Ga0070687_100499628 3300005343 Bacteria 818
15 Ga0070692_10310650 3300005345 Bacteria 966
16 Ga0070675_100150669 3300005354 Bacteria 1994
17 Ga0070671_100487068 3300005355 Unclassified 1060
18 Ga0070674_100555495 3300005356 Bacteria 964
19 Ga0070673_100147189 3300005364 Bacteria 1992
20 Ga0070703_10005552 3300005406 Bacteria 3528
21 Ga0070709_10094044 3300005434 Bacteria 1983
22 Ga0070709_10198192 3300005434 Unclassified 1420
23 Ga0070714_100109525 3300005435 Bacteria 2443
24 Ga0070713_100354086 3300005436 Bacteria 1363
25 Ga0070710_10107310 3300005437 Bacteria 1672
26 Ga0070710_10358217 3300005437 Bacteria 967
27 Ga0070711_100071840 3300005439 Unclassified 2440
28 Ga0070705_100441954 3300005440 Bacteria 973
29 Ga0070694_100224492 3300005444 Bacteria 1410
30 Ga0070694_100768500 3300005444 Bacteria 788
31 Ga0070708_100104007 3300005445 Bacteria 2603
32 Ga0070708_100154491 3300005445 Bacteria 2135
33 Ga0070678_100046969 3300005456 Bacteria 3100
34 Ga0070678_100324404 3300005456 Unclassified 1316
35 Ga0070681_10010355 3300005458 Bacteria 9206
36 Ga0068867_100040481 3300005459 Bacteria 3402
37 Ga0068867_100405306 3300005459 Bacteria 1151
38 Ga0070706_100037563 3300005467 Bacteria 4473
39 Ga0070706_100265629 3300005467 Bacteria 1601
40 Ga0070707_100009422 3300005468 Bacteria 9063
41 Ga0070707_100074670 3300005468 Bacteria 3269
42 Ga0070707_100114252 3300005468 Bacteria 2619
43 Ga0070707_100344851 3300005468 Unclassified 1447
44 Ga0070707_100517237 3300005468 Bacteria 1156
45 Ga0070707_100582520 3300005468 Unclassified 1081
46 Ga0070698_100011372 3300005471 Bacteria 9446
47 Ga0070699_100037948 3300005518 Bacteria 4171
48 Ga0070699_100149024 3300005518 Bacteria 2069
49 Ga0070699_100259203 3300005518 Bacteria 1555
50 Ga0070699_100584468 3300005518 Unclassified 1018
51 Ga0070679_100002009 3300005530 Bacteria 18258
52 Ga0070684_100000360 3300005535 Bacteria 31368
53 Ga0070697_100081560 3300005536 Bacteria 2665
54 Ga0070686_100038265 3300005544 Bacteria 2981
55 Ga0070686_100088406 3300005544 Bacteria 2068
56 Ga0070695_100384014 3300005545 Bacteria 1060
57 Ga0070696_100054684 3300005546 Bacteria 2782
58 Ga0070693_100008085 3300005547 Bacteria 5165
59 Ga0070704_100068753 3300005549 Bacteria 2564
60 Ga0070704_100481622 3300005549 Unclassified 1074
61 Ga0068855_100698108 3300005563 Unclassified 1086
62 Ga0068854_100598288 3300005578 Bacteria 941
63 Ga0068856_100003184 3300005614 Bacteria 16712
64 Ga0068856_100458959 3300005614 Unclassified 1295
65 Ga0070702_100266932 3300005615 Unclassified 1168
66 Ga0068864_100114098 3300005618 Bacteria 2409
67 Ga0068860_100411992 3300005843 Bacteria 1338
68 Ga0068862_100947319 3300005844 Unclassified 849
69 Ga0081455_10036799 3300005937 Bacteria 4353
70 Ga0070717_10161143 3300006028 Bacteria 1946
71 Ga0070715_10030131 3300006163 Bacteria 2191
72 Ga0070715_10229112 3300006163 Bacteria 960
73 Ga0070716_100372049 3300006173 Bacteria 1018
74 Ga0070716_100405333 3300006173 Bacteria 982
75 Ga0070712_100019977 3300006175 Bacteria 4379
76 Ga0070712_100078129 3300006175 Bacteria 2388
77 Ga0070712_100272140 3300006175 Bacteria 1361
78 Ga0075428_100001324 3300006844 Bacteria 26239
79 Ga0075433_10069889 3300006852 Bacteria 3085
80 Ga0075433_10203420 3300006852 Bacteria 1760
81 Ga0075434_100231069 3300006871 Unclassified 1869
82 Ga0068865_100088286 3300006881 Unclassified 2243
83 Ga0075436_100049813 3300006914 Unclassified 2891
84 Ga0075435_100039398 3300007076 Bacteria 3771
85 Ga0075435_100171691 3300007076 Bacteria 1829
86 Ga0075435_100423397 3300007076 Bacteria 1147
87 Ga0105245_10007278 3300009098 Bacteria 9693
88 Ga0105245_10410565 3300009098 Unclassified 1355
89 Ga0105245_10523498 3300009098 Bacteria 1205
90 Ga0105245_10556654 3300009098 Bacteria 1169
91 Ga0105245_10728490 3300009098 Unclassified 1026
92 Ga0114129_10520095 3300009147 Bacteria 1551
93 Ga0114129_11502327 3300009147 Bacteria 828
94 Ga0105241_10220411 3300009174 Unclassified 1594
95 Ga0105242_10067814 3300009176 Bacteria 2950
96 Ga0105242_10101482 3300009176 Bacteria 2439
97 Ga0105242_10231685 3300009176 Bacteria 1655
98 Ga0105248_10860280 3300009177 Unclassified 1024
99 Ga0105248_10861352 3300009177 Bacteria 1023
100 Ga0105237_10714636 3300009545 Bacteria 1008
101 Ga0105239_10176915 3300010375 Unclassified 2387
102 Ga0157369_10009145 3300013105 Bacteria 11337
103 Ga0157369_10014867 3300013105 Bacteria 8786
104 Ga0157369_10235806 3300013105 Bacteria 1912
105 Ga0157374_10081899 3300013296 Bacteria 3063
106 Ga0157374_10692419 3300013296 Bacteria 1032
107 Ga0157378_10153809 3300013297 Bacteria 2145
108 Ga0157378_10268550 3300013297 Bacteria 1640
109 Ga0163162_10178101 3300013306 Unclassified 2252
110 Ga0163162_10254192 3300013306 Bacteria 1889
111 Ga0163162_10530597 3300013306 Bacteria 1306
112 Ga0163162_10618240 3300013306 Bacteria 1209
113 Ga0157375_10338498 3300013308 Bacteria 1670
114 Ga0157375_10990538 3300013308 Unclassified 981
115 Ga0157375_11886979 3300013308 Bacteria 709
116 Ga0163163_10963732 3300014325 Unclassified 916
117 Ga0157377_10065556 3300014745 Bacteria 2087
118 Ga0157377_10166830 3300014745 Unclassified 1374
119 Ga0157376_10333095 3300014969 Bacteria 1447
120 Ga0157376_10976851 3300014969 Bacteria 868
121 Ga0163161_10465200 3300017792 Bacteria 1024
122 Ga0207653_10007130 3300025885 Bacteria 3492
123 Ga0207692_10014608 3300025898 Bacteria 3434
124 Ga0207692_10200343 3300025898 Bacteria 1173
125 Ga0207688_10264258 3300025901 Bacteria 1045
126 Ga0207699_10152805 3300025906 Unclassified 1529
127 Ga0207699_10219564 3300025906 Bacteria 1297
128 Ga0207684_10155964 3300025910 Bacteria 1965
129 Ga0207684_10463190 3300025910 Unclassified 1088
130 Ga0207707_10048707 3300025912 Bacteria 3691
131 Ga0207693_10001016 3300025915 Bacteria 25132
132 Ga0207693_10001814 3300025915 Bacteria 18729
133 Ga0207693_10061285 3300025915 Bacteria 2947
134 Ga0207663_10029392 3300025916 Bacteria 3227
135 Ga0207663_10102988 3300025916 Unclassified 1921
136 Ga0207663_10329153 3300025916 Unclassified 1150
137 Ga0207660_10006413 3300025917 Bacteria 7626
138 Ga0207662_10175212 3300025918 Bacteria 1377
139 Ga0207657_10145828 3300025919 Bacteria 1931
140 Ga0207652_10004016 3300025921 Bacteria 12013
141 Ga0207646_10004270 3300025922 Bacteria 15605
142 Ga0207646_10271302 3300025922 Unclassified 1533
143 Ga0207646_10605675 3300025922 Bacteria 983
144 Ga0207659_10706382 3300025926 Bacteria 863
145 Ga0207687_10007950 3300025927 Bacteria 6944
146 Ga0207687_10238983 3300025927 Bacteria 1438
147 Ga0207687_10522528 3300025927 Unclassified 993
148 Ga0207700_10829431 3300025928 Bacteria 827
149 Ga0207664_10272426 3300025929 Unclassified 1483
150 Ga0207664_10380959 3300025929 Bacteria 1252
151 Ga0207644_10134210 3300025931 Bacteria 1899
152 Ga0207690_10269548 3300025932 Bacteria 1322
153 Ga0207686_10097924 3300025934 Bacteria 1952
154 Ga0207709_10678688 3300025935 Unclassified 823
155 Ga0207665_10283100 3300025939 Bacteria 1234
156 Ga0207711_10613178 3300025941 Bacteria 1015
157 Ga0207711_10863078 3300025941 Bacteria 842
158 Ga0207661_10014175 3300025944 Bacteria 5835
159 Ga0207679_10023949 3300025945 Bacteria 4181
160 Ga0207667_10372338 3300025949 Bacteria 1455
161 Ga0207651_10146758 3300025960 Bacteria 1831
162 Ga0207668_10065400 3300025972 Bacteria 2574
163 Ga0207703_10464274 3300026035 Bacteria 1184
164 Ga0207639_10185979 3300026041 Bacteria 1771
165 Ga0207708_10216036 3300026075 Bacteria 1534
166 Ga0207702_10019843 3300026078 Bacteria 5567
167 Ga0207648_10057227 3300026089 Unclassified 3401
168 Ga0207676_10220374 3300026095 Bacteria 1689
169 Ga0207675_100009908 3300026118 Bacteria 8917
170 Ga0207675_100744799 3300026118 Unclassified 991
171 Ga0207683_10009030 3300026121 Bacteria 8492
172 Ga0207683_10009561 3300026121 Bacteria 8265
173 Ga0207683_10580497 3300026121 Unclassified 1037
174 Ga0268266_10826691 3300028379 Bacteria 895
175 Ga0268264_10112424 3300028381 Bacteria 2388
176 Ga0268264_10691911 3300028381 Bacteria 1012
177 Ga0268264_11011967 3300028381 Unclassified 838
178 Ga0307408_100140219 3300031548 Bacteria 1897
179 Ga0307405_10132468 3300031731 Bacteria 1725
180 Ga0307407_10444115 3300031903 Bacteria 940
181 Ga0307412_10096193 3300031911 Bacteria 2084
182 Ga0307416_100027433 3300032002 Bacteria 4217
183 Ga0307415_100185052 3300032126 Unclassified 1638
184 Ga0373948_0003622 3300034817 Bacteria 2389
185 Ga0373950_0016715 3300034818 Bacteria 1257
186 Ga0373928_0001951 3300035084 Bacteria 4021
187 Ga0373929_0001667 3300035085 Bacteria 4197
188 Ga0373940_0002189 3300035088 Bacteria 3747
189 Ga0373949_0013788 3300035090 Bacteria 1795
190 Ga0373951_0001201 3300035091 Bacteria 6846
191 Ga0373932_0014335 3300035112 Bacteria 1991
192 Ga0373939_0005216 3300035114 Bacteria 3089
193 Ga0373941_0015670 3300035115 Bacteria 2049
194 Ga0373960_0001990 3300035121 Bacteria 4585
195 Ga0373943_0086079 3300035170 Bacteria 1620
196 Ga0373942_0002866 3300035207 Bacteria 4097
197 Ga0373961_0003308 3300035241 Bacteria 4008
198 Ga0373962_0004377 3300035242 Bacteria 3409
199 Ga0373931_0003088 3300035691 Bacteria 7448
200 Ga0373947_0038506 3300035725 Bacteria 2841
201 Ga0395899_0006551 3300037312 Bacteria 9025
202 Ga0395899_0224712 3300037312 Bacteria 1299
203 Ga0395899_0236234 3300037312 Bacteria 1260
204 Ga0395899_0511120 3300037312 Unclassified 778
205 Ga0395900_0073283 3300037418 Bacteria 3521
206 Ga0395900_0132720 3300037418 Bacteria 2551
207 Ga0395900_0185779 3300037418 Bacteria 2110
208 Ga0395900_0192611 3300037418 Bacteria 2067
209 Ga0395900_0197182 3300037418 Bacteria 2039
210 Ga0395900_0228475 3300037418 Bacteria 1872
211 Ga0395900_0346107 3300037418 Bacteria 1461
212 Ga0395898_0002345 3300037466 Bacteria 22578
213 Ga0395898_0132711 3300037466 Bacteria 2384
214 Ga0395898_0790515 3300037466 Bacteria 889
215 Ga0395905_0024654 3300037471 Bacteria 5675
216 Ga0395905_0178622 3300037471 Bacteria 1993
217 Ga0395905_0335595 3300037471 Bacteria 1402
218 Ga0395901_0012793 3300038443 Bacteria 8510
219 Ga0395901_0099216 3300038443 Bacteria 3054
220 Ga0395901_0122889 3300038443 Bacteria 2728
221 Ga0395901_0223350 3300038443 Bacteria 1968
222 Ga0395901_0228617 3300038443 Unclassified 1943
223 Ga0395901_0279501 3300038443 Bacteria 1734
224 Ga0395901_0362992 3300038443 Bacteria 1493
225 Ga0395901_0757619 3300038443 Bacteria 963
226 Ga0451793_0401116 3300041452 Bacteria 1271
227 Ga0451849_1441005 3300041505 Bacteria 973
228 Ga0451853_1472358 3300041512 Bacteria 1341
229 Ga0439458_0031435 3300042157 Bacteria 1266
230 Ga0466969_0063395 3300044656 Bacteria 1792
231 Ga0466965_0079566 3300044683 Unclassified 1656
232 Ga0466963_0011173 3300044694 Bacteria 5463
233 Ga0466963_0054647 3300044694 Bacteria 2655
234 Ga0466971_0310845 3300044719 Bacteria 758
235 Ga0466960_0002965 3300044901 Bacteria 6468
236 Ga0466960_0037169 3300044901 Bacteria 2283
237 Ga0466959_0000677 3300045049 Bacteria 19896
238 Ga0466967_0034477 3300045976 Bacteria 4296
239 Ga0466967_0123689 3300045976 Unclassified 2394
240 Ga0466967_0163968 3300045976 Bacteria 2088
241 Ga0466967_0508363 3300045976 Unclassified 1183
242 Ga0466967_0771057 3300045976 Unclassified 954
243 Ga0495592_0103063 3300046454 Bacteria 2031
244 Ga0495629_0062821 3300046459 Bacteria 2593
245 Ga0495582_0197991 3300046473 Bacteria 1147
246 Ga0495605_0199476 3300046474 Bacteria 873
247 Ga0495584_0122882 3300046491 Unclassified 1315
248 Ga0495630_0305373 3300046517 Bacteria 1216
249 Ga0495656_0015084 3300046615 Bacteria 2910
250 Ga0495647_0044320 3300046681 Bacteria 1706
251 Ga0495658_0063307 3300046683 Bacteria 2128
252 Ga0495613_0417507 3300046689 Unclassified 913
253 Ga0495674_0350158 3300047319 Bacteria 1199
254 Ga0495676_0032517 3300047321 Bacteria 4402
255 Ga0496100_0002277 3300048903 Bacteria 9700
256 Ga0496100_0010479 3300048903 Bacteria 5249
257 Ga0496100_0083683 3300048903 Bacteria 2161
258 Ga0496100_0173955 3300048903 Bacteria 1553
259 Ga0496101_0004512 3300048904 Bacteria 8782
260 Ga0496101_0036581 3300048904 Bacteria 3477
261 Ga0496101_0043479 3300048904 Bacteria 3211
262 Ga0496101_0454898 3300048904 Unclassified 1010
263 Ga0496102_0068877 3300048905 Bacteria 3247
264 Ga0496102_0388877 3300048905 Unclassified 1312
265 Ga0496102_0556073 3300048905 Bacteria 1070
266 Ga0496103_0028937 3300048906 Bacteria 3365
267 Ga0496103_0066038 3300048906 Bacteria 2258
268 Ga0496103_0070570 3300048906 Bacteria 2185
269 Ga0496103_0343527 3300048906 Bacteria 960
270 Ga0496104_0000332 3300048907 Bacteria 42258
271 Ga0496104_0009071 3300048907 Bacteria 8843
272 Ga0496104_0012048 3300048907 Bacteria 7761
273 Ga0496104_0034765 3300048907 Bacteria 4701
274 Ga0496104_0135416 3300048907 Bacteria 2366
275 Ga0496104_0609967 3300048907 Unclassified 1001
276 Ga0496105_0003459 3300048908 Bacteria 11682
277 Ga0496105_0020946 3300048908 Bacteria 5288
278 Ga0496105_0027716 3300048908 Bacteria 4630
279 Ga0496105_0067484 3300048908 Bacteria 2953
280 Ga0496106_0008501 3300048909 Bacteria 7593
281 Ga0496106_0603020 3300048909 Unclassified 879
282 Ga0496107_0010805 3300048910 Bacteria 6351
283 Ga0496107_0030412 3300048910 Bacteria 3849
284 Ga0496107_0043628 3300048910 Bacteria 3222
285 Ga0496107_0203482 3300048910 Bacteria 1472
286 Ga0496108_0013138 3300048911 Bacteria 6749
287 Ga0496108_0021717 3300048911 Bacteria 5278
288 Ga0496108_0045643 3300048911 Bacteria 3660
289 Ga0496108_0063943 3300048911 Bacteria 3099
290 Ga0496108_0127178 3300048911 Bacteria 2188
291 Ga0496108_0162562 3300048911 Bacteria 1930
292 Ga0496108_0407984 3300048911 Bacteria 1187
293 Ga0496108_0774823 3300048911 Unclassified 829
294 Ga0496109_0000288 3300048912 Bacteria 47831
295 Ga0496109_0006052 3300048912 Bacteria 10162
296 Ga0496109_0017240 3300048912 Bacteria 6328
297 Ga0496109_0051318 3300048912 Bacteria 3757
298 Ga0496109_0267857 3300048912 Bacteria 1609
299 Ga0496109_0355044 3300048912 Bacteria 1385
300 Ga0496110_0000069 3300048913 Bacteria 51597
301 Ga0496110_0014066 3300048913 Bacteria 6633
302 Ga0496110_0023263 3300048913 Bacteria 5268
303 Ga0496110_0040397 3300048913 Bacteria 4066
304 Ga0496110_0265561 3300048913 Unclassified 1562
305 Ga0496110_0427623 3300048913 Bacteria 1207
306 Ga0496110_0468997 3300048913 Bacteria 1147
307 Ga0496110_0872972 3300048913 Bacteria 805
308 Ga0496111_0000084 3300048914 Bacteria 39267
309 Ga0496111_0017228 3300048914 Bacteria 4992
310 Ga0496111_0030683 3300048914 Bacteria 3823
311 Ga0496111_0060117 3300048914 Bacteria 2754
312 Ga0496111_0103594 3300048914 Bacteria 2093
313 Ga0496111_0198280 3300048914 Bacteria 1492
314 Ga0496112_0016344 3300048915 Bacteria 6949
315 Ga0496112_0026800 3300048915 Bacteria 5552
316 Ga0496112_0045736 3300048915 Bacteria 4291
317 Ga0496112_0046159 3300048915 Bacteria 4272
318 Ga0496112_0058801 3300048915 Bacteria 3787
319 Ga0496112_0126125 3300048915 Bacteria 2530
320 Ga0496112_0406073 3300048915 Bacteria 1302
321 Ga0496112_0483069 3300048915 Bacteria 1175
322 Ga0496113_0010153 3300048916 Bacteria 6214
323 Ga0496113_0019776 3300048916 Bacteria 4719
324 Ga0496113_0046850 3300048916 Bacteria 3211
325 Ga0496113_0130343 3300048916 Bacteria 1973
326 Ga0496114_0006208 3300048917 Bacteria 9411
327 Ga0496114_0019601 3300048917 Bacteria 5481
328 Ga0496114_0023619 3300048917 Bacteria 5018
329 Ga0496114_0587228 3300048917 Bacteria 983
330 Ga0496114_0664890 3300048917 Bacteria 915
331 Ga0496115_0013463 3300048918 Bacteria 6188
332 Ga0496115_0018282 3300048918 Bacteria 5378
333 Ga0496115_0188114 3300048918 Unclassified 1706
334 Ga0496115_0207906 3300048918 Unclassified 1617
335 Ga0501034_0658655 3300049571 Bacteria 948
336 Ga0501040_0128022 3300049576 Bacteria 1784
337 Ga0501040_0358659 3300049576 Bacteria 1045
338 Ga0501042_0328477 3300049578 Bacteria 1105
339 Ga0501046_0527176 3300049580 Bacteria 844
340 Ga0501047_0055166 3300049581 Bacteria 3843
341 Ga0501047_0159947 3300049581 Unclassified 2124
342 Ga0501048_0066633 3300049582 Bacteria 2546
343 Ga0501067_0452658 3300049583 Unclassified 717
344 Ga0501068_0211369 3300049584 Bacteria 1232
345 Ga0501071_0595647 3300049587 Bacteria 850
346 Ga0501079_0062989 3300049741 Bacteria 2861
347 Ga0501081_0045033 3300049743 Bacteria 3030
348 nmdc:mga0n895_268623_c1 3300050512 Unclassified 1730
349 nmdc:mga0n895_525977_c1 3300050512 Bacteria 1190
350 nmdc:mga0n895_88719_c1 3300050512 Bacteria 3093
351 nmdc:mga0rr50_374719_c1 3300050513 Bacteria 1200
352 nmdc:mga0rr50_52082_c1 3300050513 Bacteria 3040
353 nmdc:mga08x19_149702_c1 3300050514 Bacteria 1580
354 nmdc:mga08x19_70231_c1 3300050514 Bacteria 2282
355 Ga0495619_0022566 3300053085 Bacteria 4030
356 Ga0466962_0043675 3300061719 Unclassified 2144
357 Ga0530510_0555720 3300061734 Unclassified 872
358 Ga0070690_100133138
359 rootL2_10186547
360 Ga0070676_10526249
361 Ga0070683_100192171
362 Ga0070683_100765715
363 Ga0068869_100393912
364 Ga0070680_100027904
365 Ga0070680_100766034
366 Ga0070682_100238946
367 Ga0070682_100266165
368 Ga0068868_100767443
369 Ga0070660_100294225
370 Ga0070687_100262062
371 Ga0070687_100499628
372 Ga0070692_10310650
373 Ga0070675_100150669
374 Ga0070671_100487068
375 Ga0070674_100555495
376 Ga0070673_100147189
377 Ga0070703_10005552
378 Ga0070709_10094044
379 Ga0070709_10198192
380 Ga0070714_100109525
381 Ga0070713_100354086
382 Ga0070710_10107310
383 Ga0070710_10358217
384 Ga0070711_100071840
385 Ga0070705_100441954
386 Ga0070694_100224492
387 Ga0070694_100768500
388 Ga0070708_100104007
389 Ga0070708_100154491
390 Ga0070678_100046969
391 Ga0070678_100324404
392 Ga0070681_10010355
393 Ga0068867_100040481
394 Ga0068867_100405306
395 Ga0070706_100037563
396 Ga0070706_100265629
397 Ga0070707_100009422
398 Ga0070707_100074670
399 Ga0070707_100114252
400 Ga0070707_100344851
401 Ga0070707_100517237
402 Ga0070707_100582520
403 Ga0070698_100011372
404 Ga0070699_100037948
405 Ga0070699_100149024
406 Ga0070699_100259203
407 Ga0070699_100584468
408 Ga0070679_100002009
409 Ga0070684_100000360
410 Ga0070697_100081560
411 Ga0070686_100038265
412 Ga0070686_100088406
413 Ga0070695_100384014
414 Ga0070696_100054684
415 Ga0070693_100008085
416 Ga0070704_100068753
417 Ga0070704_100481622
418 Ga0068855_100698108
419 Ga0068854_100598288
420 Ga0068856_100003184
421 Ga0068856_100458959
422 Ga0070702_100266932
423 Ga0068864_100114098
424 Ga0068860_100411992
425 Ga0068862_100947319
426 Ga0081455_10036799
427 Ga0070717_10161143
428 Ga0070715_10030131
429 Ga0070715_10229112
430 Ga0070716_100372049
431 Ga0070716_100405333
432 Ga0070712_100019977
433 Ga0070712_100078129
434 Ga0070712_100272140
435 Ga0075428_100001324
436 Ga0075433_10069889
437 Ga0075433_10203420
438 Ga0075434_100231069
439 Ga0068865_100088286
440 Ga0075436_100049813
441 Ga0075435_100039398
442 Ga0075435_100171691
443 Ga0075435_100423397
444 Ga0105245_10007278
445 Ga0105245_10410565
446 Ga0105245_10523498
447 Ga0105245_10556654
448 Ga0105245_10728490
449 Ga0114129_10520095
450 Ga0114129_11502327
451 Ga0105241_10220411
452 Ga0105242_10067814
453 Ga0105242_10101482
454 Ga0105242_10231685
455 Ga0105248_10860280
456 Ga0105248_10861352
457 Ga0105237_10714636
458 Ga0105239_10176915
459 Ga0157369_10009145
460 Ga0157369_10014867
461 Ga0157369_10235806
462 Ga0157374_10081899
463 Ga0157374_10692419
464 Ga0157378_10153809
465 Ga0157378_10268550
466 Ga0163162_10178101
467 Ga0163162_10254192
468 Ga0163162_10530597
469 Ga0163162_10618240
470 Ga0157375_10338498
471 Ga0157375_10990538
472 Ga0157375_11886979
473 Ga0163163_10963732
474 Ga0157377_10065556
475 Ga0157377_10166830
476 Ga0157376_10333095
477 Ga0157376_10976851
478 Ga0163161_10465200
479 Ga0207653_10007130
480 Ga0207692_10014608
481 Ga0207692_10200343
482 Ga0207688_10264258
483 Ga0207699_10152805
484 Ga0207699_10219564
485 Ga0207684_10155964
486 Ga0207684_10463190
487 Ga0207707_10048707
488 Ga0207693_10001016
489 Ga0207693_10001814
490 Ga0207693_10061285
491 Ga0207663_10029392
492 Ga0207663_10102988
493 Ga0207663_10329153
494 Ga0207660_10006413
495 Ga0207662_10175212
496 Ga0207657_10145828
497 Ga0207652_10004016
498 Ga0207646_10004270
499 Ga0207646_10271302
500 Ga0207646_10605675
501 Ga0207659_10706382
502 Ga0207687_10007950
503 Ga0207687_10238983
504 Ga0207687_10522528
505 Ga0207700_10829431
506 Ga0207664_10272426
507 Ga0207664_10380959
508 Ga0207644_10134210
509 Ga0207690_10269548
510 Ga0207686_10097924
511 Ga0207709_10678688
512 Ga0207665_10283100
513 Ga0207711_10613178
514 Ga0207711_10863078
515 Ga0207661_10014175
516 Ga0207679_10023949
517 Ga0207667_10372338
518 Ga0207651_10146758
519 Ga0207668_10065400
520 Ga0207703_10464274
521 Ga0207639_10185979
522 Ga0207708_10216036
523 Ga0207702_10019843
524 Ga0207648_10057227
525 Ga0207676_10220374
526 Ga0207675_100009908
527 Ga0207675_100744799
528 Ga0207683_10009030
529 Ga0207683_10009561
530 Ga0207683_10580497
531 Ga0268266_10826691
532 Ga0268264_10112424
533 Ga0268264_10691911
534 Ga0268264_11011967
535 Ga0307408_100140219
536 Ga0307405_10132468
537 Ga0307407_10444115
538 Ga0307412_10096193
539 Ga0307416_100027433
540 Ga0307415_100185052
541 Ga0373948_0003622
542 Ga0373950_0016715
543 Ga0373928_0001951
544 Ga0373929_0001667
545 Ga0373940_0002189
546 Ga0373949_0013788
547 Ga0373951_0001201
548 Ga0373932_0014335
549 Ga0373939_0005216
550 Ga0373941_0015670
551 Ga0373960_0001990
552 Ga0373943_0086079
553 Ga0373942_0002866
554 Ga0373961_0003308
555 Ga0373962_0004377
556 Ga0373931_0003088
557 Ga0373947_0038506
558 Ga0395899_0006551
559 Ga0395899_0224712
560 Ga0395899_0236234
561 Ga0395899_0511120
562 Ga0395900_0073283
563 Ga0395900_0132720
564 Ga0395900_0185779
565 Ga0395900_0192611
566 Ga0395900_0197182
567 Ga0395900_0228475
568 Ga0395900_0346107
569 Ga0395898_0002345
570 Ga0395898_0132711
571 Ga0395898_0790515
572 Ga0395905_0024654
573 Ga0395905_0178622
574 Ga0395905_0335595
575 Ga0395901_0012793
576 Ga0395901_0099216
577 Ga0395901_0122889
578 Ga0395901_0223350
579 Ga0395901_0228617
580 Ga0395901_0279501
581 Ga0395901_0362992
582 Ga0395901_0757619
583 Ga0451793_0401116
584 Ga0451849_1441005
585 Ga0451853_1472358
586 Ga0439458_0031435
587 Ga0466969_0063395
588 Ga0466965_0079566
589 Ga0466963_0011173
590 Ga0466963_0054647
591 Ga0466971_0310845
592 Ga0466960_0002965
593 Ga0466960_0037169
594 Ga0466959_0000677
595 Ga0466967_0034477
596 Ga0466967_0123689
597 Ga0466967_0163968
598 Ga0466967_0508363
599 Ga0466967_0771057
600 Ga0495592_0103063
601 Ga0495629_0062821
602 Ga0495582_0197991
603 Ga0495605_0199476
604 Ga0495584_0122882
605 Ga0495630_0305373
606 Ga0495656_0015084
607 Ga0495647_0044320
608 Ga0495658_0063307
609 Ga0495613_0417507
610 Ga0495674_0350158
611 Ga0495676_0032517
612 Ga0496100_0002277
613 Ga0496100_0010479
614 Ga0496100_0083683
615 Ga0496100_0173955
616 Ga0496101_0004512
617 Ga0496101_0036581
618 Ga0496101_0043479
619 Ga0496101_0454898
620 Ga0496102_0068877
621 Ga0496102_0388877
622 Ga0496102_0556073
623 Ga0496103_0028937
624 Ga0496103_0066038
625 Ga0496103_0070570
626 Ga0496103_0343527
627 Ga0496104_0000332
628 Ga0496104_0009071
629 Ga0496104_0012048
630 Ga0496104_0034765
631 Ga0496104_0135416
632 Ga0496104_0609967
633 Ga0496105_0003459
634 Ga0496105_0020946
635 Ga0496105_0027716
636 Ga0496105_0067484
637 Ga0496106_0008501
638 Ga0496106_0603020
639 Ga0496107_0010805
640 Ga0496107_0030412
641 Ga0496107_0043628
642 Ga0496107_0203482
643 Ga0496108_0013138
644 Ga0496108_0021717
645 Ga0496108_0045643
646 Ga0496108_0063943
647 Ga0496108_0127178
648 Ga0496108_0162562
649 Ga0496108_0407984
650 Ga0496108_0774823
651 Ga0496109_0000288
652 Ga0496109_0006052
653 Ga0496109_0017240
654 Ga0496109_0051318
655 Ga0496109_0267857
656 Ga0496109_0355044
657 Ga0496110_0000069
658 Ga0496110_0014066
659 Ga0496110_0023263
660 Ga0496110_0040397
661 Ga0496110_0265561
662 Ga0496110_0427623
663 Ga0496110_0468997
664 Ga0496110_0872972
665 Ga0496111_0000084
666 Ga0496111_0017228
667 Ga0496111_0030683
668 Ga0496111_0060117
669 Ga0496111_0103594
670 Ga0496111_0198280
671 Ga0496112_0016344
672 Ga0496112_0026800
673 Ga0496112_0045736
674 Ga0496112_0046159
675 Ga0496112_0058801
676 Ga0496112_0126125
677 Ga0496112_0406073
678 Ga0496112_0483069
679 Ga0496113_0010153
680 Ga0496113_0019776
681 Ga0496113_0046850
682 Ga0496113_0130343
683 Ga0496114_0006208
684 Ga0496114_0019601
685 Ga0496114_0023619
686 Ga0496114_0587228
687 Ga0496114_0664890
688 Ga0496115_0013463
689 Ga0496115_0018282
690 Ga0496115_0188114
691 Ga0496115_0207906
692 Ga0501034_0658655
693 Ga0501040_0128022
694 Ga0501040_0358659
695 Ga0501042_0328477
696 Ga0501046_0527176
697 Ga0501047_0055166
698 Ga0501047_0159947
699 Ga0501048_0066633
700 Ga0501067_0452658
701 Ga0501068_0211369
702 Ga0501071_0595647
703 Ga0501079_0062989
704 Ga0501081_0045033
705 nmdc:mga0n895_268623_c1
706 nmdc:mga0n895_525977_c1
707 nmdc:mga0n895_88719_c1
708 nmdc:mga0rr50_374719_c1
709 nmdc:mga0rr50_52082_c1
710 nmdc:mga08x19_149702_c1
711 nmdc:mga08x19_70231_c1
712 Ga0495619_0022566
713 Ga0466962_0043675
714 Ga0530510_0555720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

42

111

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msn-assembly1.cif.gz_A suns glycosin s-glycosyltransferase 0.9117 134 182
4uqy-assembly1.cif.gz_A coevolution of the atpase clpv, the tssb-tssc sheath and the accessory hsie protein distinguishes two type vi secretion classes 0.8959 127 186
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.8813 7 109
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.8659 7 109
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8568 122 186
ID Description Score Start End Superfamily
af_F1LTE0_1245_1381_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8869 120 183 1.25.40.10
af_A0A2R8QLF6_5_101_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8857 120 186 1.25.40.10
af_A0A0G2KK82_1317_1470_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8831 120 185 1.25.40.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8813 7 109 2.60.120.10
af_E7EXH4_169_241_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8749 122 185 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7V9MF06-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9575 1 126
AF-A0A7W1N2U7-F1-model_v4 Cupin domain-containing protein 0.9543 2 208
AF-A0A538LZN4-F1-model_v4 Cupin domain-containing protein 0.951 1 127
AF-A0A7W1N2U7-F1-model_v4 Cupin domain-containing protein 0.9498 2 208
AF-A0A6J4T435-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.944 1 127 GO:0003677
GO:0006355

Map