F420673

General Info

Members Datasets Scaffolds Average Seq Length
356 244 301 255

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606700|2810365724
Length 270
Sequence PTTTPAGTGAGMIRLAVADGVAEIVLDAPYRLNAVDESALADLSAAYDVAAAGVRDGTVRALVLRGEGRAFCAGRDLGSIEPGTDDAHRFLDATLTPLLRKMAEFPAPTFAAAHGACLGVGLGLLIATDVVYVAENAKIGSPFANLGLALDSGGHWLFTERLGPHRALDLMYTGDLLTGAEAVAGGLFSRAVPAADLLELTRTKAARAARGPLQALVASKQLVGRIRDERLGLWQAISGENDVQGVLGASDDYREGLEAFREKRAPRFGA

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221616 Leifsonia sp. Root227 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221649 Leifsonia sp. Root4 Isolate Unclassified
8 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
11 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
12 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
13 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
14 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
15 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
16 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
17 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
18 2808606372 Agromyces sp. 23-23 Isolate Unclassified
19 2808606394 Promicromonospora sp. C35 Isolate Unclassified
20 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
21 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
22 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
23 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
24 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
25 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
26 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
27 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
28 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
29 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
30 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
31 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
32 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
33 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
34 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
35 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
36 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
37 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
38 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
39 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
40 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
41 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
42 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
43 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
44 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
45 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
46 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
47 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
48 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
49 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
50 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
165 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
166 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
242 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
243 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
244 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.99
Metatranscriptomes 0.56
Isolates 15.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 9.55
Rhizosphere 69.38
Stem 0
Stem Tuber 0
Unclassified 15.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003592 3300001979 Bacteria 6767
2 JGI25154J39366_1001848 3300002738 Bacteria 6458
3 Ga0006562J51391_1111915 3300003578 Bacteria 26433
4 Ga0006562J51391_1111917 3300003578 Bacteria 16790
5 Ga0070658_10039095 3300005327 Bacteria 3827
6 Ga0070658_10196863 3300005327 Bacteria 1699
7 Ga0070676_10049484 3300005328 Bacteria 2460
8 Ga0070670_100090045 3300005331 Bacteria 2637
9 Ga0070677_10002827 3300005333 Bacteria 5562
10 Ga0070666_10017291 3300005335 Bacteria 4621
11 Ga0068868_100168258 3300005338 Bacteria 1814
12 Ga0070660_100027328 3300005339 Bacteria 4257
13 Ga0070668_100133137 3300005347 Bacteria 1997
14 Ga0070669_100034022 3300005353 Bacteria 3689
15 Ga0070675_100002081 3300005354 Bacteria 14809
16 Ga0070671_100252459 3300005355 Bacteria 1498
17 Ga0070674_100008884 3300005356 Bacteria 5999
18 Ga0070673_100028915 3300005364 Bacteria 4128
19 Ga0070688_100295469 3300005365 Bacteria 1169
20 Ga0070659_100000749 3300005366 Bacteria 23637
21 Ga0070667_100108804 3300005367 Bacteria 2401
22 Ga0070678_100036859 3300005456 Bacteria 3427
23 Ga0070685_10002782 3300005466 Bacteria 8948
24 Ga0068853_100007366 3300005539 Bacteria 8806
25 Ga0070672_100024077 3300005543 Bacteria 4493
26 Ga0070693_100168350 3300005547 Bacteria 1401
27 Ga0070665_100106261 3300005548 Bacteria 2809
28 Ga0070665_100312289 3300005548 Bacteria 1576
29 Ga0068855_100006931 3300005563 Bacteria 13743
30 Ga0068855_100461179 3300005563 Bacteria 1385
31 Ga0068857_100028573 3300005577 Bacteria 4921
32 Ga0068857_100034643 3300005577 Bacteria 4466
33 Ga0068857_100777643 3300005577 Bacteria 913
34 Ga0068854_100206929 3300005578 Bacteria 1546
35 Ga0068856_100132918 3300005614 Bacteria 2493
36 Ga0068856_100152246 3300005614 Bacteria 2322
37 Ga0068852_100000260 3300005616 Bacteria 35545
38 Ga0068852_100321141 3300005616 Bacteria 1504
39 Ga0068851_10000008 3300005834 Bacteria 231006
40 Ga0068863_100080417 3300005841 Bacteria 3087
41 Ga0068858_100000096 3300005842 Bacteria 91762
42 Ga0068862_100691790 3300005844 Bacteria 987
43 Ga0075365_10154944 3300006038 Bacteria 1595
44 Ga0075363_100024199 3300006048 Bacteria 3085
45 Ga0075364_10004802 3300006051 Bacteria 7820
46 Ga0075364_10041263 3300006051 Bacteria 2996
47 Ga0075364_10110375 3300006051 Bacteria 1835
48 Ga0105251_10028558 3300009011 Bacteria 2817
49 Ga0105244_10019576 3300009036 Bacteria 3774
50 Ga0105244_10079958 3300009036 Bacteria 1619
51 Ga0105244_10135875 3300009036 Bacteria 1185
52 Ga0105240_10042094 3300009093 Bacteria 5823
53 Ga0105240_10280455 3300009093 Bacteria 1914
54 Ga0105245_10138398 3300009098 Bacteria 2290
55 Ga0105245_10489418 3300009098 Bacteria 1244
56 Ga0105243_10017886 3300009148 Bacteria 5363
57 Ga0105243_10019867 3300009148 Bacteria 5095
58 Ga0105241_10004792 3300009174 Bacteria 9961
59 Ga0105242_10071013 3300009176 Bacteria 2888
60 Ga0105248_10000713 3300009177 Bacteria 37644
61 Ga0105248_10029944 3300009177 Bacteria 6075
62 Ga0105248_10320511 3300009177 Bacteria 1746
63 Ga0105237_10000688 3300009545 Bacteria 46838
64 Ga0105237_10077680 3300009545 Bacteria 3310
65 Ga0105237_10160835 3300009545 Bacteria 2244
66 Ga0105238_10006337 3300009551 Bacteria 11764
67 Ga0105249_10470781 3300009553 Bacteria 1298
68 Ga0105239_10598730 3300010375 Bacteria 1257
69 Ga0105239_10745180 3300010375 Bacteria 1121
70 Ga0105239_11162030 3300010375 Bacteria 889
71 Ga0105246_10001374 3300011119 Bacteria 14351
72 Ga0157371_10374929 3300013102 Bacteria 1038
73 Ga0157370_10017661 3300013104 Bacteria 7192
74 Ga0157370_10172350 3300013104 Bacteria 2011
75 Ga0157369_10273161 3300013105 Bacteria 1761
76 Ga0157374_10389752 3300013296 Bacteria 1388
77 Ga0163162_10041974 3300013306 Bacteria 4577
78 Ga0163162_10463556 3300013306 Bacteria 1399
79 Ga0157375_10028933 3300013308 Bacteria 5203
80 Ga0157375_10276421 3300013308 Bacteria 1842
81 Ga0163163_10144201 3300014325 Bacteria 2424
82 Ga0163163_10192125 3300014325 Bacteria 2090
83 Ga0157380_10047074 3300014326 Bacteria 3390
84 Ga0157380_10060425 3300014326 Bacteria 3029
85 Ga0157379_10055035 3300014968 Bacteria 3555
86 Ga0209646_1000192 3300025246 Bacteria 75005
87 Ga0209148_1002560 3300025254 Bacteria 6044
88 Ga0209129_1000060 3300025258 Bacteria 248262
89 Ga0209025_1000308 3300025294 Bacteria 108660
90 Ga0209051_1006435 3300025303 Bacteria 6613
91 Ga0207697_10001346 3300025315 Bacteria 13487
92 Ga0207697_10002868 3300025315 Bacteria 8731
93 Ga0207697_10060060 3300025315 Bacteria 1581
94 Ga0207656_10000005 3300025321 Bacteria 490514
95 Ga0207655_1023803 3300025728 Bacteria 3023
96 Ga0207655_1027097 3300025728 Bacteria 2738
97 Ga0207682_10002689 3300025893 Bacteria 7914
98 Ga0207688_10107959 3300025901 Bacteria 1613
99 Ga0207645_10001817 3300025907 Bacteria 17211
100 Ga0207705_10005614 3300025909 Bacteria 9370
101 Ga0207705_10123891 3300025909 Bacteria 1920
102 Ga0207654_10000001 3300025911 Bacteria 1816198
103 Ga0207695_10003698 3300025913 Bacteria 21313
104 Ga0207695_10043103 3300025913 Bacteria 4812
105 Ga0207671_10000016 3300025914 Bacteria 435413
106 Ga0207671_10059458 3300025914 Bacteria 2834
107 Ga0207657_10066407 3300025919 Bacteria 3070
108 Ga0207649_10233067 3300025920 Bacteria 1318
109 Ga0207681_10691649 3300025923 Bacteria 847
110 Ga0207694_10000196 3300025924 Bacteria 60714
111 Ga0207687_10071427 3300025927 Bacteria 2480
112 Ga0207687_10146319 3300025927 Bacteria 1798
113 Ga0207644_10379047 3300025931 Bacteria 1153
114 Ga0207644_10546557 3300025931 Bacteria 958
115 Ga0207690_10002457 3300025932 Bacteria 11196
116 Ga0207709_10028627 3300025935 Bacteria 3222
117 Ga0207709_10104257 3300025935 Bacteria 1882
118 Ga0207691_10005579 3300025940 Bacteria 12154
119 Ga0207691_10218313 3300025940 Bacteria 1654
120 Ga0207711_10002484 3300025941 Bacteria 16451
121 Ga0207711_10014724 3300025941 Bacteria 6498
122 Ga0207711_10044649 3300025941 Bacteria 3783
123 Ga0207667_10001482 3300025949 Bacteria 29458
124 Ga0207667_10005412 3300025949 Bacteria 15570
125 Ga0207667_10253539 3300025949 Bacteria 1800
126 Ga0207667_10373174 3300025949 Bacteria 1454
127 Ga0207658_10263322 3300025986 Bacteria 1470
128 Ga0207677_10179307 3300026023 Bacteria 1665
129 Ga0207703_10000156 3300026035 Bacteria 78672
130 Ga0207639_10026731 3300026041 Bacteria 4195
131 Ga0207702_10055677 3300026078 Bacteria 3355
132 Ga0207641_10052081 3300026088 Bacteria 3466
133 Ga0207676_10493305 3300026095 Bacteria 1162
134 Ga0207674_10000405 3300026116 Bacteria 55884
135 Ga0207674_10035982 3300026116 Bacteria 5164
136 Ga0207683_10004220 3300026121 Bacteria 12415
137 Ga0207698_10000078 3300026142 Bacteria 65050
138 Ga0268266_10076365 3300028379 Bacteria 2912
139 Ga0307515_10035711 3300028794 Bacteria 8072
140 Ga0307408_100312318 3300031548 Bacteria 1321
141 Ga0307408_100650194 3300031548 Bacteria 943
142 Ga0307413_10093138 3300031824 Bacteria 1969
143 Ga0307413_10279248 3300031824 Bacteria 1255
144 Ga0307410_10008415 3300031852 Bacteria 5718
145 Ga0307410_10215361 3300031852 Bacteria 1474
146 Ga0307410_10222183 3300031852 Bacteria 1454
147 Ga0307406_10000599 3300031901 Bacteria 20645
148 Ga0307406_10000877 3300031901 Bacteria 16925
149 Ga0307406_10074867 3300031901 Bacteria 2231
150 Ga0307406_10109330 3300031901 Bacteria 1900
151 Ga0307406_10357930 3300031901 Bacteria 1143
152 Ga0307409_100012003 3300031995 Bacteria 5497
153 Ga0307416_100000911 3300032002 Bacteria 15591
154 Ga0307416_100091501 3300032002 Bacteria 2613
155 Ga0307416_100238746 3300032002 Bacteria 1759
156 Ga0307414_10360122 3300032004 Bacteria 1251
157 Ga0395900_0025053 3300037418 Bacteria 6106
158 Ga0395900_0550434 3300037418 Bacteria 1098
159 Ga0395898_0177997 3300037466 Bacteria 2032
160 Ga0395905_0152471 3300037471 Bacteria 2174
161 Ga0439436_0014517 3300041404 Bacteria 2375
162 Ga0451837_0843361 3300041494 Bacteria 876
163 Ga0451853_0730806 3300041512 Bacteria 1033
164 Ga0451853_0813360 3300041512 Bacteria 1907
165 Ga0439433_0012068 3300041999 Bacteria 1893
166 Ga0439442_002195 3300042002 Bacteria 3849
167 Ga0439442_007167 3300042002 Bacteria 2242
168 Ga0439442_008812 3300042002 Bacteria 2037
169 Ga0439442_023634 3300042002 Bacteria 1277
170 Ga0439449_0004961 3300042007 Bacteria 5120
171 Ga0439449_0006233 3300042007 Bacteria 4558
172 Ga0439449_0080704 3300042007 Bacteria 1199
173 Ga0450920_004185 3300042122 Bacteria 2526
174 Ga0450920_004235 3300042122 Bacteria 2514
175 Ga0450907_010554 3300042146 Bacteria 1532
176 Ga0450907_014353 3300042146 Bacteria 1322
177 Ga0450909_018823 3300042185 Bacteria 1027
178 Ga0439434_0009847 3300042435 Bacteria 2812
179 Ga0450918_025949 3300042531 Bacteria 1027
180 Ga0466972_0049597 3300044658 Bacteria 2028
181 Ga0466972_0068542 3300044658 Bacteria 1695
182 Ga0466970_0000001 3300044765 Bacteria 252791
183 Ga0495627_000352 3300046453 Bacteria 43219
184 Ga0495627_008037 3300046453 Bacteria 3979
185 Ga0495653_0003646 3300046463 Bacteria 12427
186 Ga0495582_0046746 3300046473 Bacteria 2384
187 Ga0495664_0002941 3300046477 Bacteria 9200
188 Ga0495631_0028502 3300046518 Bacteria 2547
189 Ga0495642_0029982 3300046528 Bacteria 2175
190 Ga0495586_0074729 3300046535 Bacteria 1855
191 Ga0495667_0000811 3300046559 Bacteria 20080
192 Ga0495656_0034158 3300046615 Bacteria 2080
193 Ga0495659_0039291 3300046664 Bacteria 1682
194 Ga0495661_0246401 3300046665 Bacteria 914
195 Ga0495670_0014668 3300046691 Bacteria 3854
196 Ga0495671_0148395 3300046692 Bacteria 1142
197 Ga0495600_0005164 3300046809 Bacteria 7848
198 Ga0495581_0387489 3300047315 Bacteria 815
199 Ga0495636_0009334 3300047318 Bacteria 3862
200 Ga0495680_0023029 3300047322 Bacteria 5184
201 Ga0495677_0019067 3300047445 Bacteria 2488
202 Ga0495677_0071313 3300047445 Bacteria 1295
203 Ga0496100_0075141 3300048903 Bacteria 2265
204 Ga0496101_0007853 3300048904 Bacteria 6941
205 Ga0496102_0021093 3300048905 Bacteria 5761
206 Ga0496102_0250644 3300048905 Bacteria 1669
207 Ga0496103_0034487 3300048906 Bacteria 3094
208 Ga0496103_0188604 3300048906 Bacteria 1325
209 Ga0496103_0199242 3300048906 Bacteria 1287
210 Ga0496103_0289757 3300048906 Bacteria 1053
211 Ga0496103_0348621 3300048906 Bacteria 952
212 Ga0496104_0344298 3300048907 Bacteria 1403
213 Ga0496105_0068801 3300048908 Bacteria 2925
214 Ga0496105_0121880 3300048908 Bacteria 2150
215 Ga0496105_0139433 3300048908 Bacteria 1996
216 Ga0496106_0012938 3300048909 Bacteria 6158
217 Ga0496106_0224478 3300048909 Bacteria 1498
218 Ga0496107_0000856 3300048910 Bacteria 17867
219 Ga0496108_0378572 3300048911 Bacteria 1236
220 Ga0496108_0619854 3300048911 Bacteria 942
221 Ga0496109_0108155 3300048912 Bacteria 2584
222 Ga0496109_0131824 3300048912 Bacteria 2333
223 Ga0496110_0021571 3300048913 Bacteria 5457
224 Ga0496110_0371796 3300048913 Bacteria 1302
225 Ga0496111_0019516 3300048914 Bacteria 4710
226 Ga0496111_0374302 3300048914 Bacteria 1053
227 Ga0496112_0089112 3300048915 Bacteria 3053
228 Ga0496112_0479430 3300048915 Bacteria 1181
229 Ga0496113_0429210 3300048916 Bacteria 1062
230 Ga0496114_0031177 3300048917 Bacteria 4386
231 Ga0496114_0064746 3300048917 Bacteria 3062
232 Ga0496114_0110357 3300048917 Bacteria 2356
233 Ga0496114_0155542 3300048917 Bacteria 1985
234 Ga0496114_0263321 3300048917 Bacteria 1518
235 Ga0496115_0024793 3300048918 Bacteria 4665
236 Ga0496115_0036909 3300048918 Bacteria 3870
237 Ga0496117_0001961 3300048920 Bacteria 27354
238 Ga0496119_0131050 3300048922 Bacteria 1366
239 Ga0496119_0182291 3300048922 Bacteria 1100
240 Ga0496120_0003177 3300048923 Bacteria 15298
241 Ga0496120_0061179 3300048923 Bacteria 2103
242 Ga0496122_0007407 3300048925 Bacteria 12215
243 Ga0496122_0033165 3300048925 Bacteria 4253
244 Ga0496122_0047744 3300048925 Bacteria 3302
245 Ga0496124_0129340 3300048927 Bacteria 2008
246 Ga0496125_0007249 3300048928 Bacteria 11812
247 Ga0496125_0011987 3300048928 Bacteria 8633
248 Ga0496125_0063564 3300048928 Bacteria 2942
249 Ga0496125_0090777 3300048928 Bacteria 2291
250 Ga0496126_0021928 3300048929 Bacteria 6228
251 Ga0496126_0026857 3300048929 Bacteria 5512
252 Ga0496126_0035873 3300048929 Bacteria 4642
253 Ga0496126_0152197 3300048929 Bacteria 1982
254 Ga0496126_0283850 3300048929 Bacteria 1371
255 Ga0501032_0000526 3300049569 Bacteria 31167
256 Ga0501034_0000042 3300049571 Bacteria 229124
257 Ga0501034_0007589 3300049571 Bacteria 11542
258 Ga0501034_0034554 3300049571 Bacteria 5125
259 Ga0501034_0073183 3300049571 Bacteria 3435
260 Ga0501034_0404685 3300049571 Bacteria 1287
261 Ga0501034_0475951 3300049571 Bacteria 1164
262 Ga0501037_0003986 3300049573 Bacteria 10707
263 Ga0501037_0018349 3300049573 Bacteria 5156
264 Ga0501038_0013508 3300049574 Bacteria 7442
265 Ga0501038_0014779 3300049574 Bacteria 7111
266 Ga0501038_0046850 3300049574 Bacteria 3747
267 Ga0501038_0052801 3300049574 Bacteria 3502
268 Ga0501038_0070258 3300049574 Bacteria 2973
269 Ga0501039_0011166 3300049575 Bacteria 6844
270 Ga0501039_0022320 3300049575 Bacteria 4859
271 Ga0501039_0055456 3300049575 Bacteria 3069
272 Ga0501043_0151673 3300049579 Bacteria 1813
273 Ga0501043_0211511 3300049579 Bacteria 1503
274 Ga0501046_0024093 3300049580 Bacteria 4997
275 Ga0501047_0019839 3300049581 Bacteria 6453
276 Ga0501048_0000826 3300049582 Bacteria 22836
277 Ga0501068_0038798 3300049584 Bacteria 2854
278 Ga0501070_0003400 3300049586 Bacteria 13815
279 Ga0501070_0100236 3300049586 Bacteria 2396
280 Ga0501070_0105404 3300049586 Bacteria 2331
281 Ga0501071_0000493 3300049587 Bacteria 19987
282 Ga0501073_0012549 3300049589 Bacteria 6185
283 Ga0501076_0471853 3300049592 Bacteria 1034
284 Ga0501076_0616279 3300049592 Bacteria 895
285 Ga0501079_0246817 3300049741 Bacteria 1395
286 Ga0501080_0617074 3300049742 Bacteria 962
287 Ga0501044_0145772 3300049823 Bacteria 2353
288 nmdc:mga00v17_23135_c1 3300050491 Bacteria 3592
289 nmdc:mga06z11_87167_c1 3300050494 Bacteria 1688
290 nmdc:mga07m45_42313_c1 3300050496 Bacteria 2553
291 Ga0500635_0000064 3300053080 Bacteria 70317
292 Ga0500635_0002491 3300053080 Bacteria 4569
293 Ga0500651_0000155 3300053093 Bacteria 43944
294 Ga0500559_0230716 3300053136 Bacteria 873
295 Ga0500568_0003203 3300053139 Bacteria 9302
296 Ga0500590_043661 3300053148 Bacteria 2298
297 Ga0500616_0000010 3300053153 Bacteria 761410
298 Ga0500616_0000089 3300053153 Bacteria 191075
299 Ga0500620_000492 3300053155 Bacteria 6946
300 Ga0501084_0327518 3300054114 Bacteria 1294
301 Ga0501082_0267063 3300060353 Bacteria 1489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_0843361 Ga0451837_0843361_201_863 213
2 3300032004 Ga0307414_10360122 Ga0307414_103601222 231
3 3300031901 Ga0307406_10357930 Ga0307406_103579302 234
4 3300048928 Ga0496125_0011987 Ga0496125_0011987_2835_3605 234
5 3300006051 Ga0075364_10004802 Ga0075364_100048027 235
6 3300048925 Ga0496122_0007407 Ga0496122_0007407_4758_5528 235
7 3300048927 Ga0496124_0129340 Ga0496124_0129340_47_817 235
8 3300048928 Ga0496125_0007249 Ga0496125_0007249_2924_3694 235
9 3300048929 Ga0496126_0152197 Ga0496126_0152197_845_1615 235
10 3300050491 nmdc:mga00v17_23135_c1 nmdc:mga00v17_23135_c1_2269_3039 235
11 3300031901 Ga0307406_10000599 Ga0307406_100005996 236
12 3300048925 Ga0496122_0047744 Ga0496122_0047744_1371_2141 236
13 3300003578 Ga0006562J51391_1111915 Ga0006562J51391_11119157 238
14 3300003578 Ga0006562J51391_1111917 Ga0006562J51391_111191716 238
15 3300005844 Ga0068862_100691790 Ga0068862_1006917901 238
16 3300009036 Ga0105244_10079958 Ga0105244_100799581 238
17 3300009553 Ga0105249_10470781 Ga0105249_104707812 238
18 3300014325 Ga0163163_10192125 Ga0163163_101921252 238
19 3300014326 Ga0157380_10047074 Ga0157380_100470742 238
20 3300026095 Ga0207676_10493305 Ga0207676_104933051 238
21 3300048906 Ga0496103_0348621 Ga0496103_0348621_124_909 238
22 3300053136 Ga0500559_0230716 Ga0500559_0230716_13_780 238
23 3300032002 Ga0307416_100238746 Ga0307416_1002387462 239
24 3300002738 JGI25154J39366_1001848 JGI25154J39366_10018485 241
25 3300025246 Ga0209646_1000192 Ga0209646_100019266 241
26 3300031852 Ga0307410_10222183 Ga0307410_102221832 241
27 3300048920 Ga0496117_0001961 Ga0496117_0001961_9566_10336 241
28 iso_pu_bacteria 2946033335 2946034599 241
29 3300046463 Ga0495653_0003646 Ga0495653_0003646_572_1351 242
30 3300046477 Ga0495664_0002941 Ga0495664_0002941_4238_5017 242
31 3300046535 Ga0495586_0074729 Ga0495586_0074729_509_1288 242
32 3300046809 Ga0495600_0005164 Ga0495600_0005164_5822_6601 242
33 3300047315 Ga0495581_0387489 Ga0495581_0387489_25_804 242
34 3300047322 Ga0495680_0023029 Ga0495680_0023029_4211_4990 242
35 3300009545 Ga0105237_10077680 Ga0105237_100776804 244
36 3300025914 Ga0207671_10059458 Ga0207671_100594581 244
37 3300046473 Ga0495582_0046746 Ga0495582_0046746_1267_2046 244
38 3300046559 Ga0495667_0000811 Ga0495667_0000811_4629_5408 244
39 3300049571 Ga0501034_0404685 Ga0501034_0404685_178_948 244
40 3300049574 Ga0501038_0046850 Ga0501038_0046850_1492_2262 244
41 3300049592 Ga0501076_0616279 Ga0501076_0616279_29_802 244
42 3300053080 Ga0500635_0000064 Ga0500635_0000064_5921_6703 244
43 3300053148 Ga0500590_043661 Ga0500590_043661_884_1666 244
44 3300054114 Ga0501084_0327518 Ga0501084_0327518_164_937 244
45 3300005547 Ga0070693_100168350 Ga0070693_1001683503 245
46 3300005616 Ga0068852_100000260 Ga0068852_1000002602 245
47 3300013296 Ga0157374_10389752 Ga0157374_103897522 245
48 3300026142 Ga0207698_10000078 Ga0207698_1000007859 245
49 3300005577 Ga0068857_100777643 Ga0068857_1007776432 246
50 3300013105 Ga0157369_10273161 Ga0157369_102731612 247
51 3300025923 Ga0207681_10691649 Ga0207681_106916491 247
52 3300026121 Ga0207683_10004220 Ga0207683_100042208 247
53 3300048906 Ga0496103_0188604 Ga0496103_0188604_374_1153 247
54 3300048913 Ga0496110_0371796 Ga0496110_0371796_150_929 247
55 3300048928 Ga0496125_0090777 Ga0496125_0090777_306_1085 247
56 3300046518 Ga0495631_0028502 Ga0495631_0028502_960_1739 248
57 3300046615 Ga0495656_0034158 Ga0495656_0034158_1087_1866 248
58 3300046664 Ga0495659_0039291 Ga0495659_0039291_456_1235 248
59 3300046665 Ga0495661_0246401 Ga0495661_0246401_34_813 248
60 3300046691 Ga0495670_0014668 Ga0495670_0014668_1389_2168 248
61 3300047318 Ga0495636_0009334 Ga0495636_0009334_2393_3172 248
62 3300047445 Ga0495677_0019067 Ga0495677_0019067_799_1578 248
63 iso_pu_bacteria 2833709550 2833709692 250
64 3300048908 Ga0496105_0121880 Ga0496105_0121880_459_1229 251
65 3300048917 Ga0496114_0263321 Ga0496114_0263321_259_1029 251
66 3300048918 Ga0496115_0036909 Ga0496115_0036909_397_1167 251
67 3300048929 Ga0496126_0283850 Ga0496126_0283850_280_1050 251
68 iso_pu_bacteria 2844849076 2844849998 251
69 iso_pu_bacteria 2857740372 2857742381 251
70 iso_pu_bacteria 2904497146 2904500631 251
71 iso_pu_bacteria 2904776348 2904777131 251
72 iso_pu_bacteria 2910809715 2910809866 251
73 iso_pu_bacteria 2919034639 2919038190 251
74 iso_pu_bacteria 2919059106 2919059285 251
75 iso_pu_bacteria 2919391150 2919393678 251
76 iso_pu_bacteria 2919538618 2919541108 251
77 iso_pu_bacteria 2932426870 2932427250 251
78 iso_pu_bacteria 2933418574 2933420977 251
79 iso_pu_bacteria 2939647034 2939650511 251
80 iso_pu_bacteria 2939674588 2939676900 251
81 iso_pu_bacteria 2643221542 2643734946 252
82 iso_pu_bacteria 2643221546 2643753312 252
83 iso_pu_bacteria 2643221553 2643783438 252
84 iso_pu_bacteria 2643221616 2644096616 252
85 iso_pu_bacteria 2643221630 2644173106 252
86 iso_pu_bacteria 2643221669 2644384091 252
87 iso_pu_bacteria 2643221724 2644679322 252
88 iso_pu_bacteria 2728369380 2730228841 252
89 iso_pu_bacteria 2739367654 2739607608 252
90 iso_pu_bacteria 2775506735 2775655528 252
91 iso_pu_bacteria 2808606306 2808629862 252
92 iso_pu_bacteria 2808606357 2808828221 252
93 iso_pu_bacteria 2808606360 2808849458 252
94 iso_pu_bacteria 2808606366 2808877927 252
95 iso_pu_bacteria 2808606371 2808895436 252
96 iso_pu_bacteria 2808606372 2808900585 252
97 iso_pu_bacteria 2808606394 2809026488 252
98 iso_pu_bacteria 2811994871 2812320028 252
99 iso_pu_bacteria 2811994871 2812320038 252
100 iso_pu_bacteria 2811994872 2812324564 252
101 iso_pu_bacteria 2852646457 2852648018 252
102 iso_pu_bacteria 2852663356 2852665744 252
103 iso_pu_bacteria 2857723135 2857727172 252
104 iso_pu_bacteria 2904509784 2904511388 252
105 iso_pu_bacteria 2939660829 2939661562 252
106 iso_pu_bacteria 2945968032 2945969274 252
107 iso_pu_bacteria 2946041624 2946043315 252
108 iso_pu_bacteria 2946059875 2946061605 252
109 iso_pu_bacteria 2946080515 2946081715 252
110 iso_pu_bacteria 8004021418 8004023917 252
111 iso_pu_bacteria 8004025490 8004025633 252
112 iso_pu_bacteria 8004182704 8004183660 252
113 iso_pu_bacteria 8004212874 8004215415 252
114 iso_pu_bacteria 2643221649 2644279676 253
115 iso_pu_bacteria 2939657138 2939659615 253
116 3300053139 Ga0500568_0003203 Ga0500568_0003203_845_1615 254
117 iso_pu_bacteria 2537561592 2537899245 254
118 iso_pu_bacteria 2946003308 2946005800 254
119 3300005327 Ga0070658_10039095 Ga0070658_100390952 255
120 3300005327 Ga0070658_10196863 Ga0070658_101968631 255
121 3300005328 Ga0070676_10049484 Ga0070676_100494843 255
122 3300005331 Ga0070670_100090045 Ga0070670_1000900453 255
123 3300005333 Ga0070677_10002827 Ga0070677_100028274 255
124 3300005335 Ga0070666_10017291 Ga0070666_100172915 255
125 3300005338 Ga0068868_100168258 Ga0068868_1001682582 255
126 3300005339 Ga0070660_100027328 Ga0070660_1000273283 255
127 3300005347 Ga0070668_100133137 Ga0070668_1001331372 255
128 3300005353 Ga0070669_100034022 Ga0070669_1000340223 255
129 3300005354 Ga0070675_100002081 Ga0070675_10000208113 255
130 3300005356 Ga0070674_100008884 Ga0070674_1000088846 255
131 3300005364 Ga0070673_100028915 Ga0070673_1000289152 255
132 3300005365 Ga0070688_100295469 Ga0070688_1002954691 255
133 3300005366 Ga0070659_100000749 Ga0070659_1000007493 255
134 3300005367 Ga0070667_100108804 Ga0070667_1001088042 255
135 3300005456 Ga0070678_100036859 Ga0070678_1000368594 255
136 3300005466 Ga0070685_10002782 Ga0070685_100027823 255
137 3300005539 Ga0068853_100007366 Ga0068853_1000073666 255
138 3300005543 Ga0070672_100024077 Ga0070672_1000240774 255
139 3300005548 Ga0070665_100312289 Ga0070665_1003122892 255
140 3300005563 Ga0068855_100006931 Ga0068855_1000069318 255
141 3300005563 Ga0068855_100461179 Ga0068855_1004611792 255
142 3300005577 Ga0068857_100028573 Ga0068857_1000285733 255
143 3300005577 Ga0068857_100034643 Ga0068857_1000346432 255
144 3300005578 Ga0068854_100206929 Ga0068854_1002069292 255
145 3300005614 Ga0068856_100132918 Ga0068856_1001329181 255
146 3300005614 Ga0068856_100152246 Ga0068856_1001522462 255
147 3300005616 Ga0068852_100321141 Ga0068852_1003211412 255
148 3300005834 Ga0068851_10000008 Ga0068851_10000008180 255
149 3300005842 Ga0068858_100000096 Ga0068858_10000009631 255
150 3300009011 Ga0105251_10028558 Ga0105251_100285582 255
151 3300009036 Ga0105244_10019576 Ga0105244_100195762 255
152 3300009036 Ga0105244_10135875 Ga0105244_101358751 255
153 3300009093 Ga0105240_10042094 Ga0105240_100420943 255
154 3300009093 Ga0105240_10280455 Ga0105240_102804552 255
155 3300009098 Ga0105245_10489418 Ga0105245_104894182 255
156 3300009148 Ga0105243_10017886 Ga0105243_100178863 255
157 3300009148 Ga0105243_10019867 Ga0105243_100198674 255
158 3300009174 Ga0105241_10004792 Ga0105241_100047929 255
159 3300009176 Ga0105242_10071013 Ga0105242_100710133 255
160 3300009177 Ga0105248_10000713 Ga0105248_1000071335 255
161 3300009177 Ga0105248_10320511 Ga0105248_103205112 255
162 3300009545 Ga0105237_10000688 Ga0105237_1000068836 255
163 3300009545 Ga0105237_10160835 Ga0105237_101608352 255
164 3300009551 Ga0105238_10006337 Ga0105238_100063376 255
165 3300010375 Ga0105239_10598730 Ga0105239_105987302 255
166 3300010375 Ga0105239_11162030 Ga0105239_111620301 255
167 3300011119 Ga0105246_10001374 Ga0105246_1000137412 255
168 3300013104 Ga0157370_10172350 Ga0157370_101723502 255
169 3300013306 Ga0163162_10041974 Ga0163162_100419742 255
170 3300013306 Ga0163162_10463556 Ga0163162_104635562 255
171 3300013308 Ga0157375_10028933 Ga0157375_100289332 255
172 3300014325 Ga0163163_10144201 Ga0163163_101442012 255
173 3300014968 Ga0157379_10055035 Ga0157379_100550352 255
174 3300025254 Ga0209148_1002560 Ga0209148_10025606 255
175 3300025258 Ga0209129_1000060 Ga0209129_1000060126 255
176 3300025294 Ga0209025_1000308 Ga0209025_100030856 255
177 3300025303 Ga0209051_1006435 Ga0209051_10064354 255
178 3300025315 Ga0207697_10001346 Ga0207697_100013468 255
179 3300025315 Ga0207697_10002868 Ga0207697_100028689 255
180 3300025315 Ga0207697_10060060 Ga0207697_100600602 255
181 3300025321 Ga0207656_10000005 Ga0207656_10000005181 255
182 3300025728 Ga0207655_1023803 Ga0207655_10238033 255
183 3300025728 Ga0207655_1027097 Ga0207655_10270972 255
184 3300025893 Ga0207682_10002689 Ga0207682_100026894 255
185 3300025901 Ga0207688_10107959 Ga0207688_101079592 255
186 3300025907 Ga0207645_10001817 Ga0207645_1000181713 255
187 3300025909 Ga0207705_10005614 Ga0207705_100056142 255
188 3300025909 Ga0207705_10123891 Ga0207705_101238911 255
189 3300025911 Ga0207654_10000001 Ga0207654_10000001723 255
190 3300025913 Ga0207695_10003698 Ga0207695_100036988 255
191 3300025913 Ga0207695_10043103 Ga0207695_100431032 255
192 3300025914 Ga0207671_10000016 Ga0207671_10000016279 255
193 3300025919 Ga0207657_10066407 Ga0207657_100664072 255
194 3300025924 Ga0207694_10000196 Ga0207694_1000019638 255
195 3300025927 Ga0207687_10071427 Ga0207687_100714272 255
196 3300025931 Ga0207644_10379047 Ga0207644_103790472 255
197 3300025932 Ga0207690_10002457 Ga0207690_100024572 255
198 3300025935 Ga0207709_10028627 Ga0207709_100286272 255
199 3300025935 Ga0207709_10104257 Ga0207709_101042572 255
200 3300025940 Ga0207691_10005579 Ga0207691_100055797 255
201 3300025940 Ga0207691_10218313 Ga0207691_102183132 255
202 3300025941 Ga0207711_10002484 Ga0207711_1000248414 255
203 3300025941 Ga0207711_10044649 Ga0207711_100446494 255
204 3300025949 Ga0207667_10001482 Ga0207667_1000148230 255
205 3300025949 Ga0207667_10005412 Ga0207667_1000541210 255
206 3300025986 Ga0207658_10263322 Ga0207658_102633222 255
207 3300026023 Ga0207677_10179307 Ga0207677_101793072 255
208 3300026035 Ga0207703_10000156 Ga0207703_1000015667 255
209 3300026041 Ga0207639_10026731 Ga0207639_100267316 255
210 3300026078 Ga0207702_10055677 Ga0207702_100556772 255
211 3300026116 Ga0207674_10000405 Ga0207674_1000040544 255
212 3300026116 Ga0207674_10035982 Ga0207674_100359824 255
213 3300028379 Ga0268266_10076365 Ga0268266_100763652 255
214 3300031548 Ga0307408_100312318 Ga0307408_1003123182 255
215 3300031824 Ga0307413_10093138 Ga0307413_100931382 255
216 3300031824 Ga0307413_10279248 Ga0307413_102792481 255
217 3300031852 Ga0307410_10215361 Ga0307410_102153612 255
218 3300032002 Ga0307416_100091501 Ga0307416_1000915013 255
219 3300037418 Ga0395900_0550434 Ga0395900_0550434_290_1069 255
220 3300041404 Ga0439436_0014517 Ga0439436_0014517_1438_2217 255
221 3300041999 Ga0439433_0012068 Ga0439433_0012068_214_993 255
222 3300042002 Ga0439442_002195 Ga0439442_002195_50_829 255
223 3300042002 Ga0439442_007167 Ga0439442_007167_1157_1936 255
224 3300042002 Ga0439442_008812 Ga0439442_008812_17_796 255
225 3300042002 Ga0439442_023634 Ga0439442_023634_159_938 255
226 3300042007 Ga0439449_0004961 Ga0439449_0004961_4211_4990 255
227 3300042007 Ga0439449_0006233 Ga0439449_0006233_102_881 255
228 3300042007 Ga0439449_0080704 Ga0439449_0080704_98_877 255
229 3300042122 Ga0450920_004185 Ga0450920_004185_627_1406 255
230 3300042122 Ga0450920_004235 Ga0450920_004235_1458_2237 255
231 3300042146 Ga0450907_010554 Ga0450907_010554_159_938 255
232 3300042146 Ga0450907_014353 Ga0450907_014353_284_1063 255
233 3300042185 Ga0450909_018823 Ga0450909_018823_120_899 255
234 3300042435 Ga0439434_0009847 Ga0439434_0009847_1692_2471 255
235 3300042531 Ga0450918_025949 Ga0450918_025949_178_957 255
236 3300046528 Ga0495642_0029982 Ga0495642_0029982_88_867 255
237 3300047445 Ga0495677_0071313 Ga0495677_0071313_383_1162 255
238 3300048903 Ga0496100_0075141 Ga0496100_0075141_134_913 255
239 3300048904 Ga0496101_0007853 Ga0496101_0007853_3816_4595 255
240 3300048905 Ga0496102_0021093 Ga0496102_0021093_3418_4197 255
241 3300048905 Ga0496102_0250644 Ga0496102_0250644_316_1095 255
242 3300048906 Ga0496103_0034487 Ga0496103_0034487_40_819 255
243 3300048906 Ga0496103_0199242 Ga0496103_0199242_170_949 255
244 3300048906 Ga0496103_0289757 Ga0496103_0289757_226_1005 255
245 3300048907 Ga0496104_0344298 Ga0496104_0344298_172_951 255
246 3300048908 Ga0496105_0068801 Ga0496105_0068801_809_1576 255
247 3300048908 Ga0496105_0139433 Ga0496105_0139433_865_1644 255
248 3300048909 Ga0496106_0012938 Ga0496106_0012938_1353_2132 255
249 3300048909 Ga0496106_0224478 Ga0496106_0224478_354_1133 255
250 3300048910 Ga0496107_0000856 Ga0496107_0000856_3822_4601 255
251 3300048911 Ga0496108_0378572 Ga0496108_0378572_118_885 255
252 3300048911 Ga0496108_0619854 Ga0496108_0619854_135_902 255
253 3300048912 Ga0496109_0108155 Ga0496109_0108155_391_1158 255
254 3300048912 Ga0496109_0131824 Ga0496109_0131824_964_1743 255
255 3300048913 Ga0496110_0021571 Ga0496110_0021571_3856_4635 255
256 3300048914 Ga0496111_0019516 Ga0496111_0019516_738_1517 255
257 3300048914 Ga0496111_0374302 Ga0496111_0374302_120_899 255
258 3300048915 Ga0496112_0479430 Ga0496112_0479430_36_803 255
259 3300048916 Ga0496113_0429210 Ga0496113_0429210_234_1013 255
260 3300048917 Ga0496114_0064746 Ga0496114_0064746_2081_2848 255
261 3300048917 Ga0496114_0110357 Ga0496114_0110357_802_1569 255
262 3300048922 Ga0496119_0131050 Ga0496119_0131050_574_1356 255
263 3300048922 Ga0496119_0182291 Ga0496119_0182291_217_987 255
264 3300048923 Ga0496120_0003177 Ga0496120_0003177_11930_12700 255
265 3300048923 Ga0496120_0061179 Ga0496120_0061179_906_1688 255
266 3300049571 Ga0501034_0000042 Ga0501034_0000042_136229_137008 255
267 3300049571 Ga0501034_0475951 Ga0501034_0475951_298_1068 255
268 3300049579 Ga0501043_0211511 Ga0501043_0211511_691_1470 255
269 3300053080 Ga0500635_0002491 Ga0500635_0002491_3741_4508 255
270 3300053153 Ga0500616_0000089 Ga0500616_0000089_174377_175147 255
271 3300053155 Ga0500620_000492 Ga0500620_000492_6056_6838 255
272 iso_pu_bacteria 2808606700 2810365724 255
273 iso_pu_bacteria 2977228692 2977232022 255
274 iso_pu_bacteria 2977264416 2977267368 255
275 3300001979 JGI24740J21852_10003592 JGI24740J21852_100035924 256
276 3300005355 Ga0070671_100252459 Ga0070671_1002524592 256
277 3300005548 Ga0070665_100106261 Ga0070665_1001062612 256
278 3300005841 Ga0068863_100080417 Ga0068863_1000804172 256
279 3300006038 Ga0075365_10154944 Ga0075365_101549442 256
280 3300006048 Ga0075363_100024199 Ga0075363_1000241994 256
281 3300006051 Ga0075364_10041263 Ga0075364_100412631 256
282 3300006051 Ga0075364_10110375 Ga0075364_101103752 256
283 3300009098 Ga0105245_10138398 Ga0105245_101383981 256
284 3300009177 Ga0105248_10029944 Ga0105248_100299444 256
285 3300010375 Ga0105239_10745180 Ga0105239_107451802 256
286 3300013102 Ga0157371_10374929 Ga0157371_103749291 256
287 3300013104 Ga0157370_10017661 Ga0157370_100176618 256
288 3300013308 Ga0157375_10276421 Ga0157375_102764212 256
289 3300014326 Ga0157380_10060425 Ga0157380_100604252 256
290 3300025920 Ga0207649_10233067 Ga0207649_102330672 256
291 3300025927 Ga0207687_10146319 Ga0207687_101463192 256
292 3300025931 Ga0207644_10546557 Ga0207644_105465572 256
293 3300025941 Ga0207711_10014724 Ga0207711_100147242 256
294 3300025949 Ga0207667_10253539 Ga0207667_102535392 256
295 3300025949 Ga0207667_10373174 Ga0207667_103731742 256
296 3300026088 Ga0207641_10052081 Ga0207641_100520812 256
297 3300028794 Ga0307515_10035711 Ga0307515_100357119 256
298 3300031548 Ga0307408_100650194 Ga0307408_1006501941 256
299 3300031852 Ga0307410_10008415 Ga0307410_100084158 256
300 3300031901 Ga0307406_10000877 Ga0307406_100008778 256
301 3300031901 Ga0307406_10074867 Ga0307406_100748672 256
302 3300031901 Ga0307406_10109330 Ga0307406_101093302 256
303 3300031995 Ga0307409_100012003 Ga0307409_1000120034 256
304 3300032002 Ga0307416_100000911 Ga0307416_1000009118 256
305 3300037418 Ga0395900_0025053 Ga0395900_0025053_2697_3479 256
306 3300037466 Ga0395898_0177997 Ga0395898_0177997_735_1517 256
307 3300037471 Ga0395905_0152471 Ga0395905_0152471_1360_2142 256
308 3300041512 Ga0451853_0730806 Ga0451853_0730806_11_787 256
309 3300041512 Ga0451853_0813360 Ga0451853_0813360_772_1545 256
310 3300044658 Ga0466972_0049597 Ga0466972_0049597_852_1637 256
311 3300044658 Ga0466972_0068542 Ga0466972_0068542_498_1268 256
312 3300044765 Ga0466970_0000001 Ga0466970_0000001_23747_24532 256
313 3300046453 Ga0495627_000352 Ga0495627_000352_6534_7304 256
314 3300046453 Ga0495627_008037 Ga0495627_008037_1826_2596 256
315 3300046692 Ga0495671_0148395 Ga0495671_0148395_51_827 256
316 3300048915 Ga0496112_0089112 Ga0496112_0089112_543_1325 256
317 3300048917 Ga0496114_0031177 Ga0496114_0031177_3097_3882 256
318 3300048917 Ga0496114_0155542 Ga0496114_0155542_772_1569 256
319 3300048918 Ga0496115_0024793 Ga0496115_0024793_3117_3887 256
320 3300048925 Ga0496122_0033165 Ga0496122_0033165_2445_3224 256
321 3300048928 Ga0496125_0063564 Ga0496125_0063564_443_1213 256
322 3300048929 Ga0496126_0021928 Ga0496126_0021928_2656_3426 256
323 3300048929 Ga0496126_0026857 Ga0496126_0026857_2759_3529 256
324 3300048929 Ga0496126_0035873 Ga0496126_0035873_336_1106 256
325 3300049569 Ga0501032_0000526 Ga0501032_0000526_29274_30056 256
326 3300049571 Ga0501034_0007589 Ga0501034_0007589_2739_3509 256
327 3300049571 Ga0501034_0034554 Ga0501034_0034554_168_938 256
328 3300049571 Ga0501034_0073183 Ga0501034_0073183_2588_3361 256
329 3300049573 Ga0501037_0003986 Ga0501037_0003986_8027_8800 256
330 3300049573 Ga0501037_0018349 Ga0501037_0018349_1645_2427 256
331 3300049574 Ga0501038_0013508 Ga0501038_0013508_5791_6582 256
332 3300049574 Ga0501038_0014779 Ga0501038_0014779_5981_6754 256
333 3300049574 Ga0501038_0052801 Ga0501038_0052801_1391_2173 256
334 3300049574 Ga0501038_0070258 Ga0501038_0070258_946_1728 256
335 3300049575 Ga0501039_0011166 Ga0501039_0011166_4508_5290 256
336 3300049575 Ga0501039_0022320 Ga0501039_0022320_2634_3407 256
337 3300049575 Ga0501039_0055456 Ga0501039_0055456_1301_2083 256
338 3300049579 Ga0501043_0151673 Ga0501043_0151673_797_1570 256
339 3300049580 Ga0501046_0024093 Ga0501046_0024093_2764_3537 256
340 3300049581 Ga0501047_0019839 Ga0501047_0019839_3461_4234 256
341 3300049582 Ga0501048_0000826 Ga0501048_0000826_12613_13386 256
342 3300049584 Ga0501068_0038798 Ga0501068_0038798_2068_2841 256
343 3300049586 Ga0501070_0003400 Ga0501070_0003400_400_1170 256
344 3300049586 Ga0501070_0100236 Ga0501070_0100236_815_1588 256
345 3300049586 Ga0501070_0105404 Ga0501070_0105404_353_1135 256
346 3300049587 Ga0501071_0000493 Ga0501071_0000493_3083_3853 256
347 3300049589 Ga0501073_0012549 Ga0501073_0012549_4565_5338 256
348 3300049592 Ga0501076_0471853 Ga0501076_0471853_226_1002 256
349 3300049741 Ga0501079_0246817 Ga0501079_0246817_76_849 256
350 3300049742 Ga0501080_0617074 Ga0501080_0617074_43_819 256
351 3300049823 Ga0501044_0145772 Ga0501044_0145772_784_1557 256
352 3300050494 nmdc:mga06z11_87167_c1 nmdc:mga06z11_87167_c1_353_1123 256
353 3300050496 nmdc:mga07m45_42313_c1 nmdc:mga07m45_42313_c1_1713_2483 256
354 3300053093 Ga0500651_0000155 Ga0500651_0000155_4064_4837 256
355 3300053153 Ga0500616_0000010 Ga0500616_0000010_739080_739859 256
356 3300060353 Ga0501082_0267063 Ga0501082_0267063_73_846 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

16

270

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

21

240

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p5m-assembly1.cif.gz_F crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.91 2 256
3p5m-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.908 2 256
3p5m-assembly1.cif.gz_E crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9076 2 256
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9043 2 253
3p5m-assembly1.cif.gz_B crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9 2 256
ID Description Score Start End Superfamily
3p5mE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9077 2 178 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9062 1 196 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9018 1 196 3.90.226.10
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9011 2 196 3.90.226.10
4fzwD01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8995 1 196 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A351K4T8-F1-model_v4 Crotonase 0.9416 2 196 GO:0006635
AF-A0A3S0W511-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9223 2 256 GO:0016853
AF-A0A1T5GUA8-F1-model_v4 Enoyl-CoA hydratase 0.9157 2 248
AF-A0A4T0V4B7-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9107 2 247 GO:0006635
GO:0016853
AF-A0A3S0W511-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9087 2 256 GO:0016853

Feature Viewer

pLDDT pTM Quality
94.04 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map