F420623

General Info

Members Datasets Scaffolds Average Seq Length
356 239 327 352

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0068430|Ga0496105_0068430_639_1901
Length 420
Sequence MKAKKALRNVPLGGTLVMKCTDPLTVIDVPHFYNQAGHTLGAKQRRSEVNIFRILSSAETRRRVKESPSMNIQQQIRLSHLSHGGGCGCKLAPSVLQQLLSSQPTATPYKQLLVGLETGDDAAVWQLDNGTCVIATTDFFMPMVDDPHDFGRIAATNAISDVYAMGGTPIMALAILGMPVDKIPPEMVRRILEGGAAVCATAGIPVAGGHSIDSPEPIYGLAVIGTAPKANIRRNSDAQAGDKLILTKALGVGIYSAAFKKSALSREAYDEFIASTTLVNRIGAQLGEDPAVHAMTDVTGFGLLGHALEMARGSSKTVTIDAKCLPYLKDAVTLAQGGFITGASGRNWKSYDTSVELPAGTPEWQRQLFCDPQTSGGLLVACDPSRADELLKTIIAAGYPAARIVGHVTEGKARVLVESA

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
7 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
8 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
9 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
10 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
11 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
12 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
13 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
14 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
15 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
16 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
17 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
18 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
19 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
20 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
21 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
22 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
23 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
24 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
25 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
26 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
27 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
83 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
84 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 641522639 Methylobacterium sp. 4-46 Isolate Nodule
239 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.85
Metatranscriptomes 0
Isolates 8.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 3.93
Rhizoplane 23.31
Rhizosphere 58.99
Stem 0
Stem Tuber 0
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000056 3300003187 Bacteria 151555
2 JGI25406J46586_10035521 3300003203 Bacteria 1818
3 Ga0055526_1001952 3300003771 Bacteria 14256
4 Ga0055524_1000089 3300003775 Bacteria 115137
5 Ga0070670_100212239 3300005331 Bacteria 1683
6 Ga0070691_10094835 3300005341 Bacteria 1475
7 Ga0070668_100187241 3300005347 Bacteria 1694
8 Ga0070671_100040599 3300005355 Bacteria 3865
9 Ga0070671_100145230 3300005355 Bacteria 2002
10 Ga0070673_100152512 3300005364 Bacteria 1958
11 Ga0070673_100277152 3300005364 Bacteria 1470
12 Ga0070667_100106479 3300005367 Bacteria 2427
13 Ga0070709_10003505 3300005434 Bacteria 8425
14 Ga0070713_100015893 3300005436 Bacteria 5643
15 Ga0070713_100356226 3300005436 Bacteria 1359
16 Ga0070710_10057033 3300005437 Bacteria 2212
17 Ga0070710_10118492 3300005437 Bacteria 1599
18 Ga0070681_10005208 3300005458 Bacteria 12556
19 Ga0070679_100022817 3300005530 Bacteria 6121
20 Ga0070679_100128666 3300005530 Bacteria 2514
21 Ga0070686_100036839 3300005544 Bacteria 3031
22 Ga0070696_100097725 3300005546 Bacteria 2100
23 Ga0070693_100019097 3300005547 Bacteria 3588
24 Ga0070665_100060694 3300005548 Bacteria 3790
25 Ga0068855_100160037 3300005563 Bacteria 2556
26 Ga0070664_100107965 3300005564 Bacteria 2426
27 Ga0068854_100269227 3300005578 Bacteria 1367
28 Ga0068856_100092652 3300005614 Bacteria 3007
29 Ga0068856_100275432 3300005614 Bacteria 1699
30 Ga0070702_100012988 3300005615 Bacteria 4193
31 Ga0068866_10056276 3300005718 Bacteria 2023
32 Ga0068861_100188480 3300005719 Bacteria 1722
33 Ga0068863_100027807 3300005841 Bacteria 5398
34 Ga0068858_100000030 3300005842 Bacteria 144357
35 Ga0068858_100100670 3300005842 Bacteria 2695
36 Ga0068858_100295925 3300005842 Bacteria 1543
37 Ga0081455_10001343 3300005937 Bacteria 30466
38 Ga0081539_10002021 3300005985 Bacteria 30604
39 Ga0081539_10102517 3300005985 Bacteria 1456
40 Ga0070717_10003626 3300006028 Bacteria 11069
41 Ga0075365_10027116 3300006038 Bacteria 3642
42 Ga0075368_10002965 3300006042 Bacteria 5606
43 Ga0075367_10162844 3300006178 Bacteria 1387
44 Ga0097621_100063984 3300006237 Bacteria 3024
45 Ga0075428_100045191 3300006844 Bacteria 4839
46 Ga0075434_100101741 3300006871 Bacteria 2880
47 Ga0075435_100071229 3300007076 Bacteria 2838
48 Ga0105240_10003057 3300009093 Bacteria 26302
49 Ga0105240_10062959 3300009093 Bacteria 4617
50 Ga0105240_10072849 3300009093 Bacteria 4244
51 Ga0105240_10388298 3300009093 Bacteria 1575
52 Ga0105245_10092814 3300009098 Bacteria 2781
53 Ga0105245_10470541 3300009098 Bacteria 1268
54 Ga0105247_10061135 3300009101 Bacteria 2335
55 Ga0105247_10089909 3300009101 Bacteria 1947
56 Ga0114129_10039125 3300009147 Bacteria 6687
57 Ga0105243_10218556 3300009148 Bacteria 1683
58 Ga0105241_10008278 3300009174 Bacteria 7657
59 Ga0105248_10000097 3300009177 Bacteria 97424
60 Ga0105248_10249709 3300009177 Bacteria 1997
61 Ga0105248_10496482 3300009177 Bacteria 1376
62 Ga0105237_10143293 3300009545 Bacteria 2384
63 Ga0105246_10073012 3300011119 Bacteria 2421
64 Ga0157369_10086714 3300013105 Bacteria 3343
65 Ga0171463_1002 3300013249 Bacteria 1274851
66 Ga0157374_10141495 3300013296 Bacteria 2336
67 Ga0157378_10388653 3300013297 Bacteria 1372
68 Ga0163163_10012541 3300014325 Bacteria 7729
69 Ga0163163_10079787 3300014325 Bacteria 3271
70 Ga0163163_10600429 3300014325 Bacteria 1164
71 Ga0157377_10078782 3300014745 Bacteria 1921
72 Ga0157379_10176122 3300014968 Bacteria 1931
73 Ga0157379_10291137 3300014968 Bacteria 1487
74 Ga0183363_1037 3300015690 Bacteria 44345
75 Ga0214542_1016209 3300021321 Bacteria 7336
76 Ga0214543_1000018 3300021327 Bacteria 272335
77 Ga0213876_10058992 3300021384 Bacteria 2026
78 Ga0213876_10122804 3300021384 Bacteria 1379
79 Ga0209673_1009486 3300025273 Bacteria 4205
80 Ga0209675_1017786 3300025291 Bacteria 2017
81 Ga0209676_1019000 3300025292 Bacteria 2377
82 Ga0209025_1000016 3300025294 Bacteria 770739
83 Ga0209564_1000035 3300025295 Bacteria 442446
84 Ga0209564_1000075 3300025295 Bacteria 285760
85 Ga0209256_1000025 3300025299 Bacteria 442449
86 Ga0207692_10002896 3300025898 Bacteria 6644
87 Ga0207710_10024072 3300025900 Bacteria 2621
88 Ga0207680_10024078 3300025903 Bacteria 3335
89 Ga0207647_10146121 3300025904 Bacteria 1384
90 Ga0207699_10000754 3300025906 Bacteria 15470
91 Ga0207643_10016528 3300025908 Bacteria 4026
92 Ga0207695_10062449 3300025913 Bacteria 3845
93 Ga0207695_10065275 3300025913 Bacteria 3743
94 Ga0207695_10103405 3300025913 Bacteria 2840
95 Ga0207671_10190998 3300025914 Bacteria 1597
96 Ga0207693_10020117 3300025915 Bacteria 5309
97 Ga0207652_10453234 3300025921 Bacteria 1156
98 Ga0207694_10278337 3300025924 Bacteria 1374
99 Ga0207650_10102890 3300025925 Bacteria 2201
100 Ga0207650_10177145 3300025925 Bacteria 1698
101 Ga0207687_10189398 3300025927 Bacteria 1600
102 Ga0207700_10001387 3300025928 Bacteria 13762
103 Ga0207644_10032822 3300025931 Bacteria 3625
104 Ga0207690_10118739 3300025932 Bacteria 1917
105 Ga0207709_10236693 3300025935 Bacteria 1326
106 Ga0207670_10252873 3300025936 Bacteria 1363
107 Ga0207711_10002325 3300025941 Bacteria 17032
108 Ga0207711_10115218 3300025941 Bacteria 2395
109 Ga0207711_10491216 3300025941 Bacteria 1144
110 Ga0207661_10025079 3300025944 Bacteria 4529
111 Ga0207679_10298483 3300025945 Bacteria 1388
112 Ga0207667_10210428 3300025949 Bacteria 1993
113 Ga0207651_10182522 3300025960 Bacteria 1666
114 Ga0207712_10052248 3300025961 Bacteria 2862
115 Ga0207658_10067109 3300025986 Bacteria 2701
116 Ga0207703_10076247 3300026035 Bacteria 2781
117 Ga0207678_10010394 3300026067 Bacteria 8169
118 Ga0207678_10299710 3300026067 Bacteria 1381
119 Ga0207702_10252453 3300026078 Bacteria 1657
120 Ga0207641_10074142 3300026088 Bacteria 2935
121 Ga0207641_10201692 3300026088 Bacteria 1834
122 Ga0207676_10050983 3300026095 Bacteria 3229
123 Ga0207676_10099914 3300026095 Bacteria 2402
124 Ga0207676_10294134 3300026095 Bacteria 1480
125 Ga0207674_10148836 3300026116 Bacteria 2299
126 Ga0207675_100057701 3300026118 Bacteria 3622
127 Ga0207683_10052914 3300026121 Bacteria 3558
128 Ga0207683_10238478 3300026121 Bacteria 1659
129 Ga0209813_10001073 3300027866 Bacteria 6141
130 Ga0268266_10052788 3300028379 Bacteria 3491
131 Ga0307517_10017257 3300028786 Bacteria 9422
132 Ga0265325_10000488 3300031241 Bacteria 28779
133 Ga0265325_10016920 3300031241 Bacteria 4065
134 Ga0265339_10001333 3300031249 Bacteria 18457
135 Ga0307513_10006613 3300031456 Bacteria 15133
136 Ga0265313_10001139 3300031595 Bacteria 25409
137 Ga0307406_10141818 3300031901 Bacteria 1702
138 Ga0373950_0008451 3300034818 Bacteria 1621
139 Ga0373938_0007515 3300034957 Bacteria 1920
140 Ga0373944_0004956 3300035089 Bacteria 3490
141 Ga0373949_0004979 3300035090 Bacteria 2997
142 Ga0373952_0011752 3300035092 Bacteria 1712
143 Ga0373932_0004356 3300035112 Bacteria 3355
144 Ga0373936_0008074 3300035113 Bacteria 3956
145 Ga0373939_0005692 3300035114 Bacteria 2971
146 Ga0373941_0025106 3300035115 Bacteria 1718
147 Ga0373943_0001686 3300035170 Bacteria 10030
148 Ga0373961_0009940 3300035241 Bacteria 2336
149 Ga0373931_0016144 3300035691 Bacteria 3671
150 Ga0373935_0100479 3300035692 Bacteria 1906
151 Ga0373927_0010181 3300035695 Bacteria 6285
152 Ga0373947_0000637 3300035725 Bacteria 20738
153 Ga0373947_0003691 3300035725 Bacteria 9033
154 Ga0373925_0001898 3300037068 Bacteria 17358
155 Ga0373925_0016757 3300037068 Bacteria 5307
156 Ga0395898_0100710 3300037466 Bacteria 2775
157 Ga0436364_1549833 3300037853 Bacteria 22971
158 Ga0436365_0603044 3300039437 Bacteria 2946
159 Ga0436365_1793704 3300039437 Bacteria 2353
160 Ga0436360_1281072 3300039438 Bacteria 1799
161 Ga0436363_0121193 3300039450 Bacteria 3562
162 Ga0495603_0006638 3300046455 Bacteria 6941
163 Ga0495629_0001003 3300046459 Bacteria 22634
164 Ga0495653_0040997 3300046463 Bacteria 3616
165 Ga0495639_0024392 3300046475 Bacteria 2663
166 Ga0495662_0027987 3300046476 Bacteria 2721
167 Ga0495664_0006670 3300046477 Bacteria 6382
168 Ga0495607_0032474 3300046501 Bacteria 3186
169 Ga0495610_0021626 3300046512 Bacteria 3532
170 Ga0495618_0017785 3300046514 Bacteria 4363
171 Ga0495618_0019143 3300046514 Bacteria 4209
172 Ga0495630_0002728 3300046517 Bacteria 12241
173 Ga0495630_0006255 3300046517 Bacteria 8451
174 Ga0495652_0029800 3300046529 Bacteria 4790
175 Ga0495665_0010367 3300046531 Bacteria 5044
176 Ga0495665_0016721 3300046531 Bacteria 3950
177 Ga0495640_0023949 3300046533 Bacteria 4441
178 Ga0495640_0038614 3300046533 Bacteria 3357
179 Ga0495586_0006002 3300046535 Bacteria 6495
180 Ga0495645_0001366 3300046543 Bacteria 16488
181 Ga0495633_0018403 3300046558 Bacteria 3549
182 Ga0495656_0016081 3300046615 Bacteria 2835
183 Ga0495668_0030741 3300046616 Bacteria 3030
184 Ga0495634_0007982 3300046642 Bacteria 7894
185 Ga0495634_0068097 3300046642 Bacteria 2352
186 Ga0495634_0180313 3300046642 Bacteria 1322
187 Ga0495611_0012755 3300046648 Bacteria 3572
188 Ga0495635_0033048 3300046663 Bacteria 3589
189 Ga0495635_0035643 3300046663 Bacteria 3449
190 Ga0495659_0008115 3300046664 Bacteria 3337
191 Ga0495659_0032972 3300046664 Bacteria 1816
192 Ga0495661_0039881 3300046665 Bacteria 2916
193 Ga0495599_0097704 3300046678 Bacteria 1831
194 Ga0495646_0109498 3300046680 Bacteria 1574
195 Ga0495647_0068329 3300046681 Bacteria 1417
196 Ga0495658_0000814 3300046683 Bacteria 16758
197 Ga0495613_0046196 3300046689 Bacteria 3220
198 Ga0495624_0000746 3300046690 Bacteria 25580
199 Ga0495624_0081212 3300046690 Bacteria 2008
200 Ga0495670_0004716 3300046691 Bacteria 6693
201 Ga0495581_0005157 3300047315 Bacteria 7561
202 Ga0495581_0078320 3300047315 Bacteria 1913
203 Ga0495674_0010520 3300047319 Bacteria 8757
204 Ga0495672_0050632 3300047320 Bacteria 2450
205 Ga0495672_0114511 3300047320 Bacteria 1442
206 Ga0495676_0040563 3300047321 Bacteria 3840
207 Ga0495680_0038986 3300047322 Bacteria 3794
208 Ga0495684_0016415 3300047471 Bacteria 5702
209 Ga0495684_0017452 3300047471 Bacteria 5526
210 Ga0495684_0022445 3300047471 Bacteria 4855
211 Ga0495593_0038840 3300047673 Bacteria 2570
212 Ga0496100_0009257 3300048903 Bacteria 5530
213 Ga0496100_0082578 3300048903 Bacteria 2173
214 Ga0496100_0105208 3300048903 Bacteria 1951
215 Ga0496101_0006179 3300048904 Bacteria 7698
216 Ga0496101_0079642 3300048904 Bacteria 2418
217 Ga0496101_0122186 3300048904 Bacteria 1969
218 Ga0496101_0169351 3300048904 Bacteria 1678
219 Ga0496101_0209863 3300048904 Bacteria 1508
220 Ga0496101_0243685 3300048904 Bacteria 1399
221 Ga0496102_0012013 3300048905 Bacteria 7481
222 Ga0496102_0028037 3300048905 Bacteria 5031
223 Ga0496102_0151197 3300048905 Bacteria 2181
224 Ga0496102_0333104 3300048905 Bacteria 1429
225 Ga0496102_0424076 3300048905 Bacteria 1249
226 Ga0496103_0011558 3300048906 Bacteria 5234
227 Ga0496103_0026325 3300048906 Bacteria 3522
228 Ga0496103_0042048 3300048906 Bacteria 2811
229 Ga0496103_0066051 3300048906 Bacteria 2257
230 Ga0496104_0000509 3300048907 Bacteria 33320
231 Ga0496104_0001104 3300048907 Bacteria 23081
232 Ga0496104_0010728 3300048907 Bacteria 8193
233 Ga0496104_0013494 3300048907 Bacteria 7361
234 Ga0496104_0019126 3300048907 Bacteria 6261
235 Ga0496104_0090383 3300048907 Bacteria 2925
236 Ga0496104_0090531 3300048907 Bacteria 2923
237 Ga0496104_0200600 3300048907 Bacteria 1907
238 Ga0496105_0000091 3300048908 Bacteria 63179
239 Ga0496105_0001830 3300048908 Bacteria 15229
240 Ga0496105_0031696 3300048908 Bacteria 4334
241 Ga0496105_0068430 3300048908 Bacteria 2933
242 Ga0496105_0163691 3300048908 Bacteria 1825
243 Ga0496106_0010096 3300048909 Bacteria 6975
244 Ga0496106_0045775 3300048909 Bacteria 3287
245 Ga0496106_0050920 3300048909 Bacteria 3122
246 Ga0496106_0093052 3300048909 Bacteria 2329
247 Ga0496107_0006038 3300048910 Bacteria 8308
248 Ga0496107_0055195 3300048910 Bacteria 2869
249 Ga0496107_0062740 3300048910 Bacteria 2692
250 Ga0496107_0087013 3300048910 Bacteria 2281
251 Ga0496108_0012112 3300048911 Bacteria 7011
252 Ga0496108_0037275 3300048911 Bacteria 4048
253 Ga0496108_0060373 3300048911 Bacteria 3190
254 Ga0496108_0283699 3300048911 Bacteria 1441
255 Ga0496109_0014640 3300048912 Bacteria 6823
256 Ga0496109_0027301 3300048912 Bacteria 5095
257 Ga0496109_0032835 3300048912 Bacteria 4668
258 Ga0496109_0039456 3300048912 Bacteria 4273
259 Ga0496109_0041803 3300048912 Bacteria 4152
260 Ga0496110_0002143 3300048913 Bacteria 14755
261 Ga0496110_0017561 3300048913 Bacteria 5983
262 Ga0496110_0027856 3300048913 Bacteria 4848
263 Ga0496110_0032441 3300048913 Bacteria 4511
264 Ga0496110_0046220 3300048913 Bacteria 3808
265 Ga0496110_0448015 3300048913 Bacteria 1176
266 Ga0496111_0018836 3300048914 Bacteria 4785
267 Ga0496111_0037225 3300048914 Bacteria 3482
268 Ga0496111_0057723 3300048914 Bacteria 2810
269 Ga0496111_0339259 3300048914 Bacteria 1112
270 Ga0496112_0012219 3300048915 Bacteria 7882
271 Ga0496112_0016738 3300048915 Bacteria 6876
272 Ga0496112_0092748 3300048915 Bacteria 2989
273 Ga0496112_0186153 3300048915 Bacteria 2039
274 Ga0496112_0189896 3300048915 Bacteria 2016
275 Ga0496113_0003675 3300048916 Bacteria 9235
276 Ga0496113_0017521 3300048916 Bacteria 4973
277 Ga0496113_0022678 3300048916 Bacteria 4445
278 Ga0496113_0046359 3300048916 Bacteria 3226
279 Ga0496113_0128211 3300048916 Bacteria 1988
280 Ga0496114_0004934 3300048917 Bacteria 10398
281 Ga0496114_0048647 3300048917 Bacteria 3527
282 Ga0496114_0083368 3300048917 Bacteria 2705
283 Ga0496114_0093614 3300048917 Bacteria 2555
284 Ga0496114_0222865 3300048917 Bacteria 1656
285 Ga0496114_0477163 3300048917 Bacteria 1103
286 Ga0496115_0000831 3300048918 Bacteria 22564
287 Ga0496115_0028964 3300048918 Bacteria 4345
288 Ga0496115_0046239 3300048918 Bacteria 3477
289 Ga0496115_0054597 3300048918 Bacteria 3208
290 Ga0496115_0071102 3300048918 Bacteria 2822
291 Ga0496115_0108463 3300048918 Bacteria 2279
292 Ga0496115_0236867 3300048918 Bacteria 1504
293 Ga0496119_0006674 3300048922 Bacteria 10613
294 Ga0496122_0006800 3300048925 Bacteria 12989
295 Ga0496123_0000625 3300048926 Bacteria 59349
296 Ga0496125_0128551 3300048928 Bacteria 1789
297 Ga0496125_0180643 3300048928 Bacteria 1406
298 Ga0496126_0249373 3300048929 Bacteria 1480
299 Ga0501034_0132298 3300049571 Bacteria 2477
300 Ga0501036_0011963 3300049572 Bacteria 7194
301 Ga0501037_0003797 3300049573 Bacteria 10958
302 Ga0501038_0005823 3300049574 Bacteria 11408
303 Ga0501043_0023065 3300049579 Bacteria 4882
304 Ga0501047_0012686 3300049581 Bacteria 7982
305 Ga0501072_0142106 3300049588 Bacteria 1914
306 Ga0501075_0004943 3300049591 Bacteria 9091
307 Ga0501079_0045742 3300049741 Bacteria 3378
308 Ga0501080_0009594 3300049742 Bacteria 8836
309 Ga0501081_0007181 3300049743 Bacteria 7245
310 Ga0501044_0300041 3300049823 Bacteria 1535
311 nmdc:mga03n38_3394_c1 3300050490 Bacteria 5105
312 nmdc:mga00v17_240_c1 3300050491 Bacteria 32452
313 nmdc:mga0yw44_143878_c1 3300050492 Bacteria 1551
314 nmdc:mga06z11_10626_c1 3300050494 Bacteria 3932
315 nmdc:mga04h51_1885_c1 3300050495 Bacteria 4891
316 nmdc:mga05p37_42468_c1 3300050507 Bacteria 5587
317 nmdc:mga0n895_77958_c1 3300050512 Bacteria 3297
318 nmdc:mga0rr50_8030_c1 3300050513 Bacteria 6546
319 Ga0495619_0002910 3300053085 Bacteria 11125
320 Ga0495619_0021183 3300053085 Bacteria 4148
321 Ga0495619_0026177 3300053085 Bacteria 3752
322 Ga0500556_0000327 3300053104 Bacteria 35744
323 Ga0500642_0000005 3300053130 Bacteria 422725
324 Ga0500616_0041708 3300053153 Bacteria 2461
325 Ga0500645_005405 3300053730 Bacteria 4707
326 Ga0501082_0000038 3300060353 Bacteria 94168
327 Ga0501082_0250187 3300060353 Bacteria 1542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221574 2643882779 338
2 3300046512 Ga0495610_0021626 Ga0495610_0021626_2264_3310 341
3 3300028786 Ga0307517_10017257 Ga0307517_100172575 342
4 iso_pu_bacteria 2508501114 2509075825 344
5 iso_pu_bacteria 2509276019 2509378360 344
6 iso_pu_bacteria 2513237087 2513590843 344
7 iso_pu_bacteria 2545555834 2545672372 344
8 iso_pu_bacteria 2558860100 2558861742 344
9 iso_pu_bacteria 2595698237 2596374676 344
10 iso_pu_bacteria 2828305725 2828307019 344
11 iso_pu_bacteria 2835312727 2835316118 344
12 iso_pu_bacteria 2840764183 2840766046 344
13 iso_pu_bacteria 2850079185 2850084210 344
14 iso_pu_bacteria 2889306138 2889307531 344
15 iso_pu_bacteria 641522639 641646214 344
16 iso_pu_bacteria 2643221547 2643754801 345
17 iso_pu_bacteria 2838074704 2838077969 345
18 iso_pu_bacteria 2896384573 2896388511 345
19 iso_pu_bacteria 2915650412 2915654516 345
20 iso_pu_bacteria 2920760137 2920764603 345
21 iso_pu_bacteria 2920822456 2920827171 345
22 3300005437 Ga0070710_10118492 Ga0070710_101184922 346
23 3300005937 Ga0081455_10001343 Ga0081455_1000134322 346
24 3300009177 Ga0105248_10000097 Ga0105248_1000009729 346
25 3300021321 Ga0214542_1016209 Ga0214542_10162093 346
26 3300021327 Ga0214543_1000018 Ga0214543_100001855 346
27 3300025941 Ga0207711_10002325 Ga0207711_100023255 346
28 iso_pu_bacteria 2508501122 2509110020 346
29 iso_pu_bacteria 2513237138 2513867730 346
30 iso_pu_bacteria 2513237144 2513912175 346
31 iso_pu_bacteria 2751185821 2753460210 346
32 iso_pu_bacteria 2765235802 2765466759 346
33 iso_pu_bacteria 2767802442 2770197540 346
34 iso_pu_bacteria 2791355082 2792581852 346
35 iso_pu_bacteria 2904578770 2904581713 346
36 iso_pu_bacteria 2919119836 2919123378 346
37 iso_pu_bacteria 8049293176 8049294874 346
38 3300003203 JGI25406J46586_10035521 JGI25406J46586_100355211 348
39 3300005331 Ga0070670_100212239 Ga0070670_1002122391 348
40 3300005347 Ga0070668_100187241 Ga0070668_1001872411 348
41 3300005355 Ga0070671_100145230 Ga0070671_1001452304 348
42 3300005364 Ga0070673_100152512 Ga0070673_1001525122 348
43 3300005364 Ga0070673_100277152 Ga0070673_1002771522 348
44 3300005367 Ga0070667_100106479 Ga0070667_1001064792 348
45 3300005434 Ga0070709_10003505 Ga0070709_100035058 348
46 3300005436 Ga0070713_100015893 Ga0070713_1000158936 348
47 3300005436 Ga0070713_100356226 Ga0070713_1003562262 348
48 3300005437 Ga0070710_10057033 Ga0070710_100570333 348
49 3300005458 Ga0070681_10005208 Ga0070681_100052083 348
50 3300005530 Ga0070679_100128666 Ga0070679_1001286662 348
51 3300005544 Ga0070686_100036839 Ga0070686_1000368393 348
52 3300005546 Ga0070696_100097725 Ga0070696_1000977252 348
53 3300005547 Ga0070693_100019097 Ga0070693_1000190972 348
54 3300005548 Ga0070665_100060694 Ga0070665_1000606944 348
55 3300005564 Ga0070664_100107965 Ga0070664_1001079654 348
56 3300005614 Ga0068856_100092652 Ga0068856_1000926522 348
57 3300005614 Ga0068856_100275432 Ga0068856_1002754322 348
58 3300005615 Ga0070702_100012988 Ga0070702_1000129882 348
59 3300005718 Ga0068866_10056276 Ga0068866_100562762 348
60 3300005719 Ga0068861_100188480 Ga0068861_1001884803 348
61 3300005841 Ga0068863_100027807 Ga0068863_1000278073 348
62 3300005842 Ga0068858_100000030 Ga0068858_10000003049 348
63 3300005842 Ga0068858_100100670 Ga0068858_1001006703 348
64 3300005842 Ga0068858_100295925 Ga0068858_1002959251 348
65 3300005985 Ga0081539_10002021 Ga0081539_100020211 348
66 3300006028 Ga0070717_10003626 Ga0070717_100036268 348
67 3300006038 Ga0075365_10027116 Ga0075365_100271163 348
68 3300006042 Ga0075368_10002965 Ga0075368_100029655 348
69 3300006178 Ga0075367_10162844 Ga0075367_101628442 348
70 3300006237 Ga0097621_100063984 Ga0097621_1000639841 348
71 3300006844 Ga0075428_100045191 Ga0075428_1000451911 348
72 3300006871 Ga0075434_100101741 Ga0075434_1001017414 348
73 3300007076 Ga0075435_100071229 Ga0075435_1000712293 348
74 3300009098 Ga0105245_10092814 Ga0105245_100928142 348
75 3300009098 Ga0105245_10470541 Ga0105245_104705411 348
76 3300009101 Ga0105247_10061135 Ga0105247_100611351 348
77 3300009101 Ga0105247_10089909 Ga0105247_100899091 348
78 3300009147 Ga0114129_10039125 Ga0114129_100391252 348
79 3300009148 Ga0105243_10218556 Ga0105243_102185563 348
80 3300009174 Ga0105241_10008278 Ga0105241_100082782 348
81 3300009177 Ga0105248_10249709 Ga0105248_102497091 348
82 3300009177 Ga0105248_10496482 Ga0105248_104964821 348
83 3300009545 Ga0105237_10143293 Ga0105237_101432932 348
84 3300011119 Ga0105246_10073012 Ga0105246_100730122 348
85 3300013105 Ga0157369_10086714 Ga0157369_100867144 348
86 3300013296 Ga0157374_10141495 Ga0157374_101414954 348
87 3300013297 Ga0157378_10388653 Ga0157378_103886531 348
88 3300014325 Ga0163163_10012541 Ga0163163_100125418 348
89 3300014325 Ga0163163_10600429 Ga0163163_106004291 348
90 3300014745 Ga0157377_10078782 Ga0157377_100787823 348
91 3300014968 Ga0157379_10176122 Ga0157379_101761221 348
92 3300014968 Ga0157379_10291137 Ga0157379_102911371 348
93 3300021384 Ga0213876_10058992 Ga0213876_100589921 348
94 3300021384 Ga0213876_10122804 Ga0213876_101228041 348
95 3300025898 Ga0207692_10002896 Ga0207692_100028968 348
96 3300025900 Ga0207710_10024072 Ga0207710_100240724 348
97 3300025903 Ga0207680_10024078 Ga0207680_100240784 348
98 3300025904 Ga0207647_10146121 Ga0207647_101461212 348
99 3300025906 Ga0207699_10000754 Ga0207699_1000075415 348
100 3300025908 Ga0207643_10016528 Ga0207643_100165283 348
101 3300025914 Ga0207671_10190998 Ga0207671_101909981 348
102 3300025915 Ga0207693_10020117 Ga0207693_100201176 348
103 3300025921 Ga0207652_10453234 Ga0207652_104532341 348
104 3300025924 Ga0207694_10278337 Ga0207694_102783373 348
105 3300025925 Ga0207650_10102890 Ga0207650_101028902 348
106 3300025925 Ga0207650_10177145 Ga0207650_101771451 348
107 3300025927 Ga0207687_10189398 Ga0207687_101893981 348
108 3300025928 Ga0207700_10001387 Ga0207700_100013879 348
109 3300025932 Ga0207690_10118739 Ga0207690_101187392 348
110 3300025935 Ga0207709_10236693 Ga0207709_102366932 348
111 3300025936 Ga0207670_10252873 Ga0207670_102528731 348
112 3300025941 Ga0207711_10115218 Ga0207711_101152182 348
113 3300025941 Ga0207711_10491216 Ga0207711_104912161 348
114 3300025944 Ga0207661_10025079 Ga0207661_100250795 348
115 3300025945 Ga0207679_10298483 Ga0207679_102984831 348
116 3300025960 Ga0207651_10182522 Ga0207651_101825222 348
117 3300025961 Ga0207712_10052248 Ga0207712_100522484 348
118 3300025986 Ga0207658_10067109 Ga0207658_100671093 348
119 3300026035 Ga0207703_10076247 Ga0207703_100762472 348
120 3300026067 Ga0207678_10010394 Ga0207678_100103946 348
121 3300026067 Ga0207678_10299710 Ga0207678_102997102 348
122 3300026078 Ga0207702_10252453 Ga0207702_102524532 348
123 3300026088 Ga0207641_10201692 Ga0207641_102016922 348
124 3300026095 Ga0207676_10050983 Ga0207676_100509831 348
125 3300026095 Ga0207676_10099914 Ga0207676_100999142 348
126 3300026095 Ga0207676_10294134 Ga0207676_102941341 348
127 3300026116 Ga0207674_10148836 Ga0207674_101488362 348
128 3300026118 Ga0207675_100057701 Ga0207675_1000577014 348
129 3300026121 Ga0207683_10052914 Ga0207683_100529144 348
130 3300026121 Ga0207683_10238478 Ga0207683_102384782 348
131 3300027866 Ga0209813_10001073 Ga0209813_100010735 348
132 3300028379 Ga0268266_10052788 Ga0268266_100527883 348
133 3300031241 Ga0265325_10000488 Ga0265325_1000048826 348
134 3300031241 Ga0265325_10016920 Ga0265325_100169202 348
135 3300031249 Ga0265339_10001333 Ga0265339_100013332 348
136 3300031595 Ga0265313_10001139 Ga0265313_1000113914 348
137 3300034818 Ga0373950_0008451 Ga0373950_0008451_514_1569 348
138 3300034957 Ga0373938_0007515 Ga0373938_0007515_677_1732 348
139 3300035089 Ga0373944_0004956 Ga0373944_0004956_1800_2849 348
140 3300035090 Ga0373949_0004979 Ga0373949_0004979_52_1107 348
141 3300035092 Ga0373952_0011752 Ga0373952_0011752_30_1085 348
142 3300035112 Ga0373932_0004356 Ga0373932_0004356_622_1677 348
143 3300035113 Ga0373936_0008074 Ga0373936_0008074_1724_2773 348
144 3300035114 Ga0373939_0005692 Ga0373939_0005692_83_1138 348
145 3300035115 Ga0373941_0025106 Ga0373941_0025106_617_1672 348
146 3300035170 Ga0373943_0001686 Ga0373943_0001686_1589_2638 348
147 3300035241 Ga0373961_0009940 Ga0373961_0009940_624_1679 348
148 3300035691 Ga0373931_0016144 Ga0373931_0016144_546_1601 348
149 3300035692 Ga0373935_0100479 Ga0373935_0100479_713_1768 348
150 3300035695 Ga0373927_0010181 Ga0373927_0010181_3764_4813 348
151 3300035725 Ga0373947_0000637 Ga0373947_0000637_2476_3531 348
152 3300035725 Ga0373947_0003691 Ga0373947_0003691_6310_7359 348
153 3300037068 Ga0373925_0001898 Ga0373925_0001898_7723_8772 348
154 3300037068 Ga0373925_0016757 Ga0373925_0016757_674_1729 348
155 3300037466 Ga0395898_0100710 Ga0395898_0100710_707_1765 348
156 3300039437 Ga0436365_0603044 Ga0436365_0603044_1273_2322 348
157 3300039437 Ga0436365_1793704 Ga0436365_1793704_1283_2332 348
158 3300039438 Ga0436360_1281072 Ga0436360_1281072_57_1106 348
159 3300039450 Ga0436363_0121193 Ga0436363_0121193_1299_2348 348
160 3300046455 Ga0495603_0006638 Ga0495603_0006638_3736_4791 348
161 3300046459 Ga0495629_0001003 Ga0495629_0001003_7592_8647 348
162 3300046463 Ga0495653_0040997 Ga0495653_0040997_935_1984 348
163 3300046475 Ga0495639_0024392 Ga0495639_0024392_434_1489 348
164 3300046476 Ga0495662_0027987 Ga0495662_0027987_1134_2183 348
165 3300046477 Ga0495664_0006670 Ga0495664_0006670_4913_5962 348
166 3300046501 Ga0495607_0032474 Ga0495607_0032474_201_1256 348
167 3300046514 Ga0495618_0017785 Ga0495618_0017785_2912_3961 348
168 3300046514 Ga0495618_0019143 Ga0495618_0019143_1948_2997 348
169 3300046517 Ga0495630_0002728 Ga0495630_0002728_5931_6980 348
170 3300046517 Ga0495630_0006255 Ga0495630_0006255_6963_8012 348
171 3300046529 Ga0495652_0029800 Ga0495652_0029800_3083_4132 348
172 3300046531 Ga0495665_0010367 Ga0495665_0010367_1429_2478 348
173 3300046531 Ga0495665_0016721 Ga0495665_0016721_2315_3364 348
174 3300046533 Ga0495640_0023949 Ga0495640_0023949_1021_2070 348
175 3300046533 Ga0495640_0038614 Ga0495640_0038614_1038_2087 348
176 3300046535 Ga0495586_0006002 Ga0495586_0006002_1864_2913 348
177 3300046543 Ga0495645_0001366 Ga0495645_0001366_5419_6468 348
178 3300046558 Ga0495633_0018403 Ga0495633_0018403_1885_2940 348
179 3300046615 Ga0495656_0016081 Ga0495656_0016081_695_1750 348
180 3300046642 Ga0495634_0007982 Ga0495634_0007982_4898_5947 348
181 3300046642 Ga0495634_0068097 Ga0495634_0068097_418_1467 348
182 3300046642 Ga0495634_0180313 Ga0495634_0180313_218_1267 348
183 3300046663 Ga0495635_0033048 Ga0495635_0033048_178_1227 348
184 3300046663 Ga0495635_0035643 Ga0495635_0035643_1185_2234 348
185 3300046664 Ga0495659_0008115 Ga0495659_0008115_2170_3225 348
186 3300046664 Ga0495659_0032972 Ga0495659_0032972_50_1096 348
187 3300046665 Ga0495661_0039881 Ga0495661_0039881_1686_2741 348
188 3300046678 Ga0495599_0097704 Ga0495599_0097704_36_1085 348
189 3300046680 Ga0495646_0109498 Ga0495646_0109498_242_1291 348
190 3300046681 Ga0495647_0068329 Ga0495647_0068329_89_1138 348
191 3300046683 Ga0495658_0000814 Ga0495658_0000814_14648_15703 348
192 3300046689 Ga0495613_0046196 Ga0495613_0046196_1072_2127 348
193 3300046690 Ga0495624_0000746 Ga0495624_0000746_16923_17972 348
194 3300046690 Ga0495624_0081212 Ga0495624_0081212_848_1897 348
195 3300046691 Ga0495670_0004716 Ga0495670_0004716_4445_5500 348
196 3300047315 Ga0495581_0005157 Ga0495581_0005157_3787_4836 348
197 3300047315 Ga0495581_0078320 Ga0495581_0078320_704_1759 348
198 3300047319 Ga0495674_0010520 Ga0495674_0010520_2378_3427 348
199 3300047320 Ga0495672_0114511 Ga0495672_0114511_270_1319 348
200 3300047321 Ga0495676_0040563 Ga0495676_0040563_263_1312 348
201 3300047322 Ga0495680_0038986 Ga0495680_0038986_2190_3245 348
202 3300047471 Ga0495684_0016415 Ga0495684_0016415_4397_5446 348
203 3300047471 Ga0495684_0017452 Ga0495684_0017452_3207_4256 348
204 3300047471 Ga0495684_0022445 Ga0495684_0022445_1187_2236 348
205 3300047673 Ga0495593_0038840 Ga0495593_0038840_1475_2524 348
206 3300048903 Ga0496100_0009257 Ga0496100_0009257_4453_5508 348
207 3300048903 Ga0496100_0082578 Ga0496100_0082578_280_1329 348
208 3300048903 Ga0496100_0105208 Ga0496100_0105208_612_1670 348
209 3300048904 Ga0496101_0006179 Ga0496101_0006179_3961_5016 348
210 3300048904 Ga0496101_0079642 Ga0496101_0079642_199_1254 348
211 3300048904 Ga0496101_0122186 Ga0496101_0122186_838_1887 348
212 3300048904 Ga0496101_0169351 Ga0496101_0169351_23_1078 348
213 3300048904 Ga0496101_0209863 Ga0496101_0209863_353_1399 348
214 3300048904 Ga0496101_0243685 Ga0496101_0243685_206_1264 348
215 3300048905 Ga0496102_0012013 Ga0496102_0012013_1751_2800 348
216 3300048905 Ga0496102_0028037 Ga0496102_0028037_3057_4112 348
217 3300048905 Ga0496102_0151197 Ga0496102_0151197_516_1562 348
218 3300048905 Ga0496102_0333104 Ga0496102_0333104_202_1257 348
219 3300048905 Ga0496102_0424076 Ga0496102_0424076_104_1159 348
220 3300048906 Ga0496103_0011558 Ga0496103_0011558_2972_4027 348
221 3300048906 Ga0496103_0026325 Ga0496103_0026325_2188_3237 348
222 3300048906 Ga0496103_0042048 Ga0496103_0042048_1211_2266 348
223 3300048906 Ga0496103_0066051 Ga0496103_0066051_700_1746 348
224 3300048907 Ga0496104_0001104 Ga0496104_0001104_8880_9929 348
225 3300048907 Ga0496104_0010728 Ga0496104_0010728_72_1127 348
226 3300048907 Ga0496104_0019126 Ga0496104_0019126_174_1232 348
227 3300048907 Ga0496104_0090531 Ga0496104_0090531_1780_2835 348
228 3300048907 Ga0496104_0200600 Ga0496104_0200600_83_1132 348
229 3300048908 Ga0496105_0068430 Ga0496105_0068430_639_1901 348
230 3300048908 Ga0496105_0163691 Ga0496105_0163691_72_1127 348
231 3300048909 Ga0496106_0010096 Ga0496106_0010096_2999_4054 348
232 3300048909 Ga0496106_0045775 Ga0496106_0045775_1761_2810 348
233 3300048909 Ga0496106_0050920 Ga0496106_0050920_879_1934 348
234 3300048909 Ga0496106_0093052 Ga0496106_0093052_1244_2299 348
235 3300048910 Ga0496107_0006038 Ga0496107_0006038_6350_7405 348
236 3300048910 Ga0496107_0055195 Ga0496107_0055195_1372_2418 348
237 3300048910 Ga0496107_0062740 Ga0496107_0062740_946_1995 348
238 3300048910 Ga0496107_0087013 Ga0496107_0087013_370_1425 348
239 3300048911 Ga0496108_0012112 Ga0496108_0012112_2999_4054 348
240 3300048911 Ga0496108_0037275 Ga0496108_0037275_2255_3310 348
241 3300048911 Ga0496108_0060373 Ga0496108_0060373_1306_2355 348
242 3300048911 Ga0496108_0283699 Ga0496108_0283699_83_1138 348
243 3300048912 Ga0496109_0014640 Ga0496109_0014640_2811_3866 348
244 3300048912 Ga0496109_0027301 Ga0496109_0027301_931_1986 348
245 3300048912 Ga0496109_0032835 Ga0496109_0032835_1938_2987 348
246 3300048912 Ga0496109_0039456 Ga0496109_0039456_2987_4042 348
247 3300048912 Ga0496109_0041803 Ga0496109_0041803_3029_4078 348
248 3300048913 Ga0496110_0002143 Ga0496110_0002143_4947_5996 348
249 3300048913 Ga0496110_0017561 Ga0496110_0017561_4857_5912 348
250 3300048913 Ga0496110_0027856 Ga0496110_0027856_707_1762 348
251 3300048913 Ga0496110_0046220 Ga0496110_0046220_2467_3516 348
252 3300048913 Ga0496110_0448015 Ga0496110_0448015_108_1163 348
253 3300048914 Ga0496111_0018836 Ga0496111_0018836_920_1975 348
254 3300048914 Ga0496111_0037225 Ga0496111_0037225_2301_3350 348
255 3300048914 Ga0496111_0057723 Ga0496111_0057723_1713_2762 348
256 3300048914 Ga0496111_0339259 Ga0496111_0339259_31_1086 348
257 3300048915 Ga0496112_0012219 Ga0496112_0012219_4527_5585 348
258 3300048915 Ga0496112_0092748 Ga0496112_0092748_277_1332 348
259 3300048915 Ga0496112_0186153 Ga0496112_0186153_42_1097 348
260 3300048915 Ga0496112_0189896 Ga0496112_0189896_920_1975 348
261 3300048916 Ga0496113_0017521 Ga0496113_0017521_2999_4054 348
262 3300048916 Ga0496113_0022678 Ga0496113_0022678_1245_2294 348
263 3300048916 Ga0496113_0046359 Ga0496113_0046359_565_1620 348
264 3300048916 Ga0496113_0128211 Ga0496113_0128211_17_1072 348
265 3300048917 Ga0496114_0004934 Ga0496114_0004934_7209_8264 348
266 3300048917 Ga0496114_0083368 Ga0496114_0083368_998_2056 348
267 3300048917 Ga0496114_0093614 Ga0496114_0093614_523_1578 348
268 3300048917 Ga0496114_0222865 Ga0496114_0222865_266_1315 348
269 3300048917 Ga0496114_0477163 Ga0496114_0477163_34_1089 348
270 3300048918 Ga0496115_0046239 Ga0496115_0046239_423_1478 348
271 3300048918 Ga0496115_0071102 Ga0496115_0071102_576_1622 348
272 3300048918 Ga0496115_0108463 Ga0496115_0108463_14_1069 348
273 3300048918 Ga0496115_0236867 Ga0496115_0236867_59_1114 348
274 3300049572 Ga0501036_0011963 Ga0501036_0011963_4829_5881 348
275 3300049573 Ga0501037_0003797 Ga0501037_0003797_5272_6324 348
276 3300049574 Ga0501038_0005823 Ga0501038_0005823_9058_10110 348
277 3300049581 Ga0501047_0012686 Ga0501047_0012686_6146_7198 348
278 3300049588 Ga0501072_0142106 Ga0501072_0142106_510_1559 348
279 3300049591 Ga0501075_0004943 Ga0501075_0004943_6158_7207 348
280 3300049741 Ga0501079_0045742 Ga0501079_0045742_2002_3051 348
281 3300049742 Ga0501080_0009594 Ga0501080_0009594_2060_3112 348
282 3300049743 Ga0501081_0007181 Ga0501081_0007181_5523_6572 348
283 3300049823 Ga0501044_0300041 Ga0501044_0300041_210_1262 348
284 3300050490 nmdc:mga03n38_3394_c1 nmdc:mga03n38_3394_c1_475_1524 348
285 3300050491 nmdc:mga00v17_240_c1 nmdc:mga00v17_240_c1_10665_11714 348
286 3300050492 nmdc:mga0yw44_143878_c1 nmdc:mga0yw44_143878_c1_139_1188 348
287 3300050494 nmdc:mga06z11_10626_c1 nmdc:mga06z11_10626_c1_43_1092 348
288 3300050495 nmdc:mga04h51_1885_c1 nmdc:mga04h51_1885_c1_1257_2306 348
289 3300050507 nmdc:mga05p37_42468_c1 nmdc:mga05p37_42468_c1_749_1795 348
290 3300050512 nmdc:mga0n895_77958_c1 nmdc:mga0n895_77958_c1_114_1169 348
291 3300050513 nmdc:mga0rr50_8030_c1 nmdc:mga0rr50_8030_c1_90_1145 348
292 3300053085 Ga0495619_0002910 Ga0495619_0002910_1025_2074 348
293 3300053085 Ga0495619_0021183 Ga0495619_0021183_2063_3118 348
294 3300053085 Ga0495619_0026177 Ga0495619_0026177_2237_3286 348
295 3300053130 Ga0500642_0000005 Ga0500642_0000005_105844_106893 348
296 3300053153 Ga0500616_0041708 Ga0500616_0041708_561_1610 348
297 3300053730 Ga0500645_005405 Ga0500645_005405_3573_4625 348
298 3300060353 Ga0501082_0000038 Ga0501082_0000038_19099_20151 348
299 3300060353 Ga0501082_0250187 Ga0501082_0250187_328_1377 348
300 3300005341 Ga0070691_10094835 Ga0070691_100948352 349
301 3300005530 Ga0070679_100022817 Ga0070679_1000228173 349
302 3300005563 Ga0068855_100160037 Ga0068855_1001600372 349
303 3300005578 Ga0068854_100269227 Ga0068854_1002692271 349
304 3300009093 Ga0105240_10388298 Ga0105240_103882981 349
305 3300013249 Ga0171463_1002 Ga0171463_1002420 349
306 3300015690 Ga0183363_1037 Ga0183363_103741 349
307 3300025913 Ga0207695_10065275 Ga0207695_100652754 349
308 3300025949 Ga0207667_10210428 Ga0207667_102104282 349
309 3300005985 Ga0081539_10102517 Ga0081539_101025172 350
310 3300037853 Ga0436364_1549833 Ga0436364_1549833_10888_11952 351
311 3300048922 Ga0496119_0006674 Ga0496119_0006674_3540_4607 351
312 3300048925 Ga0496122_0006800 Ga0496122_0006800_5960_7027 351
313 3300048926 Ga0496123_0000625 Ga0496123_0000625_6113_7180 351
314 3300053104 Ga0500556_0000327 Ga0500556_0000327_31369_32436 351
315 3300005355 Ga0070671_100040599 Ga0070671_1000405992 352
316 3300014325 Ga0163163_10079787 Ga0163163_100797872 352
317 3300025931 Ga0207644_10032822 Ga0207644_100328224 352
318 3300026088 Ga0207641_10074142 Ga0207641_100741421 352
319 3300046616 Ga0495668_0030741 Ga0495668_0030741_414_1472 352
320 3300031456 Ga0307513_10006613 Ga0307513_1000661313 353
321 3300046648 Ga0495611_0012755 Ga0495611_0012755_1858_2931 353
322 3300047320 Ga0495672_0050632 Ga0495672_0050632_762_1826 353
323 3300048918 Ga0496115_0000831 Ga0496115_0000831_19999_21063 353
324 3300049571 Ga0501034_0132298 Ga0501034_0132298_806_1936 354
325 3300049579 Ga0501043_0023065 Ga0501043_0023065_1991_3139 354
326 3300009093 Ga0105240_10003057 Ga0105240_100030579 355
327 3300009093 Ga0105240_10062959 Ga0105240_100629593 355
328 3300009093 Ga0105240_10072849 Ga0105240_100728492 355
329 3300025913 Ga0207695_10062449 Ga0207695_100624492 355
330 3300025913 Ga0207695_10103405 Ga0207695_101034053 355
331 3300003187 JGI25151J46595_10000056 JGI25151J46595_10000056143 356
332 3300003771 Ga0055526_1001952 Ga0055526_100195212 356
333 3300003775 Ga0055524_1000089 Ga0055524_100008993 356
334 3300025273 Ga0209673_1009486 Ga0209673_10094863 356
335 3300025291 Ga0209675_1017786 Ga0209675_10177861 356
336 3300025292 Ga0209676_1019000 Ga0209676_10190002 356
337 3300025294 Ga0209025_1000016 Ga0209025_1000016363 356
338 3300025295 Ga0209564_1000035 Ga0209564_100003595 356
339 3300025295 Ga0209564_1000075 Ga0209564_1000075134 356
340 3300025299 Ga0209256_1000025 Ga0209256_1000025351 356
341 3300031901 Ga0307406_10141818 Ga0307406_101418182 356
342 3300048907 Ga0496104_0000509 Ga0496104_0000509_3607_4698 356
343 3300048907 Ga0496104_0013494 Ga0496104_0013494_4556_5647 356
344 3300048907 Ga0496104_0090383 Ga0496104_0090383_316_1407 356
345 3300048908 Ga0496105_0000091 Ga0496105_0000091_58293_59384 356
346 3300048908 Ga0496105_0001830 Ga0496105_0001830_8818_9909 356
347 3300048908 Ga0496105_0031696 Ga0496105_0031696_1853_2944 356
348 3300048913 Ga0496110_0032441 Ga0496110_0032441_2245_3336 356
349 3300048915 Ga0496112_0016738 Ga0496112_0016738_3542_4633 356
350 3300048916 Ga0496113_0003675 Ga0496113_0003675_1551_2642 356
351 3300048917 Ga0496114_0048647 Ga0496114_0048647_2116_3207 356
352 3300048918 Ga0496115_0028964 Ga0496115_0028964_655_1782 356
353 3300048918 Ga0496115_0054597 Ga0496115_0054597_219_1310 356
354 3300048928 Ga0496125_0128551 Ga0496125_0128551_602_1678 356
355 3300048928 Ga0496125_0180643 Ga0496125_0180643_264_1355 356
356 3300048929 Ga0496126_0249373 Ga0496126_0249373_13_1089 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

119

227

0.94

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

239

418

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u0o-assembly1.cif.gz_A the crystal structure of selenophosphate synthetase from e. coli 0.928 38 356
2zau-assembly1.cif.gz_C-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9256 60 355
3u0o-assembly1.cif.gz_A the crystal structure of selenophosphate synthetase from e. coli 0.9224 38 356
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.9206 14 355
2zau-assembly1.cif.gz_B-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9191 59 355
ID Description Score Start End Superfamily
3u0oB02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9047 172 356 3.90.650.10
3u0oA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9044 38 171 3.30.1330.10
3u0oB02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9001 172 356 3.90.650.10
2yyeA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8978 14 165 3.30.1330.10
2zauB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8972 59 170 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A529IV71-F1-model_v4 deleted 0.9926 49 356
AF-C0AQN0-F1-model_v4 deleted 0.9895 79 163
AF-A0A259PD58-F1-model_v4 Selenide, water dikinase SelD 0.9892 71 356 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A6H9XTK2-F1-model_v4 Selenide, water dikinase (EC 2.7.9.3) (Selenium donor protein) (Selenophosphate synthase) 0.9824 13 356 GO:0000287
GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A259PD58-F1-model_v4 Selenide, water dikinase SelD 0.9824 71 356 GO:0004756
GO:0005524
GO:0005737
GO:0016260

Feature Viewer

pLDDT pTM Quality
88.21 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map