F420554

General Info

Members Datasets Scaffolds Average Seq Length
356 185 712 120

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_102055401|Ga0307416_1020554012
Length 140
Sequence MGMDRERPVDSFLPLRPVEFHVLLSLAAGERHGYGIIQDAEERDETIGLDVGTLYRALRRMEDQGLIGAAERRRAPDAGDERRNYYRITPLGLRVARAEAKRLEALTRAARVRGLLGAGAVWRSSRSTHGSSASSPRCPA

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.65
Nodule 0
Rhizoplane 0.84
Rhizosphere 95.51
Stem 0
Stem Tuber 0
Unclassified 30.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_102055401 3300032002 Bacteria 674
2 MRS1b_contig_2452035 2162886011 Unclassified 819
3 Ga0065712_10068543 3300005290 Bacteria 9966
4 Ga0070658_11744647 3300005327 Unclassified 539
5 Ga0070683_100960105 3300005329 Bacteria 820
6 Ga0070670_101640117 3300005331 Unclassified 591
7 Ga0070680_100124561 3300005336 Bacteria 2153
8 Ga0070680_100896785 3300005336 Unclassified 765
9 Ga0070689_100437690 3300005340 Bacteria 1111
10 Ga0070689_100479931 3300005340 Bacteria 1062
11 Ga0070661_100287826 3300005344 Bacteria 1276
12 Ga0070668_100307880 3300005347 Bacteria 1330
13 Ga0070675_100022138 3300005354 Bacteria 5078
14 Ga0070675_100033123 3300005354 Archaea 4186
15 Ga0070675_102263833 3300005354 Unclassified 500
16 Ga0070673_100077232 3300005364 Bacteria 2691
17 Ga0070673_100662891 3300005364 Bacteria 956
18 Ga0070688_100155181 3300005365 Bacteria 1568
19 Ga0070688_100421971 3300005365 Unclassified 992
20 Ga0070667_101021980 3300005367 Unclassified 771
21 Ga0070708_100748076 3300005445 Bacteria 919
22 Ga0070678_100638496 3300005456 Bacteria 954
23 Ga0070678_101163905 3300005456 Unclassified 714
24 Ga0070662_100711876 3300005457 Unclassified 850
25 Ga0070681_10790198 3300005458 Unclassified 866
26 Ga0068867_100856605 3300005459 Unclassified 814
27 Ga0068867_102413873 3300005459 Bacteria 500
28 Ga0070685_10164701 3300005466 Unclassified 1416
29 Ga0070685_11064195 3300005466 Bacteria 610
30 Ga0070685_11445849 3300005466 Unclassified 529
31 Ga0070707_100002234 3300005468 Bacteria 18496
32 Ga0070698_101130969 3300005471 Unclassified 732
33 Ga0070679_100115639 3300005530 Bacteria 2668
34 Ga0070679_100661404 3300005530 Unclassified 987
35 Ga0070679_100900965 3300005530 Unclassified 828
36 Ga0070672_101464243 3300005543 Unclassified 611
37 Ga0070686_100550749 3300005544 Bacteria 902
38 Ga0070695_100023378 3300005545 Bacteria 3797
39 Ga0070665_100017550 3300005548 Bacteria 7187
40 Ga0070704_100355095 3300005549 Bacteria 1238
41 Ga0070664_100057853 3300005564 Bacteria 3296
42 Ga0070664_100776256 3300005564 Bacteria 895
43 Ga0068857_100840260 3300005577 Unclassified 878
44 Ga0070702_100669773 3300005615 Unclassified 787
45 Ga0068859_100488335 3300005617 Bacteria 1327
46 Ga0068864_101066374 3300005618 Bacteria 803
47 Ga0068866_10529823 3300005718 Bacteria 784
48 Ga0068861_100079272 3300005719 Bacteria 2567
49 Ga0068861_100320430 3300005719 Bacteria 1350
50 Ga0068861_100656134 3300005719 Bacteria 970
51 Ga0068870_10207053 3300005840 Bacteria 1192
52 Ga0068863_100124318 3300005841 Bacteria 2461
53 Ga0068863_100738965 3300005841 Unclassified 979
54 Ga0068862_100018550 3300005844 Bacteria 5795
55 Ga0068862_100547145 3300005844 Unclassified 1105
56 Ga0081539_10052987 3300005985 Bacteria 2274
57 Ga0075365_10795519 3300006038 Bacteria 667
58 Ga0075363_100137534 3300006048 Bacteria 1374
59 Ga0075364_10087983 3300006051 Bacteria 2059
60 Ga0075362_10035984 3300006177 Bacteria 2163
61 Ga0075367_10028184 3300006178 Bacteria 3202
62 Ga0075366_10000463 3300006195 Bacteria 18923
63 Ga0097621_100859016 3300006237 Unclassified 843
64 Ga0075428_100004609 3300006844 Bacteria 15243
65 Ga0075428_100027414 3300006844 Bacteria 6304
66 Ga0075428_100058954 3300006844 Bacteria 4204
67 Ga0075428_100420137 3300006844 Bacteria 1433
68 Ga0075428_101178618 3300006844 Bacteria 808
69 Ga0075428_101955623 3300006844 Unclassified 608
70 Ga0075430_100002836 3300006846 Bacteria 14501
71 Ga0075430_100018381 3300006846 Bacteria 5949
72 Ga0075430_100046106 3300006846 Bacteria 3681
73 Ga0075430_100157722 3300006846 Unclassified 1889
74 Ga0075431_100003592 3300006847 Bacteria 15032
75 Ga0075431_100025112 3300006847 Bacteria 6109
76 Ga0075431_100030758 3300006847 Bacteria 5531
77 Ga0075431_100255038 3300006847 Bacteria 1781
78 Ga0075431_100284933 3300006847 Bacteria 1672
79 Ga0075431_100343477 3300006847 Bacteria 1502
80 Ga0075431_102057386 3300006847 Unclassified 526
81 Ga0075433_10002492 3300006852 Bacteria 14013
82 Ga0075433_10043028 3300006852 Bacteria 3919
83 Ga0075433_10492945 3300006852 Bacteria 1079
84 Ga0075433_11466359 3300006852 Bacteria 590
85 Ga0075434_100005401 3300006871 Bacteria 11630
86 Ga0075434_100058549 3300006871 Bacteria 3829
87 Ga0075434_100168807 3300006871 Unclassified 2208
88 Ga0075434_100458644 3300006871 Bacteria 1296
89 Ga0075429_100010119 3300006880 Bacteria 8171
90 Ga0075429_100032001 3300006880 Bacteria 4573
91 Ga0075429_100040716 3300006880 Bacteria 4045
92 Ga0075429_100318191 3300006880 Bacteria 1362
93 Ga0075429_100498031 3300006880 Bacteria 1068
94 Ga0068865_100193600 3300006881 Unclassified 1574
95 Ga0068865_100932891 3300006881 Unclassified 757
96 Ga0068865_101075656 3300006881 Unclassified 707
97 Ga0068865_101361043 3300006881 Unclassified 633
98 Ga0075436_101242045 3300006914 Unclassified 563
99 Ga0097620_100488355 3300006931 Bacteria 1327
100 Ga0075435_100024427 3300007076 Bacteria 4691
101 Ga0075435_100338474 3300007076 Unclassified 1289
102 Ga0099794_10390981 3300007265 Bacteria 726
103 Ga0111539_10000194 3300009094 Bacteria 71319
104 Ga0111539_10085879 3300009094 Unclassified 3698
105 Ga0111539_10450156 3300009094 Bacteria 1499
106 Ga0111539_11284884 3300009094 Bacteria 849
107 Ga0105247_10235022 3300009101 Unclassified 1246
108 Ga0114129_10022164 3300009147 Bacteria 9016
109 Ga0114129_10031217 3300009147 Bacteria 7534
110 Ga0114129_10062601 3300009147 Bacteria 5197
111 Ga0114129_10150527 3300009147 Unclassified 3185
112 Ga0114129_10316314 3300009147 Bacteria 2076
113 Ga0114129_10343401 3300009147 Bacteria 1979
114 Ga0114129_10559551 3300009147 Bacteria 1486
115 Ga0114129_10689081 3300009147 Bacteria 1314
116 Ga0114129_10877427 3300009147 Unclassified 1138
117 Ga0114129_10884699 3300009147 Bacteria 1133
118 Ga0114129_11711664 3300009147 Unclassified 767
119 Ga0114129_12114675 3300009147 Bacteria 679
120 Ga0105243_11519031 3300009148 Bacteria 694
121 Ga0105242_10406013 3300009176 Bacteria 1273
122 Ga0105242_13158242 3300009176 Unclassified 511
123 Ga0105248_10118790 3300009177 Archaea 2982
124 Ga0105248_11069306 3300009177 Unclassified 912
125 Ga0105249_10448312 3300009553 Bacteria 1329
126 Ga0105249_11653691 3300009553 Unclassified 713
127 Ga0105246_10803807 3300011119 Unclassified 835
128 Ga0157378_10456693 3300013297 Unclassified 1269
129 Ga0163162_10718891 3300013306 Unclassified 1119
130 Ga0163162_11583437 3300013306 Unclassified 747
131 Ga0157372_11377460 3300013307 Bacteria 813
132 Ga0157375_10148796 3300013308 Bacteria 2475
133 Ga0157375_11142254 3300013308 Unclassified 913
134 Ga0163163_10489446 3300014325 Bacteria 1291
135 Ga0163163_11076659 3300014325 Bacteria 867
136 Ga0157380_10864866 3300014326 Unclassified 927
137 Ga0157380_13117741 3300014326 Unclassified 529
138 Ga0157377_10034947 3300014745 Bacteria 2753
139 Ga0182007_10425112 3300015262 Bacteria 509
140 Ga0163161_10833555 3300017792 Unclassified 777
141 Ga0163161_11757797 3300017792 Unclassified 550
142 Ga0207680_10281860 3300025903 Bacteria 1155
143 Ga0207643_10149320 3300025908 Bacteria 1400
144 Ga0207643_10170880 3300025908 Bacteria 1312
145 Ga0207660_10870355 3300025917 Unclassified 735
146 Ga0207649_10418391 3300025920 Bacteria 1006
147 Ga0207652_10106309 3300025921 Bacteria 2484
148 Ga0207652_10776506 3300025921 Unclassified 852
149 Ga0207646_10058966 3300025922 Bacteria 3428
150 Ga0207650_11901636 3300025925 Unclassified 503
151 Ga0207659_10098970 3300025926 Unclassified 2194
152 Ga0207659_10271058 3300025926 Unclassified 1384
153 Ga0207687_10725216 3300025927 Unclassified 845
154 Ga0207706_11000814 3300025933 Unclassified 702
155 Ga0207709_10977004 3300025935 Bacteria 691
156 Ga0207670_10248080 3300025936 Bacteria 1375
157 Ga0207670_10507352 3300025936 Unclassified 980
158 Ga0207669_11192928 3300025937 Unclassified 645
159 Ga0207704_10400376 3300025938 Bacteria 1083
160 Ga0207711_11103144 3300025941 Unclassified 734
161 Ga0207689_10151313 3300025942 Unclassified 1913
162 Ga0207679_10206319 3300025945 Bacteria 1645
163 Ga0207679_10708281 3300025945 Bacteria 914
164 Ga0207679_12108664 3300025945 Unclassified 512
165 Ga0207712_10516262 3300025961 Bacteria 1023
166 Ga0207668_10112279 3300025972 Bacteria 2047
167 Ga0207668_11612007 3300025972 Unclassified 586
168 Ga0207658_10097847 3300025986 Unclassified 2292
169 Ga0207658_10141136 3300025986 Bacteria 1950
170 Ga0207677_10033526 3300026023 Bacteria 3316
171 Ga0207639_10398168 3300026041 Bacteria 1240
172 Ga0207641_10079724 3300026088 Unclassified 2839
173 Ga0207648_10536107 3300026089 Unclassified 1074
174 Ga0207648_11310885 3300026089 Bacteria 680
175 Ga0207674_10330881 3300026116 Bacteria 1473
176 Ga0207674_10654585 3300026116 Bacteria 1014
177 Ga0207675_100026289 3300026118 Bacteria 5418
178 Ga0207675_100336005 3300026118 Bacteria 1478
179 Ga0207675_100522189 3300026118 Bacteria 1184
180 Ga0207675_101396714 3300026118 Bacteria 721
181 Ga0207683_10719295 3300026121 Unclassified 926
182 Ga0207698_11444452 3300026142 Bacteria 703
183 Ga0207428_10000365 3300027907 Bacteria 58330
184 Ga0207428_10022975 3300027907 Bacteria 5252
185 Ga0207428_10083064 3300027907 Unclassified 2499
186 Ga0268266_10708614 3300028379 Bacteria 970
187 Ga0268265_10220880 3300028380 Bacteria 1658
188 Ga0268265_10243167 3300028380 Unclassified 1589
189 Ga0268264_11574689 3300028381 Unclassified 668
190 Ga0268264_11687256 3300028381 Unclassified 644
191 Ga0307408_100008261 3300031548 Bacteria 6871
192 Ga0307408_100099924 3300031548 Bacteria 2208
193 Ga0307408_100650634 3300031548 Unclassified 942
194 Ga0307405_10004471 3300031731 Bacteria 6611
195 Ga0307405_10010068 3300031731 Bacteria 4878
196 Ga0307413_10000306 3300031824 Bacteria 15174
197 Ga0307413_10008357 3300031824 Bacteria 4882
198 Ga0307413_10012376 3300031824 Bacteria 4245
199 Ga0307410_10000511 3300031852 Bacteria 15756
200 Ga0307410_10015350 3300031852 Bacteria 4540
201 Ga0307410_10041028 3300031852 Bacteria 3049
202 Ga0307410_10328485 3300031852 Unclassified 1216
203 Ga0307410_10364091 3300031852 Bacteria 1159
204 Ga0307410_11410943 3300031852 Bacteria 612
205 Ga0307406_10002812 3300031901 Bacteria 9483
206 Ga0307406_10030543 3300031901 Bacteria 3273
207 Ga0307406_10084051 3300031901 Bacteria 2124
208 Ga0307406_11097772 3300031901 Unclassified 687
209 Ga0307406_11398433 3300031901 Unclassified 613
210 Ga0307407_10000459 3300031903 Bacteria 12454
211 Ga0307407_10000581 3300031903 Bacteria 11567
212 Ga0307407_10030759 3300031903 Bacteria 2899
213 Ga0307407_10485185 3300031903 Bacteria 903
214 Ga0307412_10004898 3300031911 Bacteria 7476
215 Ga0307412_10011146 3300031911 Bacteria 5199
216 Ga0307412_10011497 3300031911 Bacteria 5131
217 Ga0307412_10974161 3300031911 Bacteria 748
218 Ga0307409_100000267 3300031995 Bacteria 21200
219 Ga0307409_100032198 3300031995 Bacteria 3797
220 Ga0307409_100503242 3300031995 Bacteria 1180
221 Ga0307409_100543095 3300031995 Unclassified 1139
222 Ga0307409_102888259 3300031995 Bacteria 508
223 Ga0307416_100000192 3300032002 Bacteria 32674
224 Ga0307416_100000645 3300032002 Bacteria 17987
225 Ga0307416_100011025 3300032002 Bacteria 6004
226 Ga0307416_100209137 3300032002 Bacteria 1859
227 Ga0307416_100340174 3300032002 Bacteria 1513
228 Ga0307416_100650411 3300032002 Bacteria 1139
229 Ga0307416_100696396 3300032002 Bacteria 1105
230 Ga0307416_100886078 3300032002 Unclassified 992
231 Ga0307414_10012217 3300032004 Bacteria 5067
232 Ga0307414_10028063 3300032004 Bacteria 3646
233 Ga0307414_10197963 3300032004 Unclassified 1631
234 Ga0307411_10003697 3300032005 Bacteria 7165
235 Ga0307411_10010469 3300032005 Bacteria 4945
236 Ga0307411_10044981 3300032005 Bacteria 2836
237 Ga0307415_100004483 3300032126 Bacteria 7252
238 Ga0307415_100018794 3300032126 Bacteria 4182
239 Ga0307415_101693868 3300032126 Unclassified 609
240 Ga0307415_102051764 3300032126 Bacteria 558
241 Ga0373931_0048203 3300035691 Unclassified 2258
242 Ga0373937_1097564 3300036401 Unclassified 744
243 Ga0373925_0114194 3300037068 Bacteria 2090
244 Ga0395905_1676246 3300037471 Bacteria 541
245 Ga0439438_128545 3300041405 Bacteria 608
246 Ga0439435_0013182 3300042436 Bacteria 2016
247 Ga0439459_0135920 3300042438 Unclassified 632
248 Ga0439459_0175122 3300042438 Bacteria 574
249 Ga0439460_0019775 3300042461 Bacteria 1827
250 Ga0466965_0392867 3300044683 Unclassified 765
251 Ga0451576_0218801 3300045051 Bacteria 1989
252 Ga0495586_0102580 3300046535 Bacteria 1588
253 Ga0495586_0513961 3300046535 Unclassified 691
254 Ga0495658_0269650 3300046683 Bacteria 1073
255 Ga0495613_0516204 3300046689 Unclassified 803
256 Ga0495674_0939998 3300047319 Unclassified 665
257 Ga0496108_0218047 3300048911 Bacteria 1657
258 Ga0496110_1170777 3300048913 Unclassified 677
259 Ga0496113_0231595 3300048916 Bacteria 1473
260 Ga0501292_015868 3300049515 Bacteria 1181
261 Ga0501032_0044155 3300049569 Bacteria 3017
262 Ga0501033_0084339 3300049570 Bacteria 2328
263 Ga0501034_0208012 3300049571 Bacteria 1912
264 Ga0501036_0127806 3300049572 Unclassified 2146
265 Ga0501037_0027500 3300049573 Unclassified 4202
266 Ga0501037_0268712 3300049573 Bacteria 1190
267 Ga0501038_0018734 3300049574 Bacteria 6250
268 Ga0501039_0314882 3300049575 Bacteria 1230
269 Ga0501040_0698319 3300049576 Bacteria 734
270 Ga0501041_0105537 3300049577 Unclassified 1746
271 Ga0501042_0530289 3300049578 Bacteria 855
272 Ga0501043_0003788 3300049579 Bacteria 12431
273 Ga0501043_0207623 3300049579 Bacteria 1518
274 Ga0501043_0380779 3300049579 Bacteria 1068
275 Ga0501043_0650452 3300049579 Unclassified 774
276 Ga0501043_0659685 3300049579 Unclassified 767
277 Ga0501046_0014134 3300049580 Bacteria 6741
278 Ga0501046_0065592 3300049580 Bacteria 2832
279 Ga0501047_0001559 3300049581 Bacteria 22423
280 Ga0501047_0332246 3300049581 Bacteria 1358
281 Ga0501067_0093380 3300049583 Bacteria 1670
282 Ga0501068_0857473 3300049584 Bacteria 597
283 Ga0501068_1110302 3300049584 Bacteria 523
284 Ga0501070_0029471 3300049586 Bacteria 4601
285 Ga0501070_0281308 3300049586 Bacteria 1357
286 Ga0501071_0192640 3300049587 Bacteria 1529
287 Ga0501072_0013112 3300049588 Bacteria 6344
288 Ga0501072_0363188 3300049588 Bacteria 1149
289 Ga0501073_0010343 3300049589 Bacteria 6846
290 Ga0501073_0303449 3300049589 Unclassified 1101
291 Ga0501074_0053999 3300049590 Unclassified 2898
292 Ga0501074_0246630 3300049590 Bacteria 1270
293 Ga0501075_0492165 3300049591 Bacteria 935
294 Ga0501075_0540172 3300049591 Bacteria 890
295 Ga0501076_0342865 3300049592 Unclassified 1226
296 Ga0501077_0172037 3300049593 Bacteria 1376
297 Ga0501257_203884 3300049686 Bacteria 570
298 Ga0501079_0570068 3300049741 Unclassified 890
299 Ga0501080_0030381 3300049742 Bacteria 5034
300 Ga0501080_0050604 3300049742 Unclassified 3866
301 Ga0501081_0100654 3300049743 Unclassified 2043
302 Ga0501083_0001351 3300049744 Bacteria 16653
303 Ga0501083_0049651 3300049744 Bacteria 2827
304 Ga0501035_0022135 3300049822 Bacteria 5838
305 Ga0501044_0280303 3300049823 Bacteria 1600
306 Ga0501045_0040871 3300049824 Bacteria 3373
307 Ga0501045_0414596 3300049824 Bacteria 1002
308 nmdc:mga03683_65121_c1 3300050489 Bacteria 1548
309 nmdc:mga03n38_73115_c1 3300050490 Bacteria 1591
310 nmdc:mga0yw44_294904_c1 3300050492 Bacteria 1086
311 nmdc:mga0k408_881_c1 3300050493 Bacteria 16475
312 nmdc:mga06z11_103194_c1 3300050494 Bacteria 1568
313 nmdc:mga07m45_383648_c1 3300050496 Bacteria 816
314 nmdc:mga05p37_1128_c1 3300050507 Bacteria 30678
315 nmdc:mga05p37_1178963_c1 3300050507 Bacteria 794
316 nmdc:mga05p37_306674_c1 3300050507 Bacteria 1883
317 nmdc:mga05p37_638085_c1 3300050507 Bacteria 1195
318 nmdc:mga05p37_68411_c1 3300050507 Bacteria 4367
319 nmdc:mga05p37_895804_c1 3300050507 Bacteria 957
320 nmdc:mga09592_14414_c1 3300050508 Bacteria 6451
321 nmdc:mga09592_21721_c1 3300050508 Bacteria 5291
322 nmdc:mga09592_318351_c1 3300050508 Bacteria 1348
323 nmdc:mga09592_458647_c1 3300050508 Unclassified 1099
324 nmdc:mga09592_606506_c1 3300050508 Bacteria 937
325 nmdc:mga0qj67_11066_c1 3300050509 Bacteria 6755
326 nmdc:mga0qj67_284439_c1 3300050509 Bacteria 1340
327 nmdc:mga0qj67_2955_c1 3300050509 Bacteria 12187
328 nmdc:mga06r32_1148564_c1 3300050510 Bacteria 724
329 nmdc:mga06r32_195849_c1 3300050510 Bacteria 2008
330 nmdc:mga06r32_20135_c1 3300050510 Bacteria 6137
331 nmdc:mga06r32_272989_c1 3300050510 Bacteria 1678
332 nmdc:mga06r32_6109_c1 3300050510 Bacteria 10816
333 nmdc:mga06r32_877552_c1 3300050510 Unclassified 854
334 nmdc:mga08y16_1873864_c1 3300050511 Unclassified 551
335 nmdc:mga08y16_458879_c1 3300050511 Bacteria 1299
336 nmdc:mga08y16_64050_c1 3300050511 Unclassified 3839
337 nmdc:mga08y16_782_c1 3300050511 Bacteria 30382
338 nmdc:mga0n895_1953838_c1 3300050512 Unclassified 545
339 nmdc:mga0n895_2599_c1 3300050512 Bacteria 14188
340 nmdc:mga0n895_45965_c1 3300050512 Bacteria 4263
341 nmdc:mga0n895_93921_c1 3300050512 Bacteria 3003
342 nmdc:mga0rr50_674685_c1 3300050513 Unclassified 882
343 nmdc:mga0rr50_76333_c1 3300050513 Unclassified 2572
344 nmdc:mga0rr50_767433_c1 3300050513 Unclassified 823
345 nmdc:mga08x19_903301_c1 3300050514 Bacteria 627
346 nmdc:mga0a205_2639_c1 3300050515 Bacteria 15837
347 nmdc:mga0a205_29939_c1 3300050515 Bacteria 5210
348 nmdc:mga0a205_559251_c1 3300050515 Bacteria 999
349 Ga0500599_033149 3300053736 Bacteria 775
350 Ga0501084_0020534 3300054114 Bacteria 5510
351 Ga0501084_0130059 3300054114 Bacteria 2119
352 Ga0501082_0310365 3300060353 Bacteria 1373
353 Ga0501082_0320416 3300060353 Unclassified 1350
354 Ga0501082_0573228 3300060353 Unclassified 987
355 Ga0501082_1525471 3300060353 Bacteria 583
356 Ga0530510_0569162 3300061734 Unclassified 861
357 Ga0307416_102055401
358 MRS1b_contig_2452035
359 Ga0065712_10068543
360 Ga0070658_11744647
361 Ga0070683_100960105
362 Ga0070670_101640117
363 Ga0070680_100124561
364 Ga0070680_100896785
365 Ga0070689_100437690
366 Ga0070689_100479931
367 Ga0070661_100287826
368 Ga0070668_100307880
369 Ga0070675_100022138
370 Ga0070675_100033123
371 Ga0070675_102263833
372 Ga0070673_100077232
373 Ga0070673_100662891
374 Ga0070688_100155181
375 Ga0070688_100421971
376 Ga0070667_101021980
377 Ga0070708_100748076
378 Ga0070678_100638496
379 Ga0070678_101163905
380 Ga0070662_100711876
381 Ga0070681_10790198
382 Ga0068867_100856605
383 Ga0068867_102413873
384 Ga0070685_10164701
385 Ga0070685_11064195
386 Ga0070685_11445849
387 Ga0070707_100002234
388 Ga0070698_101130969
389 Ga0070679_100115639
390 Ga0070679_100661404
391 Ga0070679_100900965
392 Ga0070672_101464243
393 Ga0070686_100550749
394 Ga0070695_100023378
395 Ga0070665_100017550
396 Ga0070704_100355095
397 Ga0070664_100057853
398 Ga0070664_100776256
399 Ga0068857_100840260
400 Ga0070702_100669773
401 Ga0068859_100488335
402 Ga0068864_101066374
403 Ga0068866_10529823
404 Ga0068861_100079272
405 Ga0068861_100320430
406 Ga0068861_100656134
407 Ga0068870_10207053
408 Ga0068863_100124318
409 Ga0068863_100738965
410 Ga0068862_100018550
411 Ga0068862_100547145
412 Ga0081539_10052987
413 Ga0075365_10795519
414 Ga0075363_100137534
415 Ga0075364_10087983
416 Ga0075362_10035984
417 Ga0075367_10028184
418 Ga0075366_10000463
419 Ga0097621_100859016
420 Ga0075428_100004609
421 Ga0075428_100027414
422 Ga0075428_100058954
423 Ga0075428_100420137
424 Ga0075428_101178618
425 Ga0075428_101955623
426 Ga0075430_100002836
427 Ga0075430_100018381
428 Ga0075430_100046106
429 Ga0075430_100157722
430 Ga0075431_100003592
431 Ga0075431_100025112
432 Ga0075431_100030758
433 Ga0075431_100255038
434 Ga0075431_100284933
435 Ga0075431_100343477
436 Ga0075431_102057386
437 Ga0075433_10002492
438 Ga0075433_10043028
439 Ga0075433_10492945
440 Ga0075433_11466359
441 Ga0075434_100005401
442 Ga0075434_100058549
443 Ga0075434_100168807
444 Ga0075434_100458644
445 Ga0075429_100010119
446 Ga0075429_100032001
447 Ga0075429_100040716
448 Ga0075429_100318191
449 Ga0075429_100498031
450 Ga0068865_100193600
451 Ga0068865_100932891
452 Ga0068865_101075656
453 Ga0068865_101361043
454 Ga0075436_101242045
455 Ga0097620_100488355
456 Ga0075435_100024427
457 Ga0075435_100338474
458 Ga0099794_10390981
459 Ga0111539_10000194
460 Ga0111539_10085879
461 Ga0111539_10450156
462 Ga0111539_11284884
463 Ga0105247_10235022
464 Ga0114129_10022164
465 Ga0114129_10031217
466 Ga0114129_10062601
467 Ga0114129_10150527
468 Ga0114129_10316314
469 Ga0114129_10343401
470 Ga0114129_10559551
471 Ga0114129_10689081
472 Ga0114129_10877427
473 Ga0114129_10884699
474 Ga0114129_11711664
475 Ga0114129_12114675
476 Ga0105243_11519031
477 Ga0105242_10406013
478 Ga0105242_13158242
479 Ga0105248_10118790
480 Ga0105248_11069306
481 Ga0105249_10448312
482 Ga0105249_11653691
483 Ga0105246_10803807
484 Ga0157378_10456693
485 Ga0163162_10718891
486 Ga0163162_11583437
487 Ga0157372_11377460
488 Ga0157375_10148796
489 Ga0157375_11142254
490 Ga0163163_10489446
491 Ga0163163_11076659
492 Ga0157380_10864866
493 Ga0157380_13117741
494 Ga0157377_10034947
495 Ga0182007_10425112
496 Ga0163161_10833555
497 Ga0163161_11757797
498 Ga0207680_10281860
499 Ga0207643_10149320
500 Ga0207643_10170880
501 Ga0207660_10870355
502 Ga0207649_10418391
503 Ga0207652_10106309
504 Ga0207652_10776506
505 Ga0207646_10058966
506 Ga0207650_11901636
507 Ga0207659_10098970
508 Ga0207659_10271058
509 Ga0207687_10725216
510 Ga0207706_11000814
511 Ga0207709_10977004
512 Ga0207670_10248080
513 Ga0207670_10507352
514 Ga0207669_11192928
515 Ga0207704_10400376
516 Ga0207711_11103144
517 Ga0207689_10151313
518 Ga0207679_10206319
519 Ga0207679_10708281
520 Ga0207679_12108664
521 Ga0207712_10516262
522 Ga0207668_10112279
523 Ga0207668_11612007
524 Ga0207658_10097847
525 Ga0207658_10141136
526 Ga0207677_10033526
527 Ga0207639_10398168
528 Ga0207641_10079724
529 Ga0207648_10536107
530 Ga0207648_11310885
531 Ga0207674_10330881
532 Ga0207674_10654585
533 Ga0207675_100026289
534 Ga0207675_100336005
535 Ga0207675_100522189
536 Ga0207675_101396714
537 Ga0207683_10719295
538 Ga0207698_11444452
539 Ga0207428_10000365
540 Ga0207428_10022975
541 Ga0207428_10083064
542 Ga0268266_10708614
543 Ga0268265_10220880
544 Ga0268265_10243167
545 Ga0268264_11574689
546 Ga0268264_11687256
547 Ga0307408_100008261
548 Ga0307408_100099924
549 Ga0307408_100650634
550 Ga0307405_10004471
551 Ga0307405_10010068
552 Ga0307413_10000306
553 Ga0307413_10008357
554 Ga0307413_10012376
555 Ga0307410_10000511
556 Ga0307410_10015350
557 Ga0307410_10041028
558 Ga0307410_10328485
559 Ga0307410_10364091
560 Ga0307410_11410943
561 Ga0307406_10002812
562 Ga0307406_10030543
563 Ga0307406_10084051
564 Ga0307406_11097772
565 Ga0307406_11398433
566 Ga0307407_10000459
567 Ga0307407_10000581
568 Ga0307407_10030759
569 Ga0307407_10485185
570 Ga0307412_10004898
571 Ga0307412_10011146
572 Ga0307412_10011497
573 Ga0307412_10974161
574 Ga0307409_100000267
575 Ga0307409_100032198
576 Ga0307409_100503242
577 Ga0307409_100543095
578 Ga0307409_102888259
579 Ga0307416_100000192
580 Ga0307416_100000645
581 Ga0307416_100011025
582 Ga0307416_100209137
583 Ga0307416_100340174
584 Ga0307416_100650411
585 Ga0307416_100696396
586 Ga0307416_100886078
587 Ga0307414_10012217
588 Ga0307414_10028063
589 Ga0307414_10197963
590 Ga0307411_10003697
591 Ga0307411_10010469
592 Ga0307411_10044981
593 Ga0307415_100004483
594 Ga0307415_100018794
595 Ga0307415_101693868
596 Ga0307415_102051764
597 Ga0373931_0048203
598 Ga0373937_1097564
599 Ga0373925_0114194
600 Ga0395905_1676246
601 Ga0439438_128545
602 Ga0439435_0013182
603 Ga0439459_0135920
604 Ga0439459_0175122
605 Ga0439460_0019775
606 Ga0466965_0392867
607 Ga0451576_0218801
608 Ga0495586_0102580
609 Ga0495586_0513961
610 Ga0495658_0269650
611 Ga0495613_0516204
612 Ga0495674_0939998
613 Ga0496108_0218047
614 Ga0496110_1170777
615 Ga0496113_0231595
616 Ga0501292_015868
617 Ga0501032_0044155
618 Ga0501033_0084339
619 Ga0501034_0208012
620 Ga0501036_0127806
621 Ga0501037_0027500
622 Ga0501037_0268712
623 Ga0501038_0018734
624 Ga0501039_0314882
625 Ga0501040_0698319
626 Ga0501041_0105537
627 Ga0501042_0530289
628 Ga0501043_0003788
629 Ga0501043_0207623
630 Ga0501043_0380779
631 Ga0501043_0650452
632 Ga0501043_0659685
633 Ga0501046_0014134
634 Ga0501046_0065592
635 Ga0501047_0001559
636 Ga0501047_0332246
637 Ga0501067_0093380
638 Ga0501068_0857473
639 Ga0501068_1110302
640 Ga0501070_0029471
641 Ga0501070_0281308
642 Ga0501071_0192640
643 Ga0501072_0013112
644 Ga0501072_0363188
645 Ga0501073_0010343
646 Ga0501073_0303449
647 Ga0501074_0053999
648 Ga0501074_0246630
649 Ga0501075_0492165
650 Ga0501075_0540172
651 Ga0501076_0342865
652 Ga0501077_0172037
653 Ga0501257_203884
654 Ga0501079_0570068
655 Ga0501080_0030381
656 Ga0501080_0050604
657 Ga0501081_0100654
658 Ga0501083_0001351
659 Ga0501083_0049651
660 Ga0501035_0022135
661 Ga0501044_0280303
662 Ga0501045_0040871
663 Ga0501045_0414596
664 nmdc:mga03683_65121_c1
665 nmdc:mga03n38_73115_c1
666 nmdc:mga0yw44_294904_c1
667 nmdc:mga0k408_881_c1
668 nmdc:mga06z11_103194_c1
669 nmdc:mga07m45_383648_c1
670 nmdc:mga05p37_1128_c1
671 nmdc:mga05p37_1178963_c1
672 nmdc:mga05p37_306674_c1
673 nmdc:mga05p37_638085_c1
674 nmdc:mga05p37_68411_c1
675 nmdc:mga05p37_895804_c1
676 nmdc:mga09592_14414_c1
677 nmdc:mga09592_21721_c1
678 nmdc:mga09592_318351_c1
679 nmdc:mga09592_458647_c1
680 nmdc:mga09592_606506_c1
681 nmdc:mga0qj67_11066_c1
682 nmdc:mga0qj67_284439_c1
683 nmdc:mga0qj67_2955_c1
684 nmdc:mga06r32_1148564_c1
685 nmdc:mga06r32_195849_c1
686 nmdc:mga06r32_20135_c1
687 nmdc:mga06r32_272989_c1
688 nmdc:mga06r32_6109_c1
689 nmdc:mga06r32_877552_c1
690 nmdc:mga08y16_1873864_c1
691 nmdc:mga08y16_458879_c1
692 nmdc:mga08y16_64050_c1
693 nmdc:mga08y16_782_c1
694 nmdc:mga0n895_1953838_c1
695 nmdc:mga0n895_2599_c1
696 nmdc:mga0n895_45965_c1
697 nmdc:mga0n895_93921_c1
698 nmdc:mga0rr50_674685_c1
699 nmdc:mga0rr50_76333_c1
700 nmdc:mga0rr50_767433_c1
701 nmdc:mga08x19_903301_c1
702 nmdc:mga0a205_2639_c1
703 nmdc:mga0a205_29939_c1
704 nmdc:mga0a205_559251_c1
705 Ga0500599_033149
706 Ga0501084_0020534
707 Ga0501084_0130059
708 Ga0501082_0310365
709 Ga0501082_0320416
710 Ga0501082_0573228
711 Ga0501082_1525471
712 Ga0530510_0569162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

22

98

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.8932 17 112
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8755 17 89
7cbv-assembly1.cif.gz_A-3 crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32) 0.8708 15 98
1yg2-assembly1.cif.gz_A-2 structure of the vibrio cholerae virulence activator apha 0.864 17 98
5y8t-assembly2.cif.gz_B crystal structure of bacillus subtilis padr in complex with p-coumaric acid 0.8574 15 97
ID Description Score Start End Superfamily
af_Q57735_17_96_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9195 17 107 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8931 17 112 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8755 17 89 1.10.10.10
1yg2A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.864 17 98 1.10.10.10
5y8tC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8621 15 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V0UGX8-F1-model_v4 PadR family transcriptional regulator 0.9448 9 120
AF-A0A7V8WG78-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9393 8 120
AF-A0A2V8IKJ3-F1-model_v4 PadR family transcriptional regulator 0.9388 5 120
AF-A0A7Y3IDG7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9333 7 119
AF-W0RK21-F1-model_v4 Transcriptional regulator PadR family protein 0.9331 8 120

Map