F420405

General Info

Members Datasets Scaffolds Average Seq Length
356 186 712 174

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100044623|Ga0070675_1000446234
Length 184
Sequence MLKCPAMPRGLFRKITPRSETLHSHWALKPFKRFLGDPRLWSLQRRTVTPAFGAGLAICFVPLPIHIPLAALVAIVSRINIPTIMVSLIAVNPLTIVPAYFLAYKVGVLVTGAPQRRFAFQMSWDWVQHGLGPMWKPFLIGCGLTGALFGLVGYALLDLIWRYSVRKRYRERAGSTSRQSGLFD

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
181 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 4.21
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 13.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100044623 3300005354 Bacteria 3625
2 Ga0070676_10292188 3300005328 Unclassified 1102
3 Ga0070683_100309858 3300005329 Bacteria 1502
4 Ga0070683_100769664 3300005329 Bacteria 922
5 Ga0070690_100029716 3300005330 Bacteria 3392
6 Ga0070690_100146792 3300005330 Bacteria 1606
7 Ga0070670_100036920 3300005331 Bacteria 4204
8 Ga0070670_100467859 3300005331 Bacteria 1119
9 Ga0070677_10014727 3300005333 Bacteria 2758
10 Ga0068869_100276973 3300005334 Bacteria 1348
11 Ga0068869_100277946 3300005334 Unclassified 1346
12 Ga0068869_100448915 3300005334 Bacteria 1069
13 Ga0068869_100856773 3300005334 Bacteria 784
14 Ga0070682_100020195 3300005337 Bacteria 3917
15 Ga0070682_100099289 3300005337 Bacteria 1919
16 Ga0070682_100167573 3300005337 Bacteria 1523
17 Ga0070682_100289638 3300005337 Bacteria 1197
18 Ga0068868_100067308 3300005338 Bacteria 2850
19 Ga0070689_100001759 3300005340 Bacteria 13876
20 Ga0070689_100412140 3300005340 Bacteria 1144
21 Ga0070689_100755083 3300005340 Bacteria 853
22 Ga0070691_10292843 3300005341 Unclassified 887
23 Ga0070669_100034986 3300005353 Bacteria 3637
24 Ga0070675_100080250 3300005354 Unclassified 2719
25 Ga0070675_100174699 3300005354 Bacteria 1854
26 Ga0070675_100388025 3300005354 Bacteria 1244
27 Ga0070674_100086115 3300005356 Bacteria 2256
28 Ga0070674_100634024 3300005356 Bacteria 907
29 Ga0070674_101301422 3300005356 Bacteria 648
30 Ga0070673_100018627 3300005364 Bacteria 4965
31 Ga0070673_100111720 3300005364 Bacteria 2267
32 Ga0070673_101117116 3300005364 Bacteria 737
33 Ga0070659_100601387 3300005366 Bacteria 945
34 Ga0070710_10060354 3300005437 Bacteria 2157
35 Ga0070701_10003870 3300005438 Bacteria 5979
36 Ga0070701_10119109 3300005438 Bacteria 1485
37 Ga0070701_10413993 3300005438 Bacteria 857
38 Ga0070705_100194035 3300005440 Bacteria 1387
39 Ga0070700_100111035 3300005441 Bacteria 1823
40 Ga0070700_100166520 3300005441 Bacteria 1522
41 Ga0070700_100215541 3300005441 Bacteria 1357
42 Ga0070694_100009753 3300005444 Bacteria 5897
43 Ga0070663_100393922 3300005455 Bacteria 1131
44 Ga0070678_100002874 3300005456 Bacteria 9539
45 Ga0070678_100038721 3300005456 Bacteria 3359
46 Ga0070678_100290796 3300005456 Bacteria 1385
47 Ga0068867_100442426 3300005459 Bacteria 1106
48 Ga0068867_100804147 3300005459 Unclassified 839
49 Ga0070685_10120898 3300005466 Bacteria 1626
50 Ga0070685_10166112 3300005466 Bacteria 1411
51 Ga0068853_100908405 3300005539 Bacteria 846
52 Ga0070672_100012463 3300005543 Bacteria 5970
53 Ga0070672_100181390 3300005543 Bacteria 1754
54 Ga0070672_100724933 3300005543 Unclassified 871
55 Ga0070686_100007188 3300005544 Bacteria 6202
56 Ga0070686_100044579 3300005544 Bacteria 2789
57 Ga0070686_100122064 3300005544 Bacteria 1790
58 Ga0070695_100536413 3300005545 Bacteria 910
59 Ga0070696_100015028 3300005546 Bacteria 5197
60 Ga0070665_100003700 3300005548 Bacteria 16196
61 Ga0070665_100005723 3300005548 Bacteria 12762
62 Ga0070665_100023631 3300005548 Bacteria 6189
63 Ga0070665_100096887 3300005548 Bacteria 2955
64 Ga0070665_100800298 3300005548 Bacteria 956
65 Ga0070665_101540895 3300005548 Unclassified 673
66 Ga0070704_100337958 3300005549 Bacteria 1267
67 Ga0070664_100032657 3300005564 Bacteria 4354
68 Ga0070664_100603698 3300005564 Bacteria 1018
69 Ga0068857_100318371 3300005577 Bacteria 1436
70 Ga0068857_100432153 3300005577 Bacteria 1229
71 Ga0068857_100506257 3300005577 Bacteria 1134
72 Ga0068854_100955589 3300005578 Unclassified 756
73 Ga0070702_100004705 3300005615 Bacteria 6263
74 Ga0068859_100003724 3300005617 Bacteria 15547
75 Ga0068859_100365220 3300005617 Bacteria 1539
76 Ga0068859_100509832 3300005617 Bacteria 1298
77 Ga0068864_100127251 3300005618 Bacteria 2284
78 Ga0068864_100505551 3300005618 Bacteria 1163
79 Ga0068864_100528754 3300005618 Bacteria 1138
80 Ga0068861_100010323 3300005719 Bacteria 6479
81 Ga0068861_100061261 3300005719 Bacteria 2887
82 Ga0068861_100071273 3300005719 Bacteria 2694
83 Ga0068861_100131618 3300005719 Bacteria 2031
84 Ga0068861_100668168 3300005719 Bacteria 962
85 Ga0068851_10231027 3300005834 Bacteria 1043
86 Ga0068870_10048337 3300005840 Bacteria 2240
87 Ga0068870_10061003 3300005840 Unclassified 2026
88 Ga0068863_100046042 3300005841 Bacteria 4139
89 Ga0068863_100113327 3300005841 Bacteria 2583
90 Ga0068863_100474722 3300005841 Bacteria 1229
91 Ga0068858_101003129 3300005842 Unclassified 818
92 Ga0068860_100124570 3300005843 Bacteria 2470
93 Ga0068862_100017051 3300005844 Bacteria 6043
94 Ga0068862_100102887 3300005844 Bacteria 2500
95 Ga0068862_100289002 3300005844 Bacteria 1505
96 Ga0081455_10002524 3300005937 Bacteria 21743
97 Ga0097621_100031694 3300006237 Bacteria 4196
98 Ga0097621_100340567 3300006237 Bacteria 1332
99 Ga0097621_100477410 3300006237 Bacteria 1127
100 Ga0068871_100033995 3300006358 Bacteria 4041
101 Ga0068871_100093621 3300006358 Bacteria 2507
102 Ga0068871_100162662 3300006358 Bacteria 1909
103 Ga0068871_100466326 3300006358 Bacteria 1134
104 Ga0068871_100933768 3300006358 Bacteria 805
105 Ga0075430_100674695 3300006846 Bacteria 852
106 Ga0068865_100046142 3300006881 Bacteria 2989
107 Ga0068865_100586618 3300006881 Bacteria 940
108 Ga0097620_100003724 3300006931 Bacteria 15547
109 Ga0097620_100365183 3300006931 Bacteria 1539
110 Ga0097620_100509859 3300006931 Bacteria 1298
111 Ga0105250_10440884 3300009092 Bacteria 583
112 Ga0105240_10223727 3300009093 Bacteria 2191
113 Ga0111539_10099407 3300009094 Bacteria 3417
114 Ga0111539_10825263 3300009094 Bacteria 1079
115 Ga0111539_10983758 3300009094 Bacteria 981
116 Ga0105245_10840079 3300009098 Bacteria 958
117 Ga0105243_10582161 3300009148 Bacteria 1074
118 Ga0105243_11261729 3300009148 Bacteria 754
119 Ga0105241_10135475 3300009174 Bacteria 1999
120 Ga0105242_10027887 3300009176 Bacteria 4489
121 Ga0105242_10732562 3300009176 Bacteria 971
122 Ga0105242_11247806 3300009176 Bacteria 765
123 Ga0105242_11409414 3300009176 Unclassified 724
124 Ga0105248_10347221 3300009177 Bacteria 1671
125 Ga0105237_10833370 3300009545 Bacteria 929
126 Ga0105249_10126848 3300009553 Bacteria 2431
127 Ga0105249_10559338 3300009553 Bacteria 1195
128 Ga0105239_10317310 3300010375 Bacteria 1757
129 Ga0105246_11274379 3300011119 Bacteria 680
130 Ga0157374_10430670 3300013296 Bacteria 1319
131 Ga0163162_10038698 3300013306 Bacteria 4760
132 Ga0157375_10015454 3300013308 Bacteria 6835
133 Ga0157375_10016966 3300013308 Bacteria 6560
134 Ga0157375_10819885 3300013308 Bacteria 1078
135 Ga0157375_11458035 3300013308 Bacteria 807
136 Ga0163163_10037309 3300014325 Bacteria 4727
137 Ga0163163_12058482 3300014325 Bacteria 630
138 Ga0157380_10013957 3300014326 Bacteria 5866
139 Ga0157380_10029315 3300014326 Bacteria 4206
140 Ga0157380_10266786 3300014326 Bacteria 1558
141 Ga0157380_10520805 3300014326 Unclassified 1160
142 Ga0157380_10530434 3300014326 Unclassified 1150
143 Ga0157380_10709601 3300014326 Bacteria 1012
144 Ga0157380_11620426 3300014326 Bacteria 703
145 Ga0157380_12376728 3300014326 Bacteria 595
146 Ga0157377_10363416 3300014745 Bacteria 975
147 Ga0157379_10329655 3300014968 Bacteria 1395
148 Ga0157379_11726889 3300014968 Bacteria 614
149 Ga0157376_10006514 3300014969 Bacteria 8254
150 Ga0157376_10036912 3300014969 Bacteria 3962
151 Ga0157376_10287263 3300014969 Bacteria 1552
152 Ga0157376_10663347 3300014969 Bacteria 1045
153 Ga0157376_11191010 3300014969 Unclassified 790
154 Ga0163161_10018270 3300017792 Bacteria 4916
155 Ga0163161_10264660 3300017792 Bacteria 1344
156 Ga0228598_1078172 3300024227 Bacteria 663
157 Ga0207697_10097288 3300025315 Bacteria 1252
158 Ga0207682_10043365 3300025893 Bacteria 1841
159 Ga0207642_10083156 3300025899 Bacteria 1560
160 Ga0207688_10378350 3300025901 Bacteria 875
161 Ga0207688_10390694 3300025901 Bacteria 862
162 Ga0207643_10017490 3300025908 Bacteria 3921
163 Ga0207643_10032886 3300025908 Bacteria 2899
164 Ga0207643_10033525 3300025908 Bacteria 2873
165 Ga0207695_10172805 3300025913 Bacteria 2085
166 Ga0207681_10014679 3300025923 Bacteria 4877
167 Ga0207681_10319468 3300025923 Bacteria 1234
168 Ga0207681_10607004 3300025923 Unclassified 904
169 Ga0207650_10239098 3300025925 Bacteria 1467
170 Ga0207659_10018524 3300025926 Bacteria 4565
171 Ga0207659_10577293 3300025926 Unclassified 957
172 Ga0207659_11498220 3300025926 Unclassified 577
173 Ga0207644_10482691 3300025931 Unclassified 1021
174 Ga0207644_10611032 3300025931 Unclassified 906
175 Ga0207686_10329949 3300025934 Bacteria 1143
176 Ga0207686_10428581 3300025934 Bacteria 1013
177 Ga0207686_10524966 3300025934 Bacteria 922
178 Ga0207686_10542967 3300025934 Bacteria 908
179 Ga0207670_10002801 3300025936 Bacteria 9188
180 Ga0207670_10022753 3300025936 Bacteria 3890
181 Ga0207670_10362177 3300025936 Bacteria 1151
182 Ga0207704_10012309 3300025938 Bacteria 4246
183 Ga0207704_10124961 3300025938 Bacteria 1769
184 Ga0207704_10453155 3300025938 Bacteria 1024
185 Ga0207704_10508589 3300025938 Bacteria 972
186 Ga0207704_10541664 3300025938 Bacteria 944
187 Ga0207704_10761284 3300025938 Unclassified 806
188 Ga0207691_10005555 3300025940 Bacteria 12181
189 Ga0207691_10010585 3300025940 Bacteria 8847
190 Ga0207711_10073688 3300025941 Bacteria 2968
191 Ga0207689_10018906 3300025942 Bacteria 5811
192 Ga0207689_10115391 3300025942 Bacteria 2207
193 Ga0207689_10122232 3300025942 Bacteria 2141
194 Ga0207689_10223122 3300025942 Unclassified 1557
195 Ga0207679_10062394 3300025945 Bacteria 2777
196 Ga0207651_10142727 3300025960 Bacteria 1852
197 Ga0207651_10328845 3300025960 Bacteria 1280
198 Ga0207651_10454535 3300025960 Bacteria 1099
199 Ga0207651_10580636 3300025960 Bacteria 978
200 Ga0207712_10039042 3300025961 Bacteria 3250
201 Ga0207712_10792829 3300025961 Bacteria 832
202 Ga0207668_10155162 3300025972 Bacteria 1778
203 Ga0207668_10888425 3300025972 Unclassified 793
204 Ga0207640_10300447 3300025981 Bacteria 1270
205 Ga0207640_10781395 3300025981 Bacteria 826
206 Ga0207658_10497136 3300025986 Bacteria 1086
207 Ga0207658_10835355 3300025986 Unclassified 837
208 Ga0207703_10319673 3300026035 Bacteria 1421
209 Ga0207639_10464766 3300026041 Bacteria 1151
210 Ga0207639_11119502 3300026041 Unclassified 738
211 Ga0207678_10078623 3300026067 Bacteria 2825
212 Ga0207678_10169268 3300026067 Bacteria 1865
213 Ga0207678_10208369 3300026067 Bacteria 1672
214 Ga0207708_10045358 3300026075 Bacteria 3350
215 Ga0207708_10067253 3300026075 Bacteria 2741
216 Ga0207708_10134568 3300026075 Bacteria 1935
217 Ga0207641_10007336 3300026088 Bacteria 9181
218 Ga0207641_10139689 3300026088 Bacteria 2184
219 Ga0207641_10963701 3300026088 Unclassified 849
220 Ga0207648_10040920 3300026089 Bacteria 4070
221 Ga0207676_10128293 3300026095 Bacteria 2152
222 Ga0207675_100005471 3300026118 Bacteria 12162
223 Ga0207675_100010106 3300026118 Bacteria 8844
224 Ga0207675_100032066 3300026118 Bacteria 4894
225 Ga0207675_100085714 3300026118 Bacteria 2957
226 Ga0207675_100365450 3300026118 Bacteria 1416
227 Ga0207675_101892609 3300026118 Unclassified 615
228 Ga0207683_10012288 3300026121 Bacteria 7308
229 Ga0207683_10075764 3300026121 Bacteria 2978
230 Ga0207683_10762304 3300026121 Bacteria 898
231 Ga0207428_10070438 3300027907 Bacteria 2748
232 Ga0268266_10030329 3300028379 Bacteria 4594
233 Ga0268266_10041381 3300028379 Bacteria 3931
234 Ga0268266_10136741 3300028379 Bacteria 2196
235 Ga0268266_11311938 3300028379 Unclassified 699
236 Ga0268265_10019540 3300028380 Bacteria 4712
237 Ga0268265_10045066 3300028380 Bacteria 3289
238 Ga0268265_10131156 3300028380 Bacteria 2083
239 Ga0268264_10370851 3300028381 Bacteria 1368
240 Ga0307517_10358906 3300028786 Unclassified 788
241 Ga0307515_10228275 3300028794 Bacteria 1661
242 Ga0307513_10108579 3300031456 Bacteria 2775
243 Ga0307513_10225150 3300031456 Bacteria 1693
244 Ga0307509_10082073 3300031507 Bacteria 3327
245 Ga0307509_10133840 3300031507 Bacteria 2428
246 Ga0307408_101456007 3300031548 Unclassified 646
247 Ga0307405_10831070 3300031731 Unclassified 776
248 Ga0307413_10005857 3300031824 Bacteria 5542
249 Ga0307413_10011013 3300031824 Bacteria 4421
250 Ga0307413_10164912 3300031824 Bacteria 1561
251 Ga0307410_10077628 3300031852 Bacteria 2322
252 Ga0307410_10372805 3300031852 Bacteria 1146
253 Ga0307406_10031347 3300031901 Bacteria 3237
254 Ga0307406_10833575 3300031901 Bacteria 781
255 Ga0307407_10004602 3300031903 Bacteria 5881
256 Ga0307407_10028502 3300031903 Bacteria 2986
257 Ga0307412_10434019 3300031911 Bacteria 1078
258 Ga0307409_100075831 3300031995 Bacteria 2694
259 Ga0307409_100099777 3300031995 Bacteria 2405
260 Ga0307409_100137640 3300031995 Bacteria 2098
261 Ga0307409_100167501 3300031995 Bacteria 1930
262 Ga0307416_100049015 3300032002 Bacteria 3356
263 Ga0307416_100121602 3300032002 Bacteria 2328
264 Ga0307416_100184824 3300032002 Bacteria 1958
265 Ga0307414_10280927 3300032004 Bacteria 1399
266 Ga0307411_10004910 3300032005 Bacteria 6500
267 Ga0307415_100144782 3300032126 Bacteria 1820
268 Ga0307415_100304722 3300032126 Bacteria 1321
269 Ga0307415_100328257 3300032126 Bacteria 1279
270 Ga0373945_0387944 3300035116 Unclassified 610
271 Ga0373954_0237094 3300035118 Bacteria 898
272 Ga0373957_0073734 3300035120 Bacteria 1339
273 Ga0373955_0504240 3300035172 Unclassified 739
274 Ga0373947_0232784 3300035725 Bacteria 1214
275 Ga0373937_0320252 3300036401 Bacteria 1467
276 Ga0436360_0105362 3300039438 Unclassified 755
277 Ga0451791_0374867 3300041451 Bacteria 4152
278 Ga0451791_1197663 3300041451 Bacteria 1002
279 Ga0451797_0856337 3300041453 Bacteria 2301
280 Ga0451800_0264332 3300041459 Bacteria 1093
281 Ga0451800_0958617 3300041459 Bacteria 1926
282 Ga0451802_0947554 3300041460 Unclassified 1186
283 Ga0451802_1637949 3300041460 Bacteria 1720
284 Ga0451804_0552022 3300041463 Unclassified 1539
285 Ga0451804_1169659 3300041463 Unclassified 562
286 Ga0451807_1016443 3300041486 Bacteria 3207
287 Ga0451807_1051596 3300041486 Unclassified 681
288 Ga0451807_1279402 3300041486 Bacteria 1324
289 Ga0451807_1384817 3300041486 Bacteria 3847
290 Ga0451807_2166091 3300041486 Bacteria 1098
291 Ga0451835_0970698 3300041492 Unclassified 589
292 Ga0451853_3046186 3300041512 Bacteria 1060
293 Ga0450898_083141 3300042134 Unclassified 653
294 Ga0466972_0031186 3300044658 Bacteria 2623
295 Ga0466968_0082378 3300044735 Bacteria 1416
296 Ga0466960_0057974 3300044901 Bacteria 1890
297 Ga0495590_0001151 3300046457 Bacteria 11574
298 Ga0495638_0016123 3300046460 Bacteria 5007
299 Ga0495638_0093909 3300046460 Bacteria 1803
300 Ga0495616_0003102 3300046513 Bacteria 10754
301 Ga0495620_0202653 3300046515 Bacteria 763
302 Ga0495632_0018472 3300046519 Bacteria 3827
303 Ga0495632_0070844 3300046519 Bacteria 1676
304 Ga0495654_0103826 3300046530 Bacteria 1305
305 Ga0495597_0223124 3300046542 Bacteria 748
306 Ga0495633_0296106 3300046558 Unclassified 735
307 Ga0495656_0035772 3300046615 Unclassified 2042
308 Ga0495668_0301610 3300046616 Bacteria 878
309 Ga0495625_0165578 3300046660 Bacteria 1478
310 Ga0495625_0227311 3300046660 Bacteria 1220
311 Ga0495658_0449835 3300046683 Bacteria 823
312 Ga0495649_0022079 3300046694 Bacteria 3564
313 Ga0495649_0051827 3300046694 Bacteria 2225
314 Ga0495649_0127639 3300046694 Bacteria 1343
315 Ga0495589_0154646 3300046794 Bacteria 1094
316 Ga0495686_0054905 3300047472 Bacteria 2493
317 Ga0495626_0180471 3300048091 Unclassified 875
318 Ga0496114_0061636 3300048917 Bacteria 3138
319 Ga0495678_011672 3300049459 Bacteria 4197
320 Ga0501033_0337440 3300049570 Bacteria 1057
321 Ga0501036_0481649 3300049572 Bacteria 1033
322 Ga0501036_0496053 3300049572 Bacteria 1016
323 Ga0501039_0731941 3300049575 Bacteria 773
324 Ga0501042_0068479 3300049578 Bacteria 2538
325 Ga0501048_0379592 3300049582 Bacteria 1009
326 Ga0501068_0002265 3300049584 Bacteria 10250
327 Ga0501071_0003341 3300049587 Bacteria 10027
328 Ga0501071_0448990 3300049587 Bacteria 987
329 Ga0501072_0275603 3300049588 Bacteria 1338
330 Ga0501072_0456998 3300049588 Bacteria 1011
331 Ga0501073_0000314 3300049589 Bacteria 32139
332 Ga0501074_0113207 3300049590 Bacteria 1941
333 Ga0501074_0479488 3300049590 Unclassified 882
334 Ga0501075_0157829 3300049591 Bacteria 1730
335 Ga0501076_0032709 3300049592 Bacteria 4060
336 Ga0501077_0180017 3300049593 Bacteria 1343
337 Ga0501079_0004649 3300049741 Bacteria 10169
338 Ga0501080_0001135 3300049742 Bacteria 21930
339 Ga0501080_1174217 3300049742 Unclassified 661
340 nmdc:mga0qj67_436453_c1 3300050509 Bacteria 1055
341 nmdc:mga08y16_80514_c1 3300050511 Bacteria 3396
342 Ga0500644_0016141 3300053088 Bacteria 2146
343 Ga0500644_0108623 3300053088 Bacteria 1065
344 Ga0500556_0000152 3300053104 Bacteria 57878
345 Ga0500562_107143 3300053108 Bacteria 761
346 Ga0500628_166505 3300053129 Unclassified 624
347 Ga0500616_0000032 3300053153 Bacteria 403673
348 Ga0500616_0048497 3300053153 Bacteria 2252
349 Ga0500622_0006276 3300053156 Bacteria 6945
350 Ga0501084_0003099 3300054114 Bacteria 13480
351 Ga0501084_0374048 3300054114 Bacteria 1204
352 Ga0501082_0339433 3300060353 Unclassified 1309
353 Ga0501082_0783172 3300060353 Bacteria 834
354 Ga0501082_1458031 3300060353 Unclassified 598
355 Ga0530510_0052653 3300061734 Bacteria 2941
356 Ga0530510_0528634 3300061734 Bacteria 895
357 Ga0070675_100044623
358 Ga0070676_10292188
359 Ga0070683_100309858
360 Ga0070683_100769664
361 Ga0070690_100029716
362 Ga0070690_100146792
363 Ga0070670_100036920
364 Ga0070670_100467859
365 Ga0070677_10014727
366 Ga0068869_100276973
367 Ga0068869_100277946
368 Ga0068869_100448915
369 Ga0068869_100856773
370 Ga0070682_100020195
371 Ga0070682_100099289
372 Ga0070682_100167573
373 Ga0070682_100289638
374 Ga0068868_100067308
375 Ga0070689_100001759
376 Ga0070689_100412140
377 Ga0070689_100755083
378 Ga0070691_10292843
379 Ga0070669_100034986
380 Ga0070675_100080250
381 Ga0070675_100174699
382 Ga0070675_100388025
383 Ga0070674_100086115
384 Ga0070674_100634024
385 Ga0070674_101301422
386 Ga0070673_100018627
387 Ga0070673_100111720
388 Ga0070673_101117116
389 Ga0070659_100601387
390 Ga0070710_10060354
391 Ga0070701_10003870
392 Ga0070701_10119109
393 Ga0070701_10413993
394 Ga0070705_100194035
395 Ga0070700_100111035
396 Ga0070700_100166520
397 Ga0070700_100215541
398 Ga0070694_100009753
399 Ga0070663_100393922
400 Ga0070678_100002874
401 Ga0070678_100038721
402 Ga0070678_100290796
403 Ga0068867_100442426
404 Ga0068867_100804147
405 Ga0070685_10120898
406 Ga0070685_10166112
407 Ga0068853_100908405
408 Ga0070672_100012463
409 Ga0070672_100181390
410 Ga0070672_100724933
411 Ga0070686_100007188
412 Ga0070686_100044579
413 Ga0070686_100122064
414 Ga0070695_100536413
415 Ga0070696_100015028
416 Ga0070665_100003700
417 Ga0070665_100005723
418 Ga0070665_100023631
419 Ga0070665_100096887
420 Ga0070665_100800298
421 Ga0070665_101540895
422 Ga0070704_100337958
423 Ga0070664_100032657
424 Ga0070664_100603698
425 Ga0068857_100318371
426 Ga0068857_100432153
427 Ga0068857_100506257
428 Ga0068854_100955589
429 Ga0070702_100004705
430 Ga0068859_100003724
431 Ga0068859_100365220
432 Ga0068859_100509832
433 Ga0068864_100127251
434 Ga0068864_100505551
435 Ga0068864_100528754
436 Ga0068861_100010323
437 Ga0068861_100061261
438 Ga0068861_100071273
439 Ga0068861_100131618
440 Ga0068861_100668168
441 Ga0068851_10231027
442 Ga0068870_10048337
443 Ga0068870_10061003
444 Ga0068863_100046042
445 Ga0068863_100113327
446 Ga0068863_100474722
447 Ga0068858_101003129
448 Ga0068860_100124570
449 Ga0068862_100017051
450 Ga0068862_100102887
451 Ga0068862_100289002
452 Ga0081455_10002524
453 Ga0097621_100031694
454 Ga0097621_100340567
455 Ga0097621_100477410
456 Ga0068871_100033995
457 Ga0068871_100093621
458 Ga0068871_100162662
459 Ga0068871_100466326
460 Ga0068871_100933768
461 Ga0075430_100674695
462 Ga0068865_100046142
463 Ga0068865_100586618
464 Ga0097620_100003724
465 Ga0097620_100365183
466 Ga0097620_100509859
467 Ga0105250_10440884
468 Ga0105240_10223727
469 Ga0111539_10099407
470 Ga0111539_10825263
471 Ga0111539_10983758
472 Ga0105245_10840079
473 Ga0105243_10582161
474 Ga0105243_11261729
475 Ga0105241_10135475
476 Ga0105242_10027887
477 Ga0105242_10732562
478 Ga0105242_11247806
479 Ga0105242_11409414
480 Ga0105248_10347221
481 Ga0105237_10833370
482 Ga0105249_10126848
483 Ga0105249_10559338
484 Ga0105239_10317310
485 Ga0105246_11274379
486 Ga0157374_10430670
487 Ga0163162_10038698
488 Ga0157375_10015454
489 Ga0157375_10016966
490 Ga0157375_10819885
491 Ga0157375_11458035
492 Ga0163163_10037309
493 Ga0163163_12058482
494 Ga0157380_10013957
495 Ga0157380_10029315
496 Ga0157380_10266786
497 Ga0157380_10520805
498 Ga0157380_10530434
499 Ga0157380_10709601
500 Ga0157380_11620426
501 Ga0157380_12376728
502 Ga0157377_10363416
503 Ga0157379_10329655
504 Ga0157379_11726889
505 Ga0157376_10006514
506 Ga0157376_10036912
507 Ga0157376_10287263
508 Ga0157376_10663347
509 Ga0157376_11191010
510 Ga0163161_10018270
511 Ga0163161_10264660
512 Ga0228598_1078172
513 Ga0207697_10097288
514 Ga0207682_10043365
515 Ga0207642_10083156
516 Ga0207688_10378350
517 Ga0207688_10390694
518 Ga0207643_10017490
519 Ga0207643_10032886
520 Ga0207643_10033525
521 Ga0207695_10172805
522 Ga0207681_10014679
523 Ga0207681_10319468
524 Ga0207681_10607004
525 Ga0207650_10239098
526 Ga0207659_10018524
527 Ga0207659_10577293
528 Ga0207659_11498220
529 Ga0207644_10482691
530 Ga0207644_10611032
531 Ga0207686_10329949
532 Ga0207686_10428581
533 Ga0207686_10524966
534 Ga0207686_10542967
535 Ga0207670_10002801
536 Ga0207670_10022753
537 Ga0207670_10362177
538 Ga0207704_10012309
539 Ga0207704_10124961
540 Ga0207704_10453155
541 Ga0207704_10508589
542 Ga0207704_10541664
543 Ga0207704_10761284
544 Ga0207691_10005555
545 Ga0207691_10010585
546 Ga0207711_10073688
547 Ga0207689_10018906
548 Ga0207689_10115391
549 Ga0207689_10122232
550 Ga0207689_10223122
551 Ga0207679_10062394
552 Ga0207651_10142727
553 Ga0207651_10328845
554 Ga0207651_10454535
555 Ga0207651_10580636
556 Ga0207712_10039042
557 Ga0207712_10792829
558 Ga0207668_10155162
559 Ga0207668_10888425
560 Ga0207640_10300447
561 Ga0207640_10781395
562 Ga0207658_10497136
563 Ga0207658_10835355
564 Ga0207703_10319673
565 Ga0207639_10464766
566 Ga0207639_11119502
567 Ga0207678_10078623
568 Ga0207678_10169268
569 Ga0207678_10208369
570 Ga0207708_10045358
571 Ga0207708_10067253
572 Ga0207708_10134568
573 Ga0207641_10007336
574 Ga0207641_10139689
575 Ga0207641_10963701
576 Ga0207648_10040920
577 Ga0207676_10128293
578 Ga0207675_100005471
579 Ga0207675_100010106
580 Ga0207675_100032066
581 Ga0207675_100085714
582 Ga0207675_100365450
583 Ga0207675_101892609
584 Ga0207683_10012288
585 Ga0207683_10075764
586 Ga0207683_10762304
587 Ga0207428_10070438
588 Ga0268266_10030329
589 Ga0268266_10041381
590 Ga0268266_10136741
591 Ga0268266_11311938
592 Ga0268265_10019540
593 Ga0268265_10045066
594 Ga0268265_10131156
595 Ga0268264_10370851
596 Ga0307517_10358906
597 Ga0307515_10228275
598 Ga0307513_10108579
599 Ga0307513_10225150
600 Ga0307509_10082073
601 Ga0307509_10133840
602 Ga0307408_101456007
603 Ga0307405_10831070
604 Ga0307413_10005857
605 Ga0307413_10011013
606 Ga0307413_10164912
607 Ga0307410_10077628
608 Ga0307410_10372805
609 Ga0307406_10031347
610 Ga0307406_10833575
611 Ga0307407_10004602
612 Ga0307407_10028502
613 Ga0307412_10434019
614 Ga0307409_100075831
615 Ga0307409_100099777
616 Ga0307409_100137640
617 Ga0307409_100167501
618 Ga0307416_100049015
619 Ga0307416_100121602
620 Ga0307416_100184824
621 Ga0307414_10280927
622 Ga0307411_10004910
623 Ga0307415_100144782
624 Ga0307415_100304722
625 Ga0307415_100328257
626 Ga0373945_0387944
627 Ga0373954_0237094
628 Ga0373957_0073734
629 Ga0373955_0504240
630 Ga0373947_0232784
631 Ga0373937_0320252
632 Ga0436360_0105362
633 Ga0451791_0374867
634 Ga0451791_1197663
635 Ga0451797_0856337
636 Ga0451800_0264332
637 Ga0451800_0958617
638 Ga0451802_0947554
639 Ga0451802_1637949
640 Ga0451804_0552022
641 Ga0451804_1169659
642 Ga0451807_1016443
643 Ga0451807_1051596
644 Ga0451807_1279402
645 Ga0451807_1384817
646 Ga0451807_2166091
647 Ga0451835_0970698
648 Ga0451853_3046186
649 Ga0450898_083141
650 Ga0466972_0031186
651 Ga0466968_0082378
652 Ga0466960_0057974
653 Ga0495590_0001151
654 Ga0495638_0016123
655 Ga0495638_0093909
656 Ga0495616_0003102
657 Ga0495620_0202653
658 Ga0495632_0018472
659 Ga0495632_0070844
660 Ga0495654_0103826
661 Ga0495597_0223124
662 Ga0495633_0296106
663 Ga0495656_0035772
664 Ga0495668_0301610
665 Ga0495625_0165578
666 Ga0495625_0227311
667 Ga0495658_0449835
668 Ga0495649_0022079
669 Ga0495649_0051827
670 Ga0495649_0127639
671 Ga0495589_0154646
672 Ga0495686_0054905
673 Ga0495626_0180471
674 Ga0496114_0061636
675 Ga0495678_011672
676 Ga0501033_0337440
677 Ga0501036_0481649
678 Ga0501036_0496053
679 Ga0501039_0731941
680 Ga0501042_0068479
681 Ga0501048_0379592
682 Ga0501068_0002265
683 Ga0501071_0003341
684 Ga0501071_0448990
685 Ga0501072_0275603
686 Ga0501072_0456998
687 Ga0501073_0000314
688 Ga0501074_0113207
689 Ga0501074_0479488
690 Ga0501075_0157829
691 Ga0501076_0032709
692 Ga0501077_0180017
693 Ga0501079_0004649
694 Ga0501080_0001135
695 Ga0501080_1174217
696 nmdc:mga0qj67_436453_c1
697 nmdc:mga08y16_80514_c1
698 Ga0500644_0016141
699 Ga0500644_0108623
700 Ga0500556_0000152
701 Ga0500562_107143
702 Ga0500628_166505
703 Ga0500616_0000032
704 Ga0500616_0048497
705 Ga0500622_0006276
706 Ga0501084_0003099
707 Ga0501084_0374048
708 Ga0501082_0339433
709 Ga0501082_0783172
710 Ga0501082_1458031
711 Ga0530510_0052653
712 Ga0530510_0528634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09835

DUF2062

Uncharacterized protein conserved in bacteria (DUF2062)

28

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hhx-assembly1.cif.gz_A o6-methyl-guanine in the polymerase template preinsertion site 0.3764 64 161
6ur2-assembly1.cif.gz_A dna polymerase i large fragment from bacillus stearothermophilus with dna template and primer containing an n3'-> p5' linkage 0.3234 47 161
6kmw-assembly1.cif.gz_aL structure of psi from h. hongdechloris grown under white light condition 0.2833 15 162
7m76-assembly1.cif.gz_L room temperature xfel crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem i 0.2772 15 158
6kmw-assembly1.cif.gz_aL structure of psi from h. hongdechloris grown under white light condition 0.2613 15 162
ID Description Score Start End Superfamily
af_I1LP70_44_159_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5021 94 148 1.10.10.1740
af_Q2FVL1_227_449_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4008 39 148 1.20.1250.20
af_Q9NAM5_259_399_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.3795 42 158 1.20.58.390
af_A0A1D6L8U4_250_479_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3702 5 171 1.20.1250.20
af_A0A1D6L8U4_250_479_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3611 5 171 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2M8H635-F1-model_v4 DUF2062 domain-containing protein 0.927 1 165 GO:0016020
AF-G8Q275-F1-model_v4 deleted 0.9249 43 169
AF-A0A063Y2N9-F1-model_v4 DUF2062 domain-containing protein 0.9215 37 167 GO:0016020
AF-A0A5S9NUA0-F1-model_v4 DUF2062 domain-containing protein 0.9211 25 171 GO:0016020
AF-A0A2M8H635-F1-model_v4 DUF2062 domain-containing protein 0.9165 1 165 GO:0016020

Map