F420339
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 253 | 710 | 402 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2867475112|2867478856 |
| Length | 402 |
| Sequence | ATRVLVLNSGSSSLKYQLLDMHDGARLAAGLVERIGEETSRLAHTPLATGGDTRETEGPIADHTTALKAVAAELAADGLGLDSPQLAAIGHRVVHGGLQFTEPTVIDDAVLTEIERLVPLAPLHNPANITGIRTARALRPDLPQVAVFDTAFHTTMPEHAARYALDVATADAHRIRRYGFHGTSHAYVSRRTAALLGKDPSEVNVIVLHLGNGASASAVAGGRCVDTSMGLTPLEGLVMGTRSGDIDPAVTFHLKRVAGMSEDEVDELLNKKSGLIGLCGDNDMREIRRRIDAGGEDGARAQLAFDIYIHRLKKYLGAYTAVLGRVDAVAFTAGVGENAAPVRAAALAGLEQLGMAVDADRNAVRSDEPRLISPEGSRVAVAVVPTDEELEIAQQTYALVSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 8 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 9 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 10 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 11 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 12 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 13 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 14 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 15 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 16 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 17 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 21 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 22 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 23 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 24 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 25 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 26 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 27 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 28 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 29 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 30 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 31 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 32 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 33 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 34 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 35 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 36 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 37 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 38 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 39 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 40 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 41 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 42 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 43 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 44 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 45 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 46 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 47 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 48 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 49 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 50 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 51 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 52 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 53 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 54 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 55 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 56 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 57 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 125 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 140 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 141 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 144 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 145 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 146 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 147 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 148 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 149 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 150 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 151 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 152 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 153 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 154 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 155 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 156 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 157 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 158 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 159 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 160 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 161 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 162 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 163 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 164 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 165 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 166 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 167 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 168 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 169 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 170 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 171 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 172 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 173 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 174 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 175 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 176 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 177 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 178 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 179 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 180 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 181 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 182 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 183 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 184 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 185 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 186 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 187 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 188 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 189 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 190 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 191 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 192 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 193 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 194 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 195 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 196 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 197 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 198 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 199 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 200 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 201 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 202 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 203 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 204 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 205 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 206 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 207 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 208 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 209 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 210 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 211 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 212 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 213 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 214 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 215 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 216 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 217 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 218 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 219 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 220 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 221 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 222 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 223 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 224 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 225 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 226 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 227 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 228 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 229 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 230 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 231 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 232 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 233 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 234 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 235 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 236 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 237 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 238 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 239 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 240 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 241 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 242 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 243 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 244 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 245 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 246 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 247 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 248 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 249 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 250 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 251 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 252 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 253 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.11 |
| Metatranscriptomes | 0.28 |
| Isolates | 27.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.92 |
| Nodule | 0.85 |
| Rhizoplane | 0.56 |
| Rhizosphere | 75.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10006951 | 3300001989 | Bacteria | 4264 |
| 2 | JGI24738J21930_10004456 | 3300002075 | Bacteria | 3428 |
| 3 | rootH1_10012038 | 3300003316 | Bacteria | 2215 |
| 4 | rootL2_10223465 | 3300003322 | Bacteria | 1481 |
| 5 | JGI25160J50197_1014543 | 3300003354 | Bacteria | 2628 |
| 6 | Ga0006562J51391_1039762 | 3300003578 | Bacteria | 3247 |
| 7 | Ga0075367_10018025 | 3300006178 | Bacteria | 3888 |
| 8 | Ga0105243_10007965 | 3300009148 | Bacteria | 8141 |
| 9 | Ga0105243_10166207 | 3300009148 | Bacteria | 1907 |
| 10 | Ga0105246_10011517 | 3300011119 | Bacteria | 5489 |
| 11 | Ga0157372_10069223 | 3300013307 | Bacteria | 3969 |
| 12 | Ga0157375_10360472 | 3300013308 | Bacteria | 1620 |
| 13 | Ga0182008_10001944 | 3300014497 | Bacteria | 13339 |
| 14 | Ga0182007_10001129 | 3300015262 | Bacteria | 14468 |
| 15 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 16 | Ga0209758_1005727 | 3300025297 | Bacteria | 9364 |
| 17 | Ga0207426_1001550 | 3300025302 | Bacteria | 18675 |
| 18 | Ga0207426_1004878 | 3300025302 | Bacteria | 6349 |
| 19 | Ga0207426_1011723 | 3300025302 | Bacteria | 3322 |
| 20 | Ga0207709_10024363 | 3300025935 | Bacteria | 3455 |
| 21 | Ga0207709_10043627 | 3300025935 | Bacteria | 2705 |
| 22 | Ga0209371_1016892 | 3300027312 | Bacteria | 1910 |
| 23 | Ga0268266_10054200 | 3300028379 | Bacteria | 3446 |
| 24 | Ga0307515_10000813 | 3300028794 | Bacteria | 71821 |
| 25 | Ga0268256_1012995 | 3300030500 | Bacteria | 2548 |
| 26 | Ga0307511_10004464 | 3300030521 | Bacteria | 14287 |
| 27 | Ga0307511_10071227 | 3300030521 | Bacteria | 2538 |
| 28 | Ga0307512_10007235 | 3300030522 | Bacteria | 11045 |
| 29 | Ga0307513_10069071 | 3300031456 | Bacteria | 3698 |
| 30 | Ga0307509_10027685 | 3300031507 | Bacteria | 6305 |
| 31 | Ga0307508_10021420 | 3300031616 | Bacteria | 5876 |
| 32 | Ga0307508_10031151 | 3300031616 | Bacteria | 4822 |
| 33 | Ga0307508_10048234 | 3300031616 | Bacteria | 3794 |
| 34 | Ga0307514_10010235 | 3300031649 | Bacteria | 7851 |
| 35 | Ga0307516_10005589 | 3300031730 | Bacteria | 14975 |
| 36 | Ga0307516_10020546 | 3300031730 | Bacteria | 6820 |
| 37 | Ga0307507_10009383 | 3300033179 | Bacteria | 13065 |
| 38 | Ga0307507_10046849 | 3300033179 | Bacteria | 4232 |
| 39 | Ga0307510_10014326 | 3300033180 | Bacteria | 9389 |
| 40 | Ga0307510_10036791 | 3300033180 | Bacteria | 5444 |
| 41 | Ga0395900_0146293 | 3300037418 | Bacteria | 2416 |
| 42 | Ga0395898_0003519 | 3300037466 | Bacteria | 17456 |
| 43 | Ga0395898_0018379 | 3300037466 | Bacteria | 7129 |
| 44 | Ga0439436_0004934 | 3300041404 | Bacteria | 4094 |
| 45 | Ga0439439_0002532 | 3300041406 | Bacteria | 3901 |
| 46 | Ga0439439_0013510 | 3300041406 | Bacteria | 1979 |
| 47 | Ga0451853_0167257 | 3300041512 | Bacteria | 2217 |
| 48 | Ga0439433_0004675 | 3300041999 | Bacteria | 2942 |
| 49 | Ga0439448_0000943 | 3300042005 | Bacteria | 7162 |
| 50 | Ga0439449_0000560 | 3300042007 | Bacteria | 13978 |
| 51 | Ga0439449_0011497 | 3300042007 | Bacteria | 3329 |
| 52 | Ga0439455_0002205 | 3300042012 | Bacteria | 3487 |
| 53 | Ga0439457_000023 | 3300042014 | Bacteria | 30792 |
| 54 | Ga0439457_000345 | 3300042014 | Bacteria | 12934 |
| 55 | Ga0439462_0006841 | 3300042015 | Bacteria | 2844 |
| 56 | Ga0450894_001546 | 3300042131 | Bacteria | 3262 |
| 57 | Ga0450903_000025 | 3300042138 | Bacteria | 29994 |
| 58 | Ga0439458_0003203 | 3300042157 | Bacteria | 3877 |
| 59 | Ga0466972_0003732 | 3300044658 | Bacteria | 7576 |
| 60 | Ga0466972_0007707 | 3300044658 | Bacteria | 5406 |
| 61 | Ga0466966_0011160 | 3300044684 | Bacteria | 5959 |
| 62 | Ga0466966_0022122 | 3300044684 | Bacteria | 4174 |
| 63 | Ga0466966_0030065 | 3300044684 | Bacteria | 3529 |
| 64 | Ga0466961_0002889 | 3300044693 | Bacteria | 10655 |
| 65 | Ga0466961_0009353 | 3300044693 | Bacteria | 6242 |
| 66 | Ga0466961_0010577 | 3300044693 | Bacteria | 5886 |
| 67 | Ga0466961_0024083 | 3300044693 | Bacteria | 3917 |
| 68 | Ga0466963_0002615 | 3300044694 | Bacteria | 10108 |
| 69 | Ga0466963_0014972 | 3300044694 | Bacteria | 4792 |
| 70 | Ga0466964_0026694 | 3300044706 | Bacteria | 2262 |
| 71 | Ga0466971_0000670 | 3300044719 | Bacteria | 13647 |
| 72 | Ga0466971_0061231 | 3300044719 | Bacteria | 1701 |
| 73 | Ga0466970_0001736 | 3300044765 | Bacteria | 10505 |
| 74 | Ga0466957_0002024 | 3300044842 | Bacteria | 10802 |
| 75 | Ga0466960_0003534 | 3300044901 | Bacteria | 6019 |
| 76 | Ga0466959_0008079 | 3300045049 | Bacteria | 7419 |
| 77 | Ga0466959_0011846 | 3300045049 | Bacteria | 6279 |
| 78 | Ga0466958_0001505 | 3300045836 | Bacteria | 11146 |
| 79 | Ga0466967_0004981 | 3300045976 | Bacteria | 9093 |
| 80 | Ga0466967_0007604 | 3300045976 | Bacteria | 7836 |
| 81 | Ga0466967_0011001 | 3300045976 | Bacteria | 6825 |
| 82 | Ga0495617_007492 | 3300046452 | Bacteria | 3787 |
| 83 | Ga0495627_010639 | 3300046453 | Bacteria | 3335 |
| 84 | Ga0495592_0033971 | 3300046454 | Bacteria | 3846 |
| 85 | Ga0495592_0040562 | 3300046454 | Bacteria | 3494 |
| 86 | Ga0495603_0003304 | 3300046455 | Bacteria | 9600 |
| 87 | Ga0495603_0018504 | 3300046455 | Bacteria | 4214 |
| 88 | Ga0495603_0020480 | 3300046455 | Bacteria | 4008 |
| 89 | Ga0495603_0044896 | 3300046455 | Bacteria | 2636 |
| 90 | Ga0495629_0001224 | 3300046459 | Bacteria | 20148 |
| 91 | Ga0495629_0002206 | 3300046459 | Bacteria | 15016 |
| 92 | Ga0495629_0014641 | 3300046459 | Bacteria | 5643 |
| 93 | Ga0495629_0034473 | 3300046459 | Bacteria | 3578 |
| 94 | Ga0495629_0073161 | 3300046459 | Bacteria | 2393 |
| 95 | Ga0495629_0144881 | 3300046459 | Bacteria | 1652 |
| 96 | Ga0495638_0012643 | 3300046460 | Bacteria | 5776 |
| 97 | Ga0495638_0030633 | 3300046460 | Bacteria | 3461 |
| 98 | Ga0495638_0157103 | 3300046460 | Bacteria | 1315 |
| 99 | Ga0495651_0004960 | 3300046462 | Bacteria | 10167 |
| 100 | Ga0495651_0010010 | 3300046462 | Bacteria | 7287 |
| 101 | Ga0495651_0017151 | 3300046462 | Bacteria | 5611 |
| 102 | Ga0495580_0001943 | 3300046472 | Bacteria | 18146 |
| 103 | Ga0495580_0140430 | 3300046472 | Bacteria | 1674 |
| 104 | Ga0495605_0042276 | 3300046474 | Bacteria | 2266 |
| 105 | Ga0495639_0004730 | 3300046475 | Bacteria | 5854 |
| 106 | Ga0495662_0000623 | 3300046476 | Bacteria | 16457 |
| 107 | Ga0495662_0022142 | 3300046476 | Bacteria | 3070 |
| 108 | Ga0495662_0031945 | 3300046476 | Bacteria | 2542 |
| 109 | Ga0495662_0068584 | 3300046476 | Bacteria | 1717 |
| 110 | Ga0495664_0003044 | 3300046477 | Bacteria | 9075 |
| 111 | Ga0495585_0027058 | 3300046492 | Bacteria | 3274 |
| 112 | Ga0495594_0000286 | 3300046499 | Bacteria | 24943 |
| 113 | Ga0495594_0004800 | 3300046499 | Bacteria | 6965 |
| 114 | Ga0495594_0020583 | 3300046499 | Bacteria | 3514 |
| 115 | Ga0495594_0021757 | 3300046499 | Bacteria | 3424 |
| 116 | Ga0495607_0025967 | 3300046501 | Bacteria | 3638 |
| 117 | Ga0495606_0006676 | 3300046507 | Bacteria | 10578 |
| 118 | Ga0495606_0104695 | 3300046507 | Bacteria | 1716 |
| 119 | Ga0495616_0005965 | 3300046513 | Bacteria | 7431 |
| 120 | Ga0495620_0027209 | 3300046515 | Bacteria | 2679 |
| 121 | Ga0495628_0015345 | 3300046516 | Bacteria | 6397 |
| 122 | Ga0495630_0019140 | 3300046517 | Bacteria | 5032 |
| 123 | Ga0495630_0101821 | 3300046517 | Bacteria | 2173 |
| 124 | Ga0495631_0005572 | 3300046518 | Bacteria | 6583 |
| 125 | Ga0495643_0011079 | 3300046522 | Bacteria | 5511 |
| 126 | Ga0495648_0038903 | 3300046524 | Bacteria | 3034 |
| 127 | Ga0495666_0041244 | 3300046526 | Bacteria | 2235 |
| 128 | Ga0495652_0017694 | 3300046529 | Bacteria | 6360 |
| 129 | Ga0495652_0025453 | 3300046529 | Bacteria | 5235 |
| 130 | Ga0495654_0008093 | 3300046530 | Bacteria | 5830 |
| 131 | Ga0495665_0012479 | 3300046531 | Bacteria | 4597 |
| 132 | Ga0495665_0071862 | 3300046531 | Bacteria | 1822 |
| 133 | Ga0495640_0016176 | 3300046533 | Bacteria | 5584 |
| 134 | Ga0495640_0016178 | 3300046533 | Bacteria | 5583 |
| 135 | Ga0495586_0004747 | 3300046535 | Bacteria | 7266 |
| 136 | Ga0495587_0005935 | 3300046536 | Bacteria | 7966 |
| 137 | Ga0495609_0012734 | 3300046538 | Bacteria | 3986 |
| 138 | Ga0495645_0045173 | 3300046543 | Bacteria | 3214 |
| 139 | Ga0495645_0046675 | 3300046543 | Bacteria | 3157 |
| 140 | Ga0495622_0007330 | 3300046557 | Bacteria | 5122 |
| 141 | Ga0495622_0013498 | 3300046557 | Bacteria | 3787 |
| 142 | Ga0495622_0029077 | 3300046557 | Bacteria | 2582 |
| 143 | Ga0495633_0006935 | 3300046558 | Bacteria | 6622 |
| 144 | Ga0495633_0037275 | 3300046558 | Bacteria | 2326 |
| 145 | Ga0495667_0117490 | 3300046559 | Bacteria | 1718 |
| 146 | Ga0495668_0001911 | 3300046616 | Bacteria | 18567 |
| 147 | Ga0495668_0002290 | 3300046616 | Bacteria | 16093 |
| 148 | Ga0495634_0004506 | 3300046642 | Bacteria | 10923 |
| 149 | Ga0495611_0030281 | 3300046648 | Bacteria | 2378 |
| 150 | Ga0495611_0093872 | 3300046648 | Bacteria | 1388 |
| 151 | Ga0495625_0005228 | 3300046660 | Bacteria | 11947 |
| 152 | Ga0495625_0139364 | 3300046660 | Bacteria | 1637 |
| 153 | Ga0495635_0000593 | 3300046663 | Bacteria | 23305 |
| 154 | Ga0495635_0008165 | 3300046663 | Bacteria | 7310 |
| 155 | Ga0495588_0000886 | 3300046674 | Bacteria | 13206 |
| 156 | Ga0495588_0001238 | 3300046674 | Bacteria | 10989 |
| 157 | Ga0495588_0043454 | 3300046674 | Bacteria | 2300 |
| 158 | Ga0495588_0088664 | 3300046674 | Bacteria | 1619 |
| 159 | Ga0495657_0012317 | 3300046675 | Bacteria | 6355 |
| 160 | Ga0495599_0024982 | 3300046678 | Bacteria | 3737 |
| 161 | Ga0495623_0011672 | 3300046679 | Bacteria | 5690 |
| 162 | Ga0495623_0012415 | 3300046679 | Bacteria | 5516 |
| 163 | Ga0495646_0000467 | 3300046680 | Bacteria | 21506 |
| 164 | Ga0495613_0001168 | 3300046689 | Bacteria | 20054 |
| 165 | Ga0495613_0005478 | 3300046689 | Bacteria | 9534 |
| 166 | Ga0495613_0031758 | 3300046689 | Bacteria | 3922 |
| 167 | Ga0495613_0038193 | 3300046689 | Bacteria | 3559 |
| 168 | Ga0495613_0060460 | 3300046689 | Bacteria | 2775 |
| 169 | Ga0495613_0095792 | 3300046689 | Bacteria | 2146 |
| 170 | Ga0495624_0057154 | 3300046690 | Bacteria | 2453 |
| 171 | Ga0495670_0028241 | 3300046691 | Bacteria | 2781 |
| 172 | Ga0495671_0004258 | 3300046692 | Bacteria | 8608 |
| 173 | Ga0495589_0026783 | 3300046794 | Bacteria | 2920 |
| 174 | Ga0495589_0072978 | 3300046794 | Bacteria | 1675 |
| 175 | Ga0495589_0096662 | 3300046794 | Bacteria | 1431 |
| 176 | Ga0495600_0007857 | 3300046809 | Bacteria | 6531 |
| 177 | Ga0495600_0017527 | 3300046809 | Bacteria | 4557 |
| 178 | Ga0495660_0017550 | 3300046810 | Bacteria | 4119 |
| 179 | Ga0495581_0112267 | 3300047315 | Bacteria | 1585 |
| 180 | Ga0495604_0000568 | 3300047317 | Bacteria | 32485 |
| 181 | Ga0495604_0009303 | 3300047317 | Bacteria | 7780 |
| 182 | Ga0495604_0018446 | 3300047317 | Bacteria | 5587 |
| 183 | Ga0495636_0000607 | 3300047318 | Bacteria | 13137 |
| 184 | Ga0495636_0002589 | 3300047318 | Bacteria | 6950 |
| 185 | Ga0495636_0012773 | 3300047318 | Bacteria | 3327 |
| 186 | Ga0495674_0006318 | 3300047319 | Bacteria | 11361 |
| 187 | Ga0495674_0054406 | 3300047319 | Bacteria | 3515 |
| 188 | Ga0495676_0003786 | 3300047321 | Bacteria | 13749 |
| 189 | Ga0495676_0051577 | 3300047321 | Bacteria | 3289 |
| 190 | Ga0495680_0001987 | 3300047322 | Bacteria | 21488 |
| 191 | Ga0495683_0008549 | 3300047323 | Bacteria | 5474 |
| 192 | Ga0495683_0010620 | 3300047323 | Bacteria | 4859 |
| 193 | Ga0495687_001345 | 3300047443 | Bacteria | 22903 |
| 194 | Ga0495687_007903 | 3300047443 | Bacteria | 6182 |
| 195 | Ga0495675_0003104 | 3300047444 | Bacteria | 9976 |
| 196 | Ga0495675_0008871 | 3300047444 | Bacteria | 6244 |
| 197 | Ga0495675_0023980 | 3300047444 | Bacteria | 3888 |
| 198 | Ga0495679_036928 | 3300047446 | Bacteria | 1540 |
| 199 | Ga0495685_007684 | 3300047447 | Bacteria | 3564 |
| 200 | Ga0495685_033742 | 3300047447 | Bacteria | 1759 |
| 201 | Ga0495681_0002409 | 3300047470 | Bacteria | 13379 |
| 202 | Ga0495681_0006434 | 3300047470 | Bacteria | 7721 |
| 203 | Ga0495681_0019534 | 3300047470 | Bacteria | 3697 |
| 204 | Ga0495593_0000959 | 3300047673 | Bacteria | 16876 |
| 205 | Ga0495593_0026293 | 3300047673 | Bacteria | 3214 |
| 206 | Ga0495593_0061362 | 3300047673 | Bacteria | 1966 |
| 207 | Ga0495614_0000501 | 3300048089 | Bacteria | 15996 |
| 208 | Ga0495614_0019154 | 3300048089 | Bacteria | 2961 |
| 209 | Ga0495626_0000147 | 3300048091 | Bacteria | 87994 |
| 210 | Ga0495626_0005405 | 3300048091 | Bacteria | 7492 |
| 211 | Ga0496106_0025156 | 3300048909 | Bacteria | 4429 |
| 212 | Ga0501032_0084687 | 3300049569 | Bacteria | 2108 |
| 213 | Ga0501033_0016694 | 3300049570 | Bacteria | 5553 |
| 214 | Ga0501033_0028782 | 3300049570 | Bacteria | 4174 |
| 215 | Ga0501034_0042527 | 3300049571 | Bacteria | 4599 |
| 216 | Ga0501034_0110017 | 3300049571 | Bacteria | 2746 |
| 217 | Ga0501036_0012717 | 3300049572 | Bacteria | 6981 |
| 218 | Ga0501036_0153911 | 3300049572 | Bacteria | 1939 |
| 219 | Ga0501037_0012026 | 3300049573 | Bacteria | 6375 |
| 220 | Ga0501038_0020530 | 3300049574 | Bacteria | 5937 |
| 221 | Ga0501038_0025257 | 3300049574 | Bacteria | 5296 |
| 222 | Ga0501038_0034353 | 3300049574 | Bacteria | 4459 |
| 223 | Ga0501039_0003989 | 3300049575 | Bacteria | 11097 |
| 224 | Ga0501043_0009373 | 3300049579 | Bacteria | 7689 |
| 225 | Ga0501046_0010654 | 3300049580 | Bacteria | 7884 |
| 226 | Ga0501047_0059957 | 3300049581 | Bacteria | 3673 |
| 227 | Ga0501047_0075239 | 3300049581 | Bacteria | 3249 |
| 228 | Ga0501048_0029594 | 3300049582 | Bacteria | 3969 |
| 229 | Ga0501070_0001959 | 3300049586 | Bacteria | 18176 |
| 230 | Ga0501035_0001374 | 3300049822 | Bacteria | 25051 |
| 231 | Ga0501035_0164479 | 3300049822 | Bacteria | 1919 |
| 232 | Ga0501035_0188073 | 3300049822 | Bacteria | 1776 |
| 233 | Ga0501044_0004632 | 3300049823 | Bacteria | 15397 |
| 234 | Ga0501044_0008073 | 3300049823 | Bacteria | 11563 |
| 235 | Ga0501044_0019959 | 3300049823 | Bacteria | 7156 |
| 236 | Ga0501044_0024753 | 3300049823 | Bacteria | 6368 |
| 237 | Ga0501044_0203660 | 3300049823 | Bacteria | 1936 |
| 238 | Ga0501044_0250462 | 3300049823 | Bacteria | 1712 |
| 239 | nmdc:mga06z11_584_c1 | 3300050494 | Bacteria | 13334 |
| 240 | nmdc:mga04h51_465_c1 | 3300050495 | Bacteria | 9710 |
| 241 | Ga0495601_0008557 | 3300053077 | Bacteria | 6044 |
| 242 | Ga0495619_0016553 | 3300053085 | Bacteria | 4668 |
| 243 | Ga0500578_0038758 | 3300053086 | Bacteria | 3060 |
| 244 | Ga0500553_026394 | 3300053101 | Bacteria | 2924 |
| 245 | Ga0500553_073215 | 3300053101 | Bacteria | 1567 |
| 246 | Ga0500560_013434 | 3300053107 | Bacteria | 2152 |
| 247 | Ga0500569_003451 | 3300053109 | Bacteria | 3233 |
| 248 | Ga0500652_000893 | 3300053131 | Bacteria | 9834 |
| 249 | Ga0500658_0009361 | 3300053134 | Bacteria | 3613 |
| 250 | Ga0500561_0002806 | 3300053137 | Bacteria | 2960 |
| 251 | Ga0500600_0041889 | 3300053149 | Bacteria | 2640 |
| 252 | Ga0500616_0006946 | 3300053153 | Bacteria | 7290 |
| 253 | Ga0500633_0006025 | 3300053160 | Bacteria | 2939 |
| 254 | Ga0500634_0001642 | 3300053161 | Bacteria | 8857 |
| 255 | Ga0500636_0040793 | 3300053177 | Bacteria | 2745 |
| 256 | Ga0466962_0009844 | 3300061719 | Bacteria | 4585 |
| 257 | Ga0466962_0086215 | 3300061719 | Bacteria | 1503 |
| 258 | 2867478856 | 2867475112 | Bacteria | 6909112 |
| 259 | 2547408357 | 2547132111 | Bacteria | 8013147 |
| 260 | 2554256192 | 2554235005 | Bacteria | 6457341 |
| 261 | 2585296649 | 2582581312 | Bacteria | 7308206 |
| 262 | 2585309094 | 2582581313 | Bacteria | 10042643 |
| 263 | 2585319279 | 2582581314 | Bacteria | 11452267 |
| 264 | 2616697336 | 2616644814 | Bacteria | 11555299 |
| 265 | 2616903281 | 2616644941 | Bacteria | 8510691 |
| 266 | 2643764055 | 2643221548 | Bacteria | 8053412 |
| 267 | 2643902223 | 2643221578 | Bacteria | 9213798 |
| 268 | 2643943955 | 2643221587 | Bacteria | 7586415 |
| 269 | 2644017726 | 2643221601 | Bacteria | 7493239 |
| 270 | 2644173315 | 2643221631 | Bacteria | 8168043 |
| 271 | 2644265770 | 2643221647 | Bacteria | 10741251 |
| 272 | 2644386937 | 2643221670 | Bacteria | 6497041 |
| 273 | 2644406622 | 2643221673 | Bacteria | 9196637 |
| 274 | 2644434692 | 2643221677 | Bacteria | 7584031 |
| 275 | 2644440088 | 2643221678 | Bacteria | 9540101 |
| 276 | 2644461513 | 2643221682 | Bacteria | 6743283 |
| 277 | 2644632591 | 2643221714 | Bacteria | 9015452 |
| 278 | 2738887847 | 2738541308 | Bacteria | 7020677 |
| 279 | 2739235718 | 2738543011 | Bacteria | 5731169 |
| 280 | 2768642942 | 2767802112 | Bacteria | 6465194 |
| 281 | 2784590447 | 2784132148 | Bacteria | 8627943 |
| 282 | 2785341166 | 2784746763 | Bacteria | 9783172 |
| 283 | 2785371539 | 2784746768 | Bacteria | 10036182 |
| 284 | 2786672703 | 2786546132 | Bacteria | 10419719 |
| 285 | 2793983607 | 2791355406 | Bacteria | 11364898 |
| 286 | 2804847947 | 2802429296 | Bacteria | 7227771 |
| 287 | 2808844065 | 2808606359 | Bacteria | 9866990 |
| 288 | 2808913659 | 2808606375 | Bacteria | 9466072 |
| 289 | 2809234120 | 2808606448 | Bacteria | 8656184 |
| 290 | 2811844372 | 2808606982 | Bacteria | 7791042 |
| 291 | 2812355910 | 2811994879 | Bacteria | 9313447 |
| 292 | 2812478717 | 2811994917 | Bacteria | 7761064 |
| 293 | 2819694591 | 2818991463 | Bacteria | 7948711 |
| 294 | 2819740609 | 2818991472 | Bacteria | 10089953 |
| 295 | 2852641055 | 2852635781 | Bacteria | 8251373 |
| 296 | 2862186451 | 2862178590 | Bacteria | 8583590 |
| 297 | 2862284703 | 2862281513 | Bacteria | 9621493 |
| 298 | 2862293532 | 2862290372 | Bacteria | 7471434 |
| 299 | 2862391187 | 2862382967 | Bacteria | 10317375 |
| 300 | 2862512644 | 2862507626 | Bacteria | 9425308 |
| 301 | 2862577473 | 2862574272 | Bacteria | 10567477 |
| 302 | 2862705608 | 2862705112 | Bacteria | 6563286 |
| 303 | 2863408653 | 2863404153 | Bacteria | 9672205 |
| 304 | 2867349135 | 2867346516 | Bacteria | 7608576 |
| 305 | 2867373903 | 2867369537 | Bacteria | 6501581 |
| 306 | 2867429428 | 2867428634 | Bacteria | 9590268 |
| 307 | 2873154017 | 2873151551 | Bacteria | 8625867 |
| 308 | 2875396737 | 2875391855 | Bacteria | 7600475 |
| 309 | 2877679066 | 2877676314 | Bacteria | 9512378 |
| 310 | 2889305314 | 2889300758 | Bacteria | 5690814 |
| 311 | 2912717581 | 2912715099 | Bacteria | 9460473 |
| 312 | 2912730124 | 2912723979 | Bacteria | 8557534 |
| 313 | 2912762790 | 2912757875 | Bacteria | 7940295 |
| 314 | 2918506546 | 2918501144 | Bacteria | 8668083 |
| 315 | 2919471770 | 2919468124 | Bacteria | 9133025 |
| 316 | 2939746826 | 2939743619 | Bacteria | 5762299 |
| 317 | 2946047820 | 2946045630 | Bacteria | 8527308 |
| 318 | 2946069877 | 2946064051 | Bacteria | 8957905 |
| 319 | 2946077798 | 2946072368 | Bacteria | 8999607 |
| 320 | 2947226911 | 2947224130 | Bacteria | 9938529 |
| 321 | 2954383969 | 2954380949 | Bacteria | 10050426 |
| 322 | 2954678996 | 2954673503 | Bacteria | 9685905 |
| 323 | 2954685156 | 2954682443 | Bacteria | 9862841 |
| 324 | 2954694765 | 2954691527 | Bacteria | 10720516 |
| 325 | 2954709967 | 2954701450 | Bacteria | 10834262 |
| 326 | 2954714275 | 2954711539 | Bacteria | 10867210 |
| 327 | 2954724224 | 2954721474 | Bacteria | 10456478 |
| 328 | 2954737615 | 2954731030 | Bacteria | 10243860 |
| 329 | 2954743121 | 2954740390 | Bacteria | 10229294 |
| 330 | 2954756449 | 2954749733 | Bacteria | 10366972 |
| 331 | 2954762079 | 2954759201 | Bacteria | 9358192 |
| 332 | 2966600824 | 2966598605 | Bacteria | 7676064 |
| 333 | 2990047346 | 2990044586 | Bacteria | 6603797 |
| 334 | 2990062980 | 2990059506 | Bacteria | 9321252 |
| 335 | 2995467096 | 2995463766 | Bacteria | 8577691 |
| 336 | 2997452908 | 2997451912 | Bacteria | 8492419 |
| 337 | 3006398616 | 3006393351 | Bacteria | 6615579 |
| 338 | 3006500155 | 3006493962 | Bacteria | 8825450 |
| 339 | 8008491572 | 8008485437 | Bacteria | 7198341 |
| 340 | 8008562826 | 8008558824 | Bacteria | 10610750 |
| 341 | 8008577133 | 8008574985 | Bacteria | 7815457 |
| 342 | 8023629621 | 8023623736 | Bacteria | 8593882 |
| 343 | 8025419739 | 8025413630 | Bacteria | 7014048 |
| 344 | 8025524628 | 8025524527 | Bacteria | 7197316 |
| 345 | 8025536240 | 8025530807 | Bacteria | 8495698 |
| 346 | 8047896070 | 8047893842 | Bacteria | 11723082 |
| 347 | 8048132231 | 8048127548 | Bacteria | 11053136 |
| 348 | 8048362865 | 8048356638 | Bacteria | 11044339 |
| 349 | 8048373095 | 8048369669 | Bacteria | 11666822 |
| 350 | 8048382028 | 8048379754 | Bacteria | 11877923 |
| 351 | 8048411692 | 8048406513 | Bacteria | 8936924 |
| 352 | 8054166409 | 8054160619 | Bacteria | 7783213 |
| 353 | 8056453767 | 8056447290 | Bacteria | 7680491 |
| 354 | 8056672525 | 8056667051 | Bacteria | 6953971 |
| 355 | 8056832236 | 8056829672 | Bacteria | 9045328 |
| 356 | JGI24739J22299_10006951 | |||
| 357 | JGI24738J21930_10004456 | |||
| 358 | rootH1_10012038 | |||
| 359 | rootL2_10223465 | |||
| 360 | JGI25160J50197_1014543 | |||
| 361 | Ga0006562J51391_1039762 | |||
| 362 | Ga0075367_10018025 | |||
| 363 | Ga0105243_10007965 | |||
| 364 | Ga0105243_10166207 | |||
| 365 | Ga0105246_10011517 | |||
| 366 | Ga0157372_10069223 | |||
| 367 | Ga0157375_10360472 | |||
| 368 | Ga0182008_10001944 | |||
| 369 | Ga0182007_10001129 | |||
| 370 | Ga0183367_1002 | |||
| 371 | Ga0209758_1005727 | |||
| 372 | Ga0207426_1001550 | |||
| 373 | Ga0207426_1004878 | |||
| 374 | Ga0207426_1011723 | |||
| 375 | Ga0207709_10024363 | |||
| 376 | Ga0207709_10043627 | |||
| 377 | Ga0209371_1016892 | |||
| 378 | Ga0268266_10054200 | |||
| 379 | Ga0307515_10000813 | |||
| 380 | Ga0268256_1012995 | |||
| 381 | Ga0307511_10004464 | |||
| 382 | Ga0307511_10071227 | |||
| 383 | Ga0307512_10007235 | |||
| 384 | Ga0307513_10069071 | |||
| 385 | Ga0307509_10027685 | |||
| 386 | Ga0307508_10021420 | |||
| 387 | Ga0307508_10031151 | |||
| 388 | Ga0307508_10048234 | |||
| 389 | Ga0307514_10010235 | |||
| 390 | Ga0307516_10005589 | |||
| 391 | Ga0307516_10020546 | |||
| 392 | Ga0307507_10009383 | |||
| 393 | Ga0307507_10046849 | |||
| 394 | Ga0307510_10014326 | |||
| 395 | Ga0307510_10036791 | |||
| 396 | Ga0395900_0146293 | |||
| 397 | Ga0395898_0003519 | |||
| 398 | Ga0395898_0018379 | |||
| 399 | Ga0439436_0004934 | |||
| 400 | Ga0439439_0002532 | |||
| 401 | Ga0439439_0013510 | |||
| 402 | Ga0451853_0167257 | |||
| 403 | Ga0439433_0004675 | |||
| 404 | Ga0439448_0000943 | |||
| 405 | Ga0439449_0000560 | |||
| 406 | Ga0439449_0011497 | |||
| 407 | Ga0439455_0002205 | |||
| 408 | Ga0439457_000023 | |||
| 409 | Ga0439457_000345 | |||
| 410 | Ga0439462_0006841 | |||
| 411 | Ga0450894_001546 | |||
| 412 | Ga0450903_000025 | |||
| 413 | Ga0439458_0003203 | |||
| 414 | Ga0466972_0003732 | |||
| 415 | Ga0466972_0007707 | |||
| 416 | Ga0466966_0011160 | |||
| 417 | Ga0466966_0022122 | |||
| 418 | Ga0466966_0030065 | |||
| 419 | Ga0466961_0002889 | |||
| 420 | Ga0466961_0009353 | |||
| 421 | Ga0466961_0010577 | |||
| 422 | Ga0466961_0024083 | |||
| 423 | Ga0466963_0002615 | |||
| 424 | Ga0466963_0014972 | |||
| 425 | Ga0466964_0026694 | |||
| 426 | Ga0466971_0000670 | |||
| 427 | Ga0466971_0061231 | |||
| 428 | Ga0466970_0001736 | |||
| 429 | Ga0466957_0002024 | |||
| 430 | Ga0466960_0003534 | |||
| 431 | Ga0466959_0008079 | |||
| 432 | Ga0466959_0011846 | |||
| 433 | Ga0466958_0001505 | |||
| 434 | Ga0466967_0004981 | |||
| 435 | Ga0466967_0007604 | |||
| 436 | Ga0466967_0011001 | |||
| 437 | Ga0495617_007492 | |||
| 438 | Ga0495627_010639 | |||
| 439 | Ga0495592_0033971 | |||
| 440 | Ga0495592_0040562 | |||
| 441 | Ga0495603_0003304 | |||
| 442 | Ga0495603_0018504 | |||
| 443 | Ga0495603_0020480 | |||
| 444 | Ga0495603_0044896 | |||
| 445 | Ga0495629_0001224 | |||
| 446 | Ga0495629_0002206 | |||
| 447 | Ga0495629_0014641 | |||
| 448 | Ga0495629_0034473 | |||
| 449 | Ga0495629_0073161 | |||
| 450 | Ga0495629_0144881 | |||
| 451 | Ga0495638_0012643 | |||
| 452 | Ga0495638_0030633 | |||
| 453 | Ga0495638_0157103 | |||
| 454 | Ga0495651_0004960 | |||
| 455 | Ga0495651_0010010 | |||
| 456 | Ga0495651_0017151 | |||
| 457 | Ga0495580_0001943 | |||
| 458 | Ga0495580_0140430 | |||
| 459 | Ga0495605_0042276 | |||
| 460 | Ga0495639_0004730 | |||
| 461 | Ga0495662_0000623 | |||
| 462 | Ga0495662_0022142 | |||
| 463 | Ga0495662_0031945 | |||
| 464 | Ga0495662_0068584 | |||
| 465 | Ga0495664_0003044 | |||
| 466 | Ga0495585_0027058 | |||
| 467 | Ga0495594_0000286 | |||
| 468 | Ga0495594_0004800 | |||
| 469 | Ga0495594_0020583 | |||
| 470 | Ga0495594_0021757 | |||
| 471 | Ga0495607_0025967 | |||
| 472 | Ga0495606_0006676 | |||
| 473 | Ga0495606_0104695 | |||
| 474 | Ga0495616_0005965 | |||
| 475 | Ga0495620_0027209 | |||
| 476 | Ga0495628_0015345 | |||
| 477 | Ga0495630_0019140 | |||
| 478 | Ga0495630_0101821 | |||
| 479 | Ga0495631_0005572 | |||
| 480 | Ga0495643_0011079 | |||
| 481 | Ga0495648_0038903 | |||
| 482 | Ga0495666_0041244 | |||
| 483 | Ga0495652_0017694 | |||
| 484 | Ga0495652_0025453 | |||
| 485 | Ga0495654_0008093 | |||
| 486 | Ga0495665_0012479 | |||
| 487 | Ga0495665_0071862 | |||
| 488 | Ga0495640_0016176 | |||
| 489 | Ga0495640_0016178 | |||
| 490 | Ga0495586_0004747 | |||
| 491 | Ga0495587_0005935 | |||
| 492 | Ga0495609_0012734 | |||
| 493 | Ga0495645_0045173 | |||
| 494 | Ga0495645_0046675 | |||
| 495 | Ga0495622_0007330 | |||
| 496 | Ga0495622_0013498 | |||
| 497 | Ga0495622_0029077 | |||
| 498 | Ga0495633_0006935 | |||
| 499 | Ga0495633_0037275 | |||
| 500 | Ga0495667_0117490 | |||
| 501 | Ga0495668_0001911 | |||
| 502 | Ga0495668_0002290 | |||
| 503 | Ga0495634_0004506 | |||
| 504 | Ga0495611_0030281 | |||
| 505 | Ga0495611_0093872 | |||
| 506 | Ga0495625_0005228 | |||
| 507 | Ga0495625_0139364 | |||
| 508 | Ga0495635_0000593 | |||
| 509 | Ga0495635_0008165 | |||
| 510 | Ga0495588_0000886 | |||
| 511 | Ga0495588_0001238 | |||
| 512 | Ga0495588_0043454 | |||
| 513 | Ga0495588_0088664 | |||
| 514 | Ga0495657_0012317 | |||
| 515 | Ga0495599_0024982 | |||
| 516 | Ga0495623_0011672 | |||
| 517 | Ga0495623_0012415 | |||
| 518 | Ga0495646_0000467 | |||
| 519 | Ga0495613_0001168 | |||
| 520 | Ga0495613_0005478 | |||
| 521 | Ga0495613_0031758 | |||
| 522 | Ga0495613_0038193 | |||
| 523 | Ga0495613_0060460 | |||
| 524 | Ga0495613_0095792 | |||
| 525 | Ga0495624_0057154 | |||
| 526 | Ga0495670_0028241 | |||
| 527 | Ga0495671_0004258 | |||
| 528 | Ga0495589_0026783 | |||
| 529 | Ga0495589_0072978 | |||
| 530 | Ga0495589_0096662 | |||
| 531 | Ga0495600_0007857 | |||
| 532 | Ga0495600_0017527 | |||
| 533 | Ga0495660_0017550 | |||
| 534 | Ga0495581_0112267 | |||
| 535 | Ga0495604_0000568 | |||
| 536 | Ga0495604_0009303 | |||
| 537 | Ga0495604_0018446 | |||
| 538 | Ga0495636_0000607 | |||
| 539 | Ga0495636_0002589 | |||
| 540 | Ga0495636_0012773 | |||
| 541 | Ga0495674_0006318 | |||
| 542 | Ga0495674_0054406 | |||
| 543 | Ga0495676_0003786 | |||
| 544 | Ga0495676_0051577 | |||
| 545 | Ga0495680_0001987 | |||
| 546 | Ga0495683_0008549 | |||
| 547 | Ga0495683_0010620 | |||
| 548 | Ga0495687_001345 | |||
| 549 | Ga0495687_007903 | |||
| 550 | Ga0495675_0003104 | |||
| 551 | Ga0495675_0008871 | |||
| 552 | Ga0495675_0023980 | |||
| 553 | Ga0495679_036928 | |||
| 554 | Ga0495685_007684 | |||
| 555 | Ga0495685_033742 | |||
| 556 | Ga0495681_0002409 | |||
| 557 | Ga0495681_0006434 | |||
| 558 | Ga0495681_0019534 | |||
| 559 | Ga0495593_0000959 | |||
| 560 | Ga0495593_0026293 | |||
| 561 | Ga0495593_0061362 | |||
| 562 | Ga0495614_0000501 | |||
| 563 | Ga0495614_0019154 | |||
| 564 | Ga0495626_0000147 | |||
| 565 | Ga0495626_0005405 | |||
| 566 | Ga0496106_0025156 | |||
| 567 | Ga0501032_0084687 | |||
| 568 | Ga0501033_0016694 | |||
| 569 | Ga0501033_0028782 | |||
| 570 | Ga0501034_0042527 | |||
| 571 | Ga0501034_0110017 | |||
| 572 | Ga0501036_0012717 | |||
| 573 | Ga0501036_0153911 | |||
| 574 | Ga0501037_0012026 | |||
| 575 | Ga0501038_0020530 | |||
| 576 | Ga0501038_0025257 | |||
| 577 | Ga0501038_0034353 | |||
| 578 | Ga0501039_0003989 | |||
| 579 | Ga0501043_0009373 | |||
| 580 | Ga0501046_0010654 | |||
| 581 | Ga0501047_0059957 | |||
| 582 | Ga0501047_0075239 | |||
| 583 | Ga0501048_0029594 | |||
| 584 | Ga0501070_0001959 | |||
| 585 | Ga0501035_0001374 | |||
| 586 | Ga0501035_0164479 | |||
| 587 | Ga0501035_0188073 | |||
| 588 | Ga0501044_0004632 | |||
| 589 | Ga0501044_0008073 | |||
| 590 | Ga0501044_0019959 | |||
| 591 | Ga0501044_0024753 | |||
| 592 | Ga0501044_0203660 | |||
| 593 | Ga0501044_0250462 | |||
| 594 | nmdc:mga06z11_584_c1 | |||
| 595 | nmdc:mga04h51_465_c1 | |||
| 596 | Ga0495601_0008557 | |||
| 597 | Ga0495619_0016553 | |||
| 598 | Ga0500578_0038758 | |||
| 599 | Ga0500553_026394 | |||
| 600 | Ga0500553_073215 | |||
| 601 | Ga0500560_013434 | |||
| 602 | Ga0500569_003451 | |||
| 603 | Ga0500652_000893 | |||
| 604 | Ga0500658_0009361 | |||
| 605 | Ga0500561_0002806 | |||
| 606 | Ga0500600_0041889 | |||
| 607 | Ga0500616_0006946 | |||
| 608 | Ga0500633_0006025 | |||
| 609 | Ga0500634_0001642 | |||
| 610 | Ga0500636_0040793 | |||
| 611 | Ga0466962_0009844 | |||
| 612 | Ga0466962_0086215 | |||
| 613 | 2867478856 | |||
| 614 | 2547408357 | |||
| 615 | 2554256192 | |||
| 616 | 2585296649 | |||
| 617 | 2585309094 | |||
| 618 | 2585319279 | |||
| 619 | 2616697336 | |||
| 620 | 2616903281 | |||
| 621 | 2643764055 | |||
| 622 | 2643902223 | |||
| 623 | 2643943955 | |||
| 624 | 2644017726 | |||
| 625 | 2644173315 | |||
| 626 | 2644265770 | |||
| 627 | 2644386937 | |||
| 628 | 2644406622 | |||
| 629 | 2644434692 | |||
| 630 | 2644440088 | |||
| 631 | 2644461513 | |||
| 632 | 2644632591 | |||
| 633 | 2738887847 | |||
| 634 | 2739235718 | |||
| 635 | 2768642942 | |||
| 636 | 2784590447 | |||
| 637 | 2785341166 | |||
| 638 | 2785371539 | |||
| 639 | 2786672703 | |||
| 640 | 2793983607 | |||
| 641 | 2804847947 | |||
| 642 | 2808844065 | |||
| 643 | 2808913659 | |||
| 644 | 2809234120 | |||
| 645 | 2811844372 | |||
| 646 | 2812355910 | |||
| 647 | 2812478717 | |||
| 648 | 2819694591 | |||
| 649 | 2819740609 | |||
| 650 | 2852641055 | |||
| 651 | 2862186451 | |||
| 652 | 2862284703 | |||
| 653 | 2862293532 | |||
| 654 | 2862391187 | |||
| 655 | 2862512644 | |||
| 656 | 2862577473 | |||
| 657 | 2862705608 | |||
| 658 | 2863408653 | |||
| 659 | 2867349135 | |||
| 660 | 2867373903 | |||
| 661 | 2867429428 | |||
| 662 | 2873154017 | |||
| 663 | 2875396737 | |||
| 664 | 2877679066 | |||
| 665 | 2889305314 | |||
| 666 | 2912717581 | |||
| 667 | 2912730124 | |||
| 668 | 2912762790 | |||
| 669 | 2918506546 | |||
| 670 | 2919471770 | |||
| 671 | 2939746826 | |||
| 672 | 2946047820 | |||
| 673 | 2946069877 | |||
| 674 | 2946077798 | |||
| 675 | 2947226911 | |||
| 676 | 2954383969 | |||
| 677 | 2954678996 | |||
| 678 | 2954685156 | |||
| 679 | 2954694765 | |||
| 680 | 2954709967 | |||
| 681 | 2954714275 | |||
| 682 | 2954724224 | |||
| 683 | 2954737615 | |||
| 684 | 2954743121 | |||
| 685 | 2954756449 | |||
| 686 | 2954762079 | |||
| 687 | 2966600824 | |||
| 688 | 2990047346 | |||
| 689 | 2990062980 | |||
| 690 | 2995467096 | |||
| 691 | 2997452908 | |||
| 692 | 3006398616 | |||
| 693 | 3006500155 | |||
| 694 | 8008491572 | |||
| 695 | 8008562826 | |||
| 696 | 8008577133 | |||
| 697 | 8023629621 | |||
| 698 | 8025419739 | |||
| 699 | 8025524628 | |||
| 700 | 8025536240 | |||
| 701 | 8047896070 | |||
| 702 | 8048132231 | |||
| 703 | 8048362865 | |||
| 704 | 8048373095 | |||
| 705 | 8048382028 | |||
| 706 | 8048411692 | |||
| 707 | 8054166409 | |||
| 708 | 8056453767 | |||
| 709 | 8056672525 | |||
| 710 | 8056832236 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rja-assembly1.cif.gz_F | cryo-em structure of st1cas9-sgrna-tdna20-acriia6 dimeric assembly. | 0.9503 | 5 | 31 |
| 4dq8-assembly1.cif.gz_A | crystal structure of acetate kinase acka from mycobacterium marinum | 0.9355 | 4 | 397 |
| 4dq8-assembly1.cif.gz_B | crystal structure of acetate kinase acka from mycobacterium marinum | 0.9342 | 5 | 397 |
| 4dq8-assembly1.cif.gz_A | crystal structure of acetate kinase acka from mycobacterium marinum | 0.9259 | 4 | 397 |
| 3khy-assembly1.cif.gz_B | crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 | 0.9253 | 4 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3khyB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9614 | 4 | 198 | 3.30.420.40 |
| 3khyB01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9515 | 4 | 198 | 3.30.420.40 |
| 4dq8B01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9442 | 5 | 199 | 3.30.420.40 |
| 4dq8B01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9284 | 5 | 199 | 3.30.420.40 |
| 2iirA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9246 | 5 | 199 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D4LF57-F1-model_v4 | Uncharacterized protein | 0.9732 | 1 | 182 |
GO:0005524
GO:0006083 GO:0008776 GO:0047761 |
| AF-A0A6G3WLC5-F1-model_v4 | Acetate kinase | 0.9665 | 89 | 187 |
GO:0006083
GO:0008776 |
| AF-A0A7W0PLE0-F1-model_v4 | Acetate kinase | 0.9633 | 5 | 150 |
GO:0005524
GO:0006083 GO:0008776 |
| AF-A0A269XEC3-F1-model_v4 | butyrate kinase (EC 2.7.2.7) | 0.961 | 145 | 232 |
GO:0005524
GO:0006083 GO:0008776 GO:0047761 |
| AF-F4MWZ3-F1-model_v4 | Uncharacterized protein | 0.96 | 101 | 232 |
GO:0005524
GO:0006083 GO:0008776 GO:0047761 |