F420339

General Info

Members Datasets Scaffolds Average Seq Length
355 253 710 402

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2867475112|2867478856
Length 402
Sequence ATRVLVLNSGSSSLKYQLLDMHDGARLAAGLVERIGEETSRLAHTPLATGGDTRETEGPIADHTTALKAVAAELAADGLGLDSPQLAAIGHRVVHGGLQFTEPTVIDDAVLTEIERLVPLAPLHNPANITGIRTARALRPDLPQVAVFDTAFHTTMPEHAARYALDVATADAHRIRRYGFHGTSHAYVSRRTAALLGKDPSEVNVIVLHLGNGASASAVAGGRCVDTSMGLTPLEGLVMGTRSGDIDPAVTFHLKRVAGMSEDEVDELLNKKSGLIGLCGDNDMREIRRRIDAGGEDGARAQLAFDIYIHRLKKYLGAYTAVLGRVDAVAFTAGVGENAAPVRAAALAGLEQLGMAVDADRNAVRSDEPRLISPEGSRVAVAVVPTDEELEIAQQTYALVSA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
11 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
14 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
15 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
22 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
23 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
24 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
25 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
26 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
27 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
28 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
29 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
30 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
31 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
32 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
33 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
34 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
35 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
36 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
37 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
38 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
39 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
40 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
41 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
42 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
43 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
50 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
58 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
61 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
64 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
65 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
70 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
145 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
146 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
147 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
150 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
153 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
154 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2867475112 Streptomyces sp. TM32 Isolate Unclassified
157 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
158 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
159 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
160 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
161 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
162 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
163 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
164 2643221548 Streptomyces sp. Root55 Isolate Unclassified
165 2643221578 Streptomyces sp. Root63 Isolate Unclassified
166 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
167 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
168 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
169 2643221647 Streptomyces sp. Root369 Isolate Unclassified
170 2643221670 Streptomyces sp. Root431 Isolate Unclassified
171 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
172 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
173 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
174 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
175 2643221714 Streptomyces sp. Root264 Isolate Unclassified
176 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
177 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
178 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
179 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
180 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
181 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
182 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
183 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
184 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
185 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
186 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
187 2808606448 Streptomyces sp. 193411 Isolate Unclassified
188 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
189 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
190 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
191 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
192 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
193 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
194 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
195 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
196 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
197 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
198 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
199 2862574272 Streptomyces sp. AcE210 Isolate Nodule
200 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
201 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
202 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
203 2867369537 Streptomyces sp. Z26 Isolate Unclassified
204 2867428634 Streptomyces sp. RP5T Isolate Unclassified
205 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
206 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
207 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
208 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
209 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
210 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
211 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
212 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
213 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
214 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
215 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
216 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
217 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
218 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
219 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
220 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
221 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
222 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
223 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
224 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
225 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
226 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
227 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
228 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
229 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
230 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
231 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
232 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
233 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
234 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
235 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
236 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
237 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
238 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
239 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
240 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
241 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
242 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
243 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
244 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
245 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
246 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
247 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
248 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
249 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
250 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
251 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
252 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
253 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.11
Metatranscriptomes 0.28
Isolates 27.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.92
Nodule 0.85
Rhizoplane 0.56
Rhizosphere 75.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10006951 3300001989 Bacteria 4264
2 JGI24738J21930_10004456 3300002075 Bacteria 3428
3 rootH1_10012038 3300003316 Bacteria 2215
4 rootL2_10223465 3300003322 Bacteria 1481
5 JGI25160J50197_1014543 3300003354 Bacteria 2628
6 Ga0006562J51391_1039762 3300003578 Bacteria 3247
7 Ga0075367_10018025 3300006178 Bacteria 3888
8 Ga0105243_10007965 3300009148 Bacteria 8141
9 Ga0105243_10166207 3300009148 Bacteria 1907
10 Ga0105246_10011517 3300011119 Bacteria 5489
11 Ga0157372_10069223 3300013307 Bacteria 3969
12 Ga0157375_10360472 3300013308 Bacteria 1620
13 Ga0182008_10001944 3300014497 Bacteria 13339
14 Ga0182007_10001129 3300015262 Bacteria 14468
15 Ga0183367_1002 3300015688 Bacteria 1101531
16 Ga0209758_1005727 3300025297 Bacteria 9364
17 Ga0207426_1001550 3300025302 Bacteria 18675
18 Ga0207426_1004878 3300025302 Bacteria 6349
19 Ga0207426_1011723 3300025302 Bacteria 3322
20 Ga0207709_10024363 3300025935 Bacteria 3455
21 Ga0207709_10043627 3300025935 Bacteria 2705
22 Ga0209371_1016892 3300027312 Bacteria 1910
23 Ga0268266_10054200 3300028379 Bacteria 3446
24 Ga0307515_10000813 3300028794 Bacteria 71821
25 Ga0268256_1012995 3300030500 Bacteria 2548
26 Ga0307511_10004464 3300030521 Bacteria 14287
27 Ga0307511_10071227 3300030521 Bacteria 2538
28 Ga0307512_10007235 3300030522 Bacteria 11045
29 Ga0307513_10069071 3300031456 Bacteria 3698
30 Ga0307509_10027685 3300031507 Bacteria 6305
31 Ga0307508_10021420 3300031616 Bacteria 5876
32 Ga0307508_10031151 3300031616 Bacteria 4822
33 Ga0307508_10048234 3300031616 Bacteria 3794
34 Ga0307514_10010235 3300031649 Bacteria 7851
35 Ga0307516_10005589 3300031730 Bacteria 14975
36 Ga0307516_10020546 3300031730 Bacteria 6820
37 Ga0307507_10009383 3300033179 Bacteria 13065
38 Ga0307507_10046849 3300033179 Bacteria 4232
39 Ga0307510_10014326 3300033180 Bacteria 9389
40 Ga0307510_10036791 3300033180 Bacteria 5444
41 Ga0395900_0146293 3300037418 Bacteria 2416
42 Ga0395898_0003519 3300037466 Bacteria 17456
43 Ga0395898_0018379 3300037466 Bacteria 7129
44 Ga0439436_0004934 3300041404 Bacteria 4094
45 Ga0439439_0002532 3300041406 Bacteria 3901
46 Ga0439439_0013510 3300041406 Bacteria 1979
47 Ga0451853_0167257 3300041512 Bacteria 2217
48 Ga0439433_0004675 3300041999 Bacteria 2942
49 Ga0439448_0000943 3300042005 Bacteria 7162
50 Ga0439449_0000560 3300042007 Bacteria 13978
51 Ga0439449_0011497 3300042007 Bacteria 3329
52 Ga0439455_0002205 3300042012 Bacteria 3487
53 Ga0439457_000023 3300042014 Bacteria 30792
54 Ga0439457_000345 3300042014 Bacteria 12934
55 Ga0439462_0006841 3300042015 Bacteria 2844
56 Ga0450894_001546 3300042131 Bacteria 3262
57 Ga0450903_000025 3300042138 Bacteria 29994
58 Ga0439458_0003203 3300042157 Bacteria 3877
59 Ga0466972_0003732 3300044658 Bacteria 7576
60 Ga0466972_0007707 3300044658 Bacteria 5406
61 Ga0466966_0011160 3300044684 Bacteria 5959
62 Ga0466966_0022122 3300044684 Bacteria 4174
63 Ga0466966_0030065 3300044684 Bacteria 3529
64 Ga0466961_0002889 3300044693 Bacteria 10655
65 Ga0466961_0009353 3300044693 Bacteria 6242
66 Ga0466961_0010577 3300044693 Bacteria 5886
67 Ga0466961_0024083 3300044693 Bacteria 3917
68 Ga0466963_0002615 3300044694 Bacteria 10108
69 Ga0466963_0014972 3300044694 Bacteria 4792
70 Ga0466964_0026694 3300044706 Bacteria 2262
71 Ga0466971_0000670 3300044719 Bacteria 13647
72 Ga0466971_0061231 3300044719 Bacteria 1701
73 Ga0466970_0001736 3300044765 Bacteria 10505
74 Ga0466957_0002024 3300044842 Bacteria 10802
75 Ga0466960_0003534 3300044901 Bacteria 6019
76 Ga0466959_0008079 3300045049 Bacteria 7419
77 Ga0466959_0011846 3300045049 Bacteria 6279
78 Ga0466958_0001505 3300045836 Bacteria 11146
79 Ga0466967_0004981 3300045976 Bacteria 9093
80 Ga0466967_0007604 3300045976 Bacteria 7836
81 Ga0466967_0011001 3300045976 Bacteria 6825
82 Ga0495617_007492 3300046452 Bacteria 3787
83 Ga0495627_010639 3300046453 Bacteria 3335
84 Ga0495592_0033971 3300046454 Bacteria 3846
85 Ga0495592_0040562 3300046454 Bacteria 3494
86 Ga0495603_0003304 3300046455 Bacteria 9600
87 Ga0495603_0018504 3300046455 Bacteria 4214
88 Ga0495603_0020480 3300046455 Bacteria 4008
89 Ga0495603_0044896 3300046455 Bacteria 2636
90 Ga0495629_0001224 3300046459 Bacteria 20148
91 Ga0495629_0002206 3300046459 Bacteria 15016
92 Ga0495629_0014641 3300046459 Bacteria 5643
93 Ga0495629_0034473 3300046459 Bacteria 3578
94 Ga0495629_0073161 3300046459 Bacteria 2393
95 Ga0495629_0144881 3300046459 Bacteria 1652
96 Ga0495638_0012643 3300046460 Bacteria 5776
97 Ga0495638_0030633 3300046460 Bacteria 3461
98 Ga0495638_0157103 3300046460 Bacteria 1315
99 Ga0495651_0004960 3300046462 Bacteria 10167
100 Ga0495651_0010010 3300046462 Bacteria 7287
101 Ga0495651_0017151 3300046462 Bacteria 5611
102 Ga0495580_0001943 3300046472 Bacteria 18146
103 Ga0495580_0140430 3300046472 Bacteria 1674
104 Ga0495605_0042276 3300046474 Bacteria 2266
105 Ga0495639_0004730 3300046475 Bacteria 5854
106 Ga0495662_0000623 3300046476 Bacteria 16457
107 Ga0495662_0022142 3300046476 Bacteria 3070
108 Ga0495662_0031945 3300046476 Bacteria 2542
109 Ga0495662_0068584 3300046476 Bacteria 1717
110 Ga0495664_0003044 3300046477 Bacteria 9075
111 Ga0495585_0027058 3300046492 Bacteria 3274
112 Ga0495594_0000286 3300046499 Bacteria 24943
113 Ga0495594_0004800 3300046499 Bacteria 6965
114 Ga0495594_0020583 3300046499 Bacteria 3514
115 Ga0495594_0021757 3300046499 Bacteria 3424
116 Ga0495607_0025967 3300046501 Bacteria 3638
117 Ga0495606_0006676 3300046507 Bacteria 10578
118 Ga0495606_0104695 3300046507 Bacteria 1716
119 Ga0495616_0005965 3300046513 Bacteria 7431
120 Ga0495620_0027209 3300046515 Bacteria 2679
121 Ga0495628_0015345 3300046516 Bacteria 6397
122 Ga0495630_0019140 3300046517 Bacteria 5032
123 Ga0495630_0101821 3300046517 Bacteria 2173
124 Ga0495631_0005572 3300046518 Bacteria 6583
125 Ga0495643_0011079 3300046522 Bacteria 5511
126 Ga0495648_0038903 3300046524 Bacteria 3034
127 Ga0495666_0041244 3300046526 Bacteria 2235
128 Ga0495652_0017694 3300046529 Bacteria 6360
129 Ga0495652_0025453 3300046529 Bacteria 5235
130 Ga0495654_0008093 3300046530 Bacteria 5830
131 Ga0495665_0012479 3300046531 Bacteria 4597
132 Ga0495665_0071862 3300046531 Bacteria 1822
133 Ga0495640_0016176 3300046533 Bacteria 5584
134 Ga0495640_0016178 3300046533 Bacteria 5583
135 Ga0495586_0004747 3300046535 Bacteria 7266
136 Ga0495587_0005935 3300046536 Bacteria 7966
137 Ga0495609_0012734 3300046538 Bacteria 3986
138 Ga0495645_0045173 3300046543 Bacteria 3214
139 Ga0495645_0046675 3300046543 Bacteria 3157
140 Ga0495622_0007330 3300046557 Bacteria 5122
141 Ga0495622_0013498 3300046557 Bacteria 3787
142 Ga0495622_0029077 3300046557 Bacteria 2582
143 Ga0495633_0006935 3300046558 Bacteria 6622
144 Ga0495633_0037275 3300046558 Bacteria 2326
145 Ga0495667_0117490 3300046559 Bacteria 1718
146 Ga0495668_0001911 3300046616 Bacteria 18567
147 Ga0495668_0002290 3300046616 Bacteria 16093
148 Ga0495634_0004506 3300046642 Bacteria 10923
149 Ga0495611_0030281 3300046648 Bacteria 2378
150 Ga0495611_0093872 3300046648 Bacteria 1388
151 Ga0495625_0005228 3300046660 Bacteria 11947
152 Ga0495625_0139364 3300046660 Bacteria 1637
153 Ga0495635_0000593 3300046663 Bacteria 23305
154 Ga0495635_0008165 3300046663 Bacteria 7310
155 Ga0495588_0000886 3300046674 Bacteria 13206
156 Ga0495588_0001238 3300046674 Bacteria 10989
157 Ga0495588_0043454 3300046674 Bacteria 2300
158 Ga0495588_0088664 3300046674 Bacteria 1619
159 Ga0495657_0012317 3300046675 Bacteria 6355
160 Ga0495599_0024982 3300046678 Bacteria 3737
161 Ga0495623_0011672 3300046679 Bacteria 5690
162 Ga0495623_0012415 3300046679 Bacteria 5516
163 Ga0495646_0000467 3300046680 Bacteria 21506
164 Ga0495613_0001168 3300046689 Bacteria 20054
165 Ga0495613_0005478 3300046689 Bacteria 9534
166 Ga0495613_0031758 3300046689 Bacteria 3922
167 Ga0495613_0038193 3300046689 Bacteria 3559
168 Ga0495613_0060460 3300046689 Bacteria 2775
169 Ga0495613_0095792 3300046689 Bacteria 2146
170 Ga0495624_0057154 3300046690 Bacteria 2453
171 Ga0495670_0028241 3300046691 Bacteria 2781
172 Ga0495671_0004258 3300046692 Bacteria 8608
173 Ga0495589_0026783 3300046794 Bacteria 2920
174 Ga0495589_0072978 3300046794 Bacteria 1675
175 Ga0495589_0096662 3300046794 Bacteria 1431
176 Ga0495600_0007857 3300046809 Bacteria 6531
177 Ga0495600_0017527 3300046809 Bacteria 4557
178 Ga0495660_0017550 3300046810 Bacteria 4119
179 Ga0495581_0112267 3300047315 Bacteria 1585
180 Ga0495604_0000568 3300047317 Bacteria 32485
181 Ga0495604_0009303 3300047317 Bacteria 7780
182 Ga0495604_0018446 3300047317 Bacteria 5587
183 Ga0495636_0000607 3300047318 Bacteria 13137
184 Ga0495636_0002589 3300047318 Bacteria 6950
185 Ga0495636_0012773 3300047318 Bacteria 3327
186 Ga0495674_0006318 3300047319 Bacteria 11361
187 Ga0495674_0054406 3300047319 Bacteria 3515
188 Ga0495676_0003786 3300047321 Bacteria 13749
189 Ga0495676_0051577 3300047321 Bacteria 3289
190 Ga0495680_0001987 3300047322 Bacteria 21488
191 Ga0495683_0008549 3300047323 Bacteria 5474
192 Ga0495683_0010620 3300047323 Bacteria 4859
193 Ga0495687_001345 3300047443 Bacteria 22903
194 Ga0495687_007903 3300047443 Bacteria 6182
195 Ga0495675_0003104 3300047444 Bacteria 9976
196 Ga0495675_0008871 3300047444 Bacteria 6244
197 Ga0495675_0023980 3300047444 Bacteria 3888
198 Ga0495679_036928 3300047446 Bacteria 1540
199 Ga0495685_007684 3300047447 Bacteria 3564
200 Ga0495685_033742 3300047447 Bacteria 1759
201 Ga0495681_0002409 3300047470 Bacteria 13379
202 Ga0495681_0006434 3300047470 Bacteria 7721
203 Ga0495681_0019534 3300047470 Bacteria 3697
204 Ga0495593_0000959 3300047673 Bacteria 16876
205 Ga0495593_0026293 3300047673 Bacteria 3214
206 Ga0495593_0061362 3300047673 Bacteria 1966
207 Ga0495614_0000501 3300048089 Bacteria 15996
208 Ga0495614_0019154 3300048089 Bacteria 2961
209 Ga0495626_0000147 3300048091 Bacteria 87994
210 Ga0495626_0005405 3300048091 Bacteria 7492
211 Ga0496106_0025156 3300048909 Bacteria 4429
212 Ga0501032_0084687 3300049569 Bacteria 2108
213 Ga0501033_0016694 3300049570 Bacteria 5553
214 Ga0501033_0028782 3300049570 Bacteria 4174
215 Ga0501034_0042527 3300049571 Bacteria 4599
216 Ga0501034_0110017 3300049571 Bacteria 2746
217 Ga0501036_0012717 3300049572 Bacteria 6981
218 Ga0501036_0153911 3300049572 Bacteria 1939
219 Ga0501037_0012026 3300049573 Bacteria 6375
220 Ga0501038_0020530 3300049574 Bacteria 5937
221 Ga0501038_0025257 3300049574 Bacteria 5296
222 Ga0501038_0034353 3300049574 Bacteria 4459
223 Ga0501039_0003989 3300049575 Bacteria 11097
224 Ga0501043_0009373 3300049579 Bacteria 7689
225 Ga0501046_0010654 3300049580 Bacteria 7884
226 Ga0501047_0059957 3300049581 Bacteria 3673
227 Ga0501047_0075239 3300049581 Bacteria 3249
228 Ga0501048_0029594 3300049582 Bacteria 3969
229 Ga0501070_0001959 3300049586 Bacteria 18176
230 Ga0501035_0001374 3300049822 Bacteria 25051
231 Ga0501035_0164479 3300049822 Bacteria 1919
232 Ga0501035_0188073 3300049822 Bacteria 1776
233 Ga0501044_0004632 3300049823 Bacteria 15397
234 Ga0501044_0008073 3300049823 Bacteria 11563
235 Ga0501044_0019959 3300049823 Bacteria 7156
236 Ga0501044_0024753 3300049823 Bacteria 6368
237 Ga0501044_0203660 3300049823 Bacteria 1936
238 Ga0501044_0250462 3300049823 Bacteria 1712
239 nmdc:mga06z11_584_c1 3300050494 Bacteria 13334
240 nmdc:mga04h51_465_c1 3300050495 Bacteria 9710
241 Ga0495601_0008557 3300053077 Bacteria 6044
242 Ga0495619_0016553 3300053085 Bacteria 4668
243 Ga0500578_0038758 3300053086 Bacteria 3060
244 Ga0500553_026394 3300053101 Bacteria 2924
245 Ga0500553_073215 3300053101 Bacteria 1567
246 Ga0500560_013434 3300053107 Bacteria 2152
247 Ga0500569_003451 3300053109 Bacteria 3233
248 Ga0500652_000893 3300053131 Bacteria 9834
249 Ga0500658_0009361 3300053134 Bacteria 3613
250 Ga0500561_0002806 3300053137 Bacteria 2960
251 Ga0500600_0041889 3300053149 Bacteria 2640
252 Ga0500616_0006946 3300053153 Bacteria 7290
253 Ga0500633_0006025 3300053160 Bacteria 2939
254 Ga0500634_0001642 3300053161 Bacteria 8857
255 Ga0500636_0040793 3300053177 Bacteria 2745
256 Ga0466962_0009844 3300061719 Bacteria 4585
257 Ga0466962_0086215 3300061719 Bacteria 1503
258 2867478856 2867475112 Bacteria 6909112
259 2547408357 2547132111 Bacteria 8013147
260 2554256192 2554235005 Bacteria 6457341
261 2585296649 2582581312 Bacteria 7308206
262 2585309094 2582581313 Bacteria 10042643
263 2585319279 2582581314 Bacteria 11452267
264 2616697336 2616644814 Bacteria 11555299
265 2616903281 2616644941 Bacteria 8510691
266 2643764055 2643221548 Bacteria 8053412
267 2643902223 2643221578 Bacteria 9213798
268 2643943955 2643221587 Bacteria 7586415
269 2644017726 2643221601 Bacteria 7493239
270 2644173315 2643221631 Bacteria 8168043
271 2644265770 2643221647 Bacteria 10741251
272 2644386937 2643221670 Bacteria 6497041
273 2644406622 2643221673 Bacteria 9196637
274 2644434692 2643221677 Bacteria 7584031
275 2644440088 2643221678 Bacteria 9540101
276 2644461513 2643221682 Bacteria 6743283
277 2644632591 2643221714 Bacteria 9015452
278 2738887847 2738541308 Bacteria 7020677
279 2739235718 2738543011 Bacteria 5731169
280 2768642942 2767802112 Bacteria 6465194
281 2784590447 2784132148 Bacteria 8627943
282 2785341166 2784746763 Bacteria 9783172
283 2785371539 2784746768 Bacteria 10036182
284 2786672703 2786546132 Bacteria 10419719
285 2793983607 2791355406 Bacteria 11364898
286 2804847947 2802429296 Bacteria 7227771
287 2808844065 2808606359 Bacteria 9866990
288 2808913659 2808606375 Bacteria 9466072
289 2809234120 2808606448 Bacteria 8656184
290 2811844372 2808606982 Bacteria 7791042
291 2812355910 2811994879 Bacteria 9313447
292 2812478717 2811994917 Bacteria 7761064
293 2819694591 2818991463 Bacteria 7948711
294 2819740609 2818991472 Bacteria 10089953
295 2852641055 2852635781 Bacteria 8251373
296 2862186451 2862178590 Bacteria 8583590
297 2862284703 2862281513 Bacteria 9621493
298 2862293532 2862290372 Bacteria 7471434
299 2862391187 2862382967 Bacteria 10317375
300 2862512644 2862507626 Bacteria 9425308
301 2862577473 2862574272 Bacteria 10567477
302 2862705608 2862705112 Bacteria 6563286
303 2863408653 2863404153 Bacteria 9672205
304 2867349135 2867346516 Bacteria 7608576
305 2867373903 2867369537 Bacteria 6501581
306 2867429428 2867428634 Bacteria 9590268
307 2873154017 2873151551 Bacteria 8625867
308 2875396737 2875391855 Bacteria 7600475
309 2877679066 2877676314 Bacteria 9512378
310 2889305314 2889300758 Bacteria 5690814
311 2912717581 2912715099 Bacteria 9460473
312 2912730124 2912723979 Bacteria 8557534
313 2912762790 2912757875 Bacteria 7940295
314 2918506546 2918501144 Bacteria 8668083
315 2919471770 2919468124 Bacteria 9133025
316 2939746826 2939743619 Bacteria 5762299
317 2946047820 2946045630 Bacteria 8527308
318 2946069877 2946064051 Bacteria 8957905
319 2946077798 2946072368 Bacteria 8999607
320 2947226911 2947224130 Bacteria 9938529
321 2954383969 2954380949 Bacteria 10050426
322 2954678996 2954673503 Bacteria 9685905
323 2954685156 2954682443 Bacteria 9862841
324 2954694765 2954691527 Bacteria 10720516
325 2954709967 2954701450 Bacteria 10834262
326 2954714275 2954711539 Bacteria 10867210
327 2954724224 2954721474 Bacteria 10456478
328 2954737615 2954731030 Bacteria 10243860
329 2954743121 2954740390 Bacteria 10229294
330 2954756449 2954749733 Bacteria 10366972
331 2954762079 2954759201 Bacteria 9358192
332 2966600824 2966598605 Bacteria 7676064
333 2990047346 2990044586 Bacteria 6603797
334 2990062980 2990059506 Bacteria 9321252
335 2995467096 2995463766 Bacteria 8577691
336 2997452908 2997451912 Bacteria 8492419
337 3006398616 3006393351 Bacteria 6615579
338 3006500155 3006493962 Bacteria 8825450
339 8008491572 8008485437 Bacteria 7198341
340 8008562826 8008558824 Bacteria 10610750
341 8008577133 8008574985 Bacteria 7815457
342 8023629621 8023623736 Bacteria 8593882
343 8025419739 8025413630 Bacteria 7014048
344 8025524628 8025524527 Bacteria 7197316
345 8025536240 8025530807 Bacteria 8495698
346 8047896070 8047893842 Bacteria 11723082
347 8048132231 8048127548 Bacteria 11053136
348 8048362865 8048356638 Bacteria 11044339
349 8048373095 8048369669 Bacteria 11666822
350 8048382028 8048379754 Bacteria 11877923
351 8048411692 8048406513 Bacteria 8936924
352 8054166409 8054160619 Bacteria 7783213
353 8056453767 8056447290 Bacteria 7680491
354 8056672525 8056667051 Bacteria 6953971
355 8056832236 8056829672 Bacteria 9045328
356 JGI24739J22299_10006951
357 JGI24738J21930_10004456
358 rootH1_10012038
359 rootL2_10223465
360 JGI25160J50197_1014543
361 Ga0006562J51391_1039762
362 Ga0075367_10018025
363 Ga0105243_10007965
364 Ga0105243_10166207
365 Ga0105246_10011517
366 Ga0157372_10069223
367 Ga0157375_10360472
368 Ga0182008_10001944
369 Ga0182007_10001129
370 Ga0183367_1002
371 Ga0209758_1005727
372 Ga0207426_1001550
373 Ga0207426_1004878
374 Ga0207426_1011723
375 Ga0207709_10024363
376 Ga0207709_10043627
377 Ga0209371_1016892
378 Ga0268266_10054200
379 Ga0307515_10000813
380 Ga0268256_1012995
381 Ga0307511_10004464
382 Ga0307511_10071227
383 Ga0307512_10007235
384 Ga0307513_10069071
385 Ga0307509_10027685
386 Ga0307508_10021420
387 Ga0307508_10031151
388 Ga0307508_10048234
389 Ga0307514_10010235
390 Ga0307516_10005589
391 Ga0307516_10020546
392 Ga0307507_10009383
393 Ga0307507_10046849
394 Ga0307510_10014326
395 Ga0307510_10036791
396 Ga0395900_0146293
397 Ga0395898_0003519
398 Ga0395898_0018379
399 Ga0439436_0004934
400 Ga0439439_0002532
401 Ga0439439_0013510
402 Ga0451853_0167257
403 Ga0439433_0004675
404 Ga0439448_0000943
405 Ga0439449_0000560
406 Ga0439449_0011497
407 Ga0439455_0002205
408 Ga0439457_000023
409 Ga0439457_000345
410 Ga0439462_0006841
411 Ga0450894_001546
412 Ga0450903_000025
413 Ga0439458_0003203
414 Ga0466972_0003732
415 Ga0466972_0007707
416 Ga0466966_0011160
417 Ga0466966_0022122
418 Ga0466966_0030065
419 Ga0466961_0002889
420 Ga0466961_0009353
421 Ga0466961_0010577
422 Ga0466961_0024083
423 Ga0466963_0002615
424 Ga0466963_0014972
425 Ga0466964_0026694
426 Ga0466971_0000670
427 Ga0466971_0061231
428 Ga0466970_0001736
429 Ga0466957_0002024
430 Ga0466960_0003534
431 Ga0466959_0008079
432 Ga0466959_0011846
433 Ga0466958_0001505
434 Ga0466967_0004981
435 Ga0466967_0007604
436 Ga0466967_0011001
437 Ga0495617_007492
438 Ga0495627_010639
439 Ga0495592_0033971
440 Ga0495592_0040562
441 Ga0495603_0003304
442 Ga0495603_0018504
443 Ga0495603_0020480
444 Ga0495603_0044896
445 Ga0495629_0001224
446 Ga0495629_0002206
447 Ga0495629_0014641
448 Ga0495629_0034473
449 Ga0495629_0073161
450 Ga0495629_0144881
451 Ga0495638_0012643
452 Ga0495638_0030633
453 Ga0495638_0157103
454 Ga0495651_0004960
455 Ga0495651_0010010
456 Ga0495651_0017151
457 Ga0495580_0001943
458 Ga0495580_0140430
459 Ga0495605_0042276
460 Ga0495639_0004730
461 Ga0495662_0000623
462 Ga0495662_0022142
463 Ga0495662_0031945
464 Ga0495662_0068584
465 Ga0495664_0003044
466 Ga0495585_0027058
467 Ga0495594_0000286
468 Ga0495594_0004800
469 Ga0495594_0020583
470 Ga0495594_0021757
471 Ga0495607_0025967
472 Ga0495606_0006676
473 Ga0495606_0104695
474 Ga0495616_0005965
475 Ga0495620_0027209
476 Ga0495628_0015345
477 Ga0495630_0019140
478 Ga0495630_0101821
479 Ga0495631_0005572
480 Ga0495643_0011079
481 Ga0495648_0038903
482 Ga0495666_0041244
483 Ga0495652_0017694
484 Ga0495652_0025453
485 Ga0495654_0008093
486 Ga0495665_0012479
487 Ga0495665_0071862
488 Ga0495640_0016176
489 Ga0495640_0016178
490 Ga0495586_0004747
491 Ga0495587_0005935
492 Ga0495609_0012734
493 Ga0495645_0045173
494 Ga0495645_0046675
495 Ga0495622_0007330
496 Ga0495622_0013498
497 Ga0495622_0029077
498 Ga0495633_0006935
499 Ga0495633_0037275
500 Ga0495667_0117490
501 Ga0495668_0001911
502 Ga0495668_0002290
503 Ga0495634_0004506
504 Ga0495611_0030281
505 Ga0495611_0093872
506 Ga0495625_0005228
507 Ga0495625_0139364
508 Ga0495635_0000593
509 Ga0495635_0008165
510 Ga0495588_0000886
511 Ga0495588_0001238
512 Ga0495588_0043454
513 Ga0495588_0088664
514 Ga0495657_0012317
515 Ga0495599_0024982
516 Ga0495623_0011672
517 Ga0495623_0012415
518 Ga0495646_0000467
519 Ga0495613_0001168
520 Ga0495613_0005478
521 Ga0495613_0031758
522 Ga0495613_0038193
523 Ga0495613_0060460
524 Ga0495613_0095792
525 Ga0495624_0057154
526 Ga0495670_0028241
527 Ga0495671_0004258
528 Ga0495589_0026783
529 Ga0495589_0072978
530 Ga0495589_0096662
531 Ga0495600_0007857
532 Ga0495600_0017527
533 Ga0495660_0017550
534 Ga0495581_0112267
535 Ga0495604_0000568
536 Ga0495604_0009303
537 Ga0495604_0018446
538 Ga0495636_0000607
539 Ga0495636_0002589
540 Ga0495636_0012773
541 Ga0495674_0006318
542 Ga0495674_0054406
543 Ga0495676_0003786
544 Ga0495676_0051577
545 Ga0495680_0001987
546 Ga0495683_0008549
547 Ga0495683_0010620
548 Ga0495687_001345
549 Ga0495687_007903
550 Ga0495675_0003104
551 Ga0495675_0008871
552 Ga0495675_0023980
553 Ga0495679_036928
554 Ga0495685_007684
555 Ga0495685_033742
556 Ga0495681_0002409
557 Ga0495681_0006434
558 Ga0495681_0019534
559 Ga0495593_0000959
560 Ga0495593_0026293
561 Ga0495593_0061362
562 Ga0495614_0000501
563 Ga0495614_0019154
564 Ga0495626_0000147
565 Ga0495626_0005405
566 Ga0496106_0025156
567 Ga0501032_0084687
568 Ga0501033_0016694
569 Ga0501033_0028782
570 Ga0501034_0042527
571 Ga0501034_0110017
572 Ga0501036_0012717
573 Ga0501036_0153911
574 Ga0501037_0012026
575 Ga0501038_0020530
576 Ga0501038_0025257
577 Ga0501038_0034353
578 Ga0501039_0003989
579 Ga0501043_0009373
580 Ga0501046_0010654
581 Ga0501047_0059957
582 Ga0501047_0075239
583 Ga0501048_0029594
584 Ga0501070_0001959
585 Ga0501035_0001374
586 Ga0501035_0164479
587 Ga0501035_0188073
588 Ga0501044_0004632
589 Ga0501044_0008073
590 Ga0501044_0019959
591 Ga0501044_0024753
592 Ga0501044_0203660
593 Ga0501044_0250462
594 nmdc:mga06z11_584_c1
595 nmdc:mga04h51_465_c1
596 Ga0495601_0008557
597 Ga0495619_0016553
598 Ga0500578_0038758
599 Ga0500553_026394
600 Ga0500553_073215
601 Ga0500560_013434
602 Ga0500569_003451
603 Ga0500652_000893
604 Ga0500658_0009361
605 Ga0500561_0002806
606 Ga0500600_0041889
607 Ga0500616_0006946
608 Ga0500633_0006025
609 Ga0500634_0001642
610 Ga0500636_0040793
611 Ga0466962_0009844
612 Ga0466962_0086215
613 2867478856
614 2547408357
615 2554256192
616 2585296649
617 2585309094
618 2585319279
619 2616697336
620 2616903281
621 2643764055
622 2643902223
623 2643943955
624 2644017726
625 2644173315
626 2644265770
627 2644386937
628 2644406622
629 2644434692
630 2644440088
631 2644461513
632 2644632591
633 2738887847
634 2739235718
635 2768642942
636 2784590447
637 2785341166
638 2785371539
639 2786672703
640 2793983607
641 2804847947
642 2808844065
643 2808913659
644 2809234120
645 2811844372
646 2812355910
647 2812478717
648 2819694591
649 2819740609
650 2852641055
651 2862186451
652 2862284703
653 2862293532
654 2862391187
655 2862512644
656 2862577473
657 2862705608
658 2863408653
659 2867349135
660 2867373903
661 2867429428
662 2873154017
663 2875396737
664 2877679066
665 2889305314
666 2912717581
667 2912730124
668 2912762790
669 2918506546
670 2919471770
671 2939746826
672 2946047820
673 2946069877
674 2946077798
675 2947226911
676 2954383969
677 2954678996
678 2954685156
679 2954694765
680 2954709967
681 2954714275
682 2954724224
683 2954737615
684 2954743121
685 2954756449
686 2954762079
687 2966600824
688 2990047346
689 2990062980
690 2995467096
691 2997452908
692 3006398616
693 3006500155
694 8008491572
695 8008562826
696 8008577133
697 8023629621
698 8025419739
699 8025524628
700 8025536240
701 8047896070
702 8048132231
703 8048362865
704 8048373095
705 8048382028
706 8048411692
707 8054166409
708 8056453767
709 8056672525
710 8056832236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00871

Acetate_kinase

Acetokinase family

3

394

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rja-assembly1.cif.gz_F cryo-em structure of st1cas9-sgrna-tdna20-acriia6 dimeric assembly. 0.9503 5 31
4dq8-assembly1.cif.gz_A crystal structure of acetate kinase acka from mycobacterium marinum 0.9355 4 397
4dq8-assembly1.cif.gz_B crystal structure of acetate kinase acka from mycobacterium marinum 0.9342 5 397
4dq8-assembly1.cif.gz_A crystal structure of acetate kinase acka from mycobacterium marinum 0.9259 4 397
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.9253 4 393
ID Description Score Start End Superfamily
3khyB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9614 4 198 3.30.420.40
3khyB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9515 4 198 3.30.420.40
4dq8B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9442 5 199 3.30.420.40
4dq8B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9284 5 199 3.30.420.40
2iirA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9246 5 199 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A4D4LF57-F1-model_v4 Uncharacterized protein 0.9732 1 182 GO:0005524
GO:0006083
GO:0008776
GO:0047761
AF-A0A6G3WLC5-F1-model_v4 Acetate kinase 0.9665 89 187 GO:0006083
GO:0008776
AF-A0A7W0PLE0-F1-model_v4 Acetate kinase 0.9633 5 150 GO:0005524
GO:0006083
GO:0008776
AF-A0A269XEC3-F1-model_v4 butyrate kinase (EC 2.7.2.7) 0.961 145 232 GO:0005524
GO:0006083
GO:0008776
GO:0047761
AF-F4MWZ3-F1-model_v4 Uncharacterized protein 0.96 101 232 GO:0005524
GO:0006083
GO:0008776
GO:0047761

Map