F420303

General Info

Members Datasets Scaffolds Average Seq Length
355 237 710 183

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0566694|Ga0501076_0566694_76_669
Length 197
Sequence LLAYSIVADAKETSMTILAESAATVLPAGMWSIDPAHSAVEFHVKHLGLATVKGRAPVVSGSIVGGARPSLEGVVDVSSITTFDETRDAHLQSPDFFDVERHPELTFSSTAIASDGDALTVDGGLTIRGVTRPVSLTGAFVGAGTDPWGNERIGLDLETVVDRTEWGLDWNAPLPGGGFLLPDRVKLTATFSAVRAA

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 3.38
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.83
Rhizosphere 85.63
Stem 0
Stem Tuber 0
Unclassified 3.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0566694 3300049592 Bacteria 937
2 Ga0058860_10827547 3300004801 Bacteria 1253
3 Ga0058862_10019255 3300004803 Bacteria 1260
4 Ga0070658_10077007 3300005327 Bacteria 2736
5 Ga0070676_10580766 3300005328 Bacteria 806
6 Ga0070683_100050345 3300005329 Bacteria 3856
7 Ga0070683_100087803 3300005329 Bacteria 2917
8 Ga0070683_100788307 3300005329 Unclassified 911
9 Ga0070690_100099237 3300005330 Bacteria 1928
10 Ga0070670_100849444 3300005331 Bacteria 826
11 Ga0070680_100001049 3300005336 Bacteria 19768
12 Ga0070682_100078382 3300005337 Bacteria 2131
13 Ga0070682_100097407 3300005337 Bacteria 1936
14 Ga0070682_100270794 3300005337 Bacteria 1233
15 Ga0070682_101993830 3300005337 Bacteria 510
16 Ga0068868_100114338 3300005338 Bacteria 2196
17 Ga0068868_100465458 3300005338 Bacteria 1102
18 Ga0070660_100616825 3300005339 Bacteria 908
19 Ga0070689_100181793 3300005340 Bacteria 1708
20 Ga0070689_101147781 3300005340 Bacteria 696
21 Ga0070661_100215224 3300005344 Bacteria 1472
22 Ga0070671_100446850 3300005355 Bacteria 1109
23 Ga0070674_100290461 3300005356 Bacteria 1299
24 Ga0070688_100071023 3300005365 Bacteria 2228
25 Ga0070659_100000855 3300005366 Bacteria 22241
26 Ga0070709_10273056 3300005434 Bacteria 1226
27 Ga0070714_100076496 3300005435 Bacteria 2906
28 Ga0070714_100417532 3300005435 Bacteria 1270
29 Ga0070713_100013565 3300005436 Bacteria 6024
30 Ga0070713_100082866 3300005436 Bacteria 2740
31 Ga0070710_10013083 3300005437 Bacteria 4142
32 Ga0070711_100014522 3300005439 Bacteria 4963
33 Ga0070711_100041864 3300005439 Bacteria 3094
34 Ga0070700_100101404 3300005441 Bacteria 1897
35 Ga0070663_100252884 3300005455 Bacteria 1395
36 Ga0070678_100143968 3300005456 Bacteria 1911
37 Ga0070662_100194740 3300005457 Bacteria 1605
38 Ga0070681_10025800 3300005458 Bacteria 5909
39 Ga0068867_100063345 3300005459 Bacteria 2748
40 Ga0068867_100400444 3300005459 Bacteria 1157
41 Ga0070685_10400870 3300005466 Bacteria 950
42 Ga0070707_101150632 3300005468 Unclassified 742
43 Ga0070679_100093208 3300005530 Bacteria 2999
44 Ga0070684_100208423 3300005535 Bacteria 1781
45 Ga0070684_101190380 3300005535 Bacteria 717
46 Ga0068853_100033530 3300005539 Bacteria 4358
47 Ga0070672_100152584 3300005543 Bacteria 1912
48 Ga0070686_100032572 3300005544 Bacteria 3196
49 Ga0070693_100323370 3300005547 Bacteria 1047
50 Ga0070693_100391453 3300005547 Bacteria 961
51 Ga0070665_100190193 3300005548 Bacteria 2054
52 Ga0070665_101201211 3300005548 Bacteria 769
53 Ga0070664_100132515 3300005564 Bacteria 2190
54 Ga0068854_100106889 3300005578 Bacteria 2106
55 Ga0068856_100163741 3300005614 Bacteria 2235
56 Ga0068856_100386460 3300005614 Unclassified 1419
57 Ga0070702_100107900 3300005615 Bacteria 1720
58 Ga0070702_100389316 3300005615 Bacteria 994
59 Ga0068852_100031151 3300005616 Bacteria 4398
60 Ga0068852_100204734 3300005616 Bacteria 1869
61 Ga0068866_10366841 3300005718 Bacteria 919
62 Ga0068861_100132873 3300005719 Bacteria 2022
63 Ga0068861_101110825 3300005719 Bacteria 760
64 Ga0068851_10263964 3300005834 Bacteria 980
65 Ga0070717_10055769 3300006028 Bacteria 3262
66 Ga0070716_100488300 3300006173 Bacteria 906
67 Ga0070712_100064972 3300006175 Bacteria 2589
68 Ga0070712_100099901 3300006175 Bacteria 2143
69 Ga0070712_100846359 3300006175 Bacteria 786
70 Ga0097621_100107769 3300006237 Bacteria 2351
71 Ga0075433_10044333 3300006852 Bacteria 3864
72 Ga0068865_100311704 3300006881 Bacteria 1263
73 Ga0075436_100130957 3300006914 Bacteria 1759
74 Ga0105240_10036906 3300009093 Bacteria 6283
75 Ga0105240_10615519 3300009093 Bacteria 1194
76 Ga0105245_10111548 3300009098 Bacteria 2544
77 Ga0105245_10385845 3300009098 Bacteria 1396
78 Ga0105247_10587656 3300009101 Bacteria 824
79 Ga0105243_10392336 3300009148 Bacteria 1287
80 Ga0105243_10767439 3300009148 Bacteria 947
81 Ga0105241_10582089 3300009174 Bacteria 1009
82 Ga0105242_10214512 3300009176 Bacteria 1717
83 Ga0105242_10377636 3300009176 Bacteria 1316
84 Ga0105248_10142797 3300009177 Bacteria 2701
85 Ga0105237_10015524 3300009545 Bacteria 7924
86 Ga0105238_10016144 3300009551 Bacteria 7555
87 Ga0105238_10341392 3300009551 Bacteria 1486
88 Ga0105238_10916176 3300009551 Bacteria 895
89 Ga0105239_10103115 3300010375 Bacteria 3157
90 Ga0105239_11298133 3300010375 Bacteria 839
91 Ga0105246_10009222 3300011119 Bacteria 6076
92 Ga0157371_10420182 3300013102 Bacteria 980
93 Ga0157370_10018827 3300013104 Bacteria 6943
94 Ga0157369_10002546 3300013105 Bacteria 21809
95 Ga0157369_10781475 3300013105 Bacteria 981
96 Ga0157374_10925268 3300013296 Bacteria 890
97 Ga0157374_11110160 3300013296 Bacteria 811
98 Ga0157374_11642897 3300013296 Unclassified 667
99 Ga0157378_10294905 3300013297 Bacteria 1567
100 Ga0163162_10415100 3300013306 Bacteria 1478
101 Ga0157372_10233162 3300013307 Bacteria 2134
102 Ga0157372_11397152 3300013307 Bacteria 807
103 Ga0157375_10193119 3300013308 Bacteria 2191
104 Ga0157375_10338196 3300013308 Bacteria 1671
105 Ga0157375_11179655 3300013308 Bacteria 898
106 Ga0163163_10910361 3300014325 Bacteria 943
107 Ga0182008_10001349 3300014497 Bacteria 16696
108 Ga0157377_10152162 3300014745 Bacteria 1431
109 Ga0157376_11106222 3300014969 Bacteria 818
110 Ga0182006_1032792 3300015261 Bacteria 2085
111 Ga0182007_10042658 3300015262 Bacteria 1509
112 Ga0163161_10278535 3300017792 Bacteria 1311
113 Ga0163161_10435304 3300017792 Bacteria 1057
114 Ga0206355_1459899 3300020076 Bacteria 1027
115 Ga0206350_11462873 3300020080 Unclassified 814
116 Ga0206354_10061152 3300020081 Bacteria 815
117 Ga0206353_11064138 3300020082 Bacteria 3985
118 Ga0154015_1083708 3300020610 Bacteria 597
119 Ga0154015_1412171 3300020610 Bacteria 1618
120 Ga0213876_10017284 3300021384 Bacteria 3808
121 Ga0213875_10019480 3300021388 Bacteria 3264
122 Ga0213875_10198154 3300021388 Bacteria 944
123 Ga0224712_10291319 3300022467 Bacteria 762
124 Ga0207692_10477494 3300025898 Bacteria 788
125 Ga0207642_10240749 3300025899 Bacteria 1021
126 Ga0207688_10030337 3300025901 Bacteria 2981
127 Ga0207707_10107969 3300025912 Bacteria 2433
128 Ga0207695_10042997 3300025913 Bacteria 4819
129 Ga0207695_10080406 3300025913 Bacteria 3301
130 Ga0207693_10011512 3300025915 Bacteria 7154
131 Ga0207693_10033507 3300025915 Bacteria 4053
132 Ga0207693_10585916 3300025915 Bacteria 869
133 Ga0207663_10008304 3300025916 Bacteria 5420
134 Ga0207663_10046489 3300025916 Unclassified 2675
135 Ga0207657_10064358 3300025919 Bacteria 3130
136 Ga0207657_10142270 3300025919 Bacteria 1959
137 Ga0207649_10007926 3300025920 Bacteria 5781
138 Ga0207652_10570009 3300025921 Bacteria 1017
139 Ga0207652_10616560 3300025921 Bacteria 972
140 Ga0207694_10072071 3300025924 Bacteria 2701
141 Ga0207694_10418588 3300025924 Bacteria 1116
142 Ga0207687_10297817 3300025927 Bacteria 1298
143 Ga0207687_10934199 3300025927 Bacteria 743
144 Ga0207700_10040908 3300025928 Bacteria 3387
145 Ga0207700_11009843 3300025928 Bacteria 744
146 Ga0207664_10029252 3300025929 Bacteria 4195
147 Ga0207664_10082022 3300025929 Bacteria 2626
148 Ga0207664_11164616 3300025929 Bacteria 688
149 Ga0207690_10014302 3300025932 Bacteria 4792
150 Ga0207706_10217166 3300025933 Bacteria 1675
151 Ga0207686_10210329 3300025934 Bacteria 1398
152 Ga0207709_10027671 3300025935 Bacteria 3269
153 Ga0207709_10235807 3300025935 Bacteria 1328
154 Ga0207670_10132061 3300025936 Bacteria 1831
155 Ga0207670_10721075 3300025936 Bacteria 827
156 Ga0207669_11023434 3300025937 Unclassified 695
157 Ga0207665_10196576 3300025939 Bacteria 1468
158 Ga0207665_10225023 3300025939 Bacteria 1377
159 Ga0207691_10156386 3300025940 Bacteria 2002
160 Ga0207711_10358695 3300025941 Bacteria 1350
161 Ga0207661_10014362 3300025944 Bacteria 5802
162 Ga0207661_10125074 3300025944 Bacteria 2195
163 Ga0207667_11266846 3300025949 Bacteria 715
164 Ga0207651_10169407 3300025960 Bacteria 1721
165 Ga0207668_10345256 3300025972 Bacteria 1243
166 Ga0207677_10088391 3300026023 Bacteria 2246
167 Ga0207677_10168671 3300026023 Bacteria 1709
168 Ga0207639_10026375 3300026041 Bacteria 4222
169 Ga0207708_10100245 3300026075 Bacteria 2241
170 Ga0207702_10051312 3300026078 Bacteria 3485
171 Ga0207648_10059501 3300026089 Bacteria 3332
172 Ga0207648_10242010 3300026089 Bacteria 1606
173 Ga0207648_10527597 3300026089 Bacteria 1082
174 Ga0207675_100131245 3300026118 Bacteria 2376
175 Ga0207675_100727962 3300026118 Bacteria 1002
176 Ga0207683_10208592 3300026121 Bacteria 1777
177 Ga0207698_10140653 3300026142 Bacteria 2079
178 Ga0207698_10839408 3300026142 Bacteria 923
179 Ga0268266_10164655 3300028379 Bacteria 2008
180 Ga0268266_11033259 3300028379 Bacteria 795
181 Ga0265338_10007250 3300028800 Bacteria 13843
182 Ga0265327_10128798 3300031251 Bacteria 1192
183 Ga0316576_10018212 3300031727 Unclassified 4789
184 Ga0307407_10760755 3300031903 Bacteria 734
185 Ga0307415_100724149 3300032126 Bacteria 900
186 Ga0373939_0151659 3300035114 Unclassified 844
187 Ga0373960_0182197 3300035121 Unclassified 734
188 Ga0373955_0908945 3300035172 Bacteria 542
189 Ga0316574_0000699 3300035398 Bacteria 14288
190 Ga0373924_0027036 3300035410 Bacteria 2280
191 Ga0373935_0550192 3300035692 Bacteria 841
192 Ga0373937_0005099 3300036401 Bacteria 11190
193 Ga0316582_0430259 3300036647 Bacteria 909
194 Ga0316584_0009078 3300036712 Bacteria 6883
195 Ga0373925_0861220 3300037068 Bacteria 747
196 Ga0395899_0144915 3300037312 Bacteria 1687
197 Ga0395900_0042894 3300037418 Bacteria 4660
198 Ga0395900_0291178 3300037418 Bacteria 1621
199 Ga0395898_0008433 3300037466 Bacteria 10893
200 Ga0395898_0276508 3300037466 Bacteria 1601
201 Ga0395905_0141905 3300037471 Bacteria 2259
202 Ga0395905_0724829 3300037471 Bacteria 897
203 Ga0436364_0158021 3300037853 Bacteria 899
204 Ga0436364_1043112 3300037853 Bacteria 17687
205 Ga0436364_1460093 3300037853 Bacteria 1595
206 Ga0395901_0156273 3300038443 Bacteria 2395
207 Ga0395901_0187879 3300038443 Bacteria 2167
208 Ga0395901_0630664 3300038443 Bacteria 1077
209 Ga0436365_0973085 3300039437 Bacteria 6600
210 Ga0436360_0008642 3300039438 Bacteria 2039
211 Ga0436363_1047621 3300039450 Bacteria 698
212 Ga0466969_0172570 3300044656 Bacteria 991
213 Ga0466965_0230701 3300044683 Bacteria 989
214 Ga0466966_0079290 3300044684 Bacteria 2047
215 Ga0466966_0196517 3300044684 Bacteria 1221
216 Ga0466961_0045052 3300044693 Bacteria 2822
217 Ga0466961_0930167 3300044693 Bacteria 517
218 Ga0466963_0008351 3300044694 Bacteria 6203
219 Ga0466963_0039059 3300044694 Bacteria 3107
220 Ga0466963_0286251 3300044694 Bacteria 1158
221 Ga0466964_0163019 3300044706 Bacteria 1043
222 Ga0466971_0130952 3300044719 Bacteria 1164
223 Ga0466968_0087613 3300044735 Bacteria 1375
224 Ga0466968_0100558 3300044735 Bacteria 1290
225 Ga0466970_0128663 3300044765 Bacteria 1390
226 Ga0466970_0569545 3300044765 Bacteria 655
227 Ga0466957_0099374 3300044842 Bacteria 1832
228 Ga0466957_0155674 3300044842 Bacteria 1481
229 Ga0466957_0366653 3300044842 Bacteria 980
230 Ga0466960_0009852 3300044901 Bacteria 3951
231 Ga0466959_0137068 3300045049 Bacteria 1732
232 Ga0466958_0013580 3300045836 Bacteria 4640
233 Ga0466958_0075722 3300045836 Bacteria 2065
234 Ga0466958_0089917 3300045836 Bacteria 1899
235 Ga0466958_0140850 3300045836 Bacteria 1518
236 Ga0466958_0503988 3300045836 Bacteria 785
237 Ga0466958_0841552 3300045836 Bacteria 598
238 Ga0466967_0001572 3300045976 Bacteria 13403
239 Ga0466967_0081716 3300045976 Bacteria 2919
240 Ga0466967_0216474 3300045976 Bacteria 1818
241 Ga0466967_0430798 3300045976 Bacteria 1287
242 Ga0466967_0455328 3300045976 Bacteria 1251
243 Ga0466967_0555999 3300045976 Bacteria 1130
244 Ga0495592_0018710 3300046454 Bacteria 5273
245 Ga0495641_0072662 3300046461 Bacteria 1543
246 Ga0495651_0034946 3300046462 Bacteria 3916
247 Ga0495653_0065081 3300046463 Bacteria 2744
248 Ga0495582_0094158 3300046473 Bacteria 1672
249 Ga0495664_0000007 3300046477 Bacteria 386710
250 Ga0495664_0040135 3300046477 Bacteria 2767
251 Ga0495594_0437474 3300046499 Bacteria 744
252 Ga0495608_0044838 3300046511 Bacteria 2949
253 Ga0495608_0470004 3300046511 Unclassified 764
254 Ga0495618_0022916 3300046514 Bacteria 3858
255 Ga0495628_0026822 3300046516 Bacteria 4690
256 Ga0495630_0750907 3300046517 Bacteria 746
257 Ga0495652_0029029 3300046529 Bacteria 4859
258 Ga0495652_0218085 3300046529 Bacteria 1435
259 Ga0495640_0083481 3300046533 Bacteria 2120
260 Ga0495587_0056285 3300046536 Bacteria 2314
261 Ga0495667_0032285 3300046559 Bacteria 3510
262 Ga0495635_0009571 3300046663 Bacteria 6772
263 Ga0495657_0001496 3300046675 Bacteria 20145
264 Ga0495599_0024408 3300046678 Bacteria 3781
265 Ga0495646_0099497 3300046680 Bacteria 1669
266 Ga0495658_0565989 3300046683 Bacteria 728
267 Ga0495613_0319229 3300046689 Bacteria 1072
268 Ga0495604_0017806 3300047317 Bacteria 5684
269 Ga0495674_0048796 3300047319 Bacteria 3744
270 Ga0495680_0011442 3300047322 Bacteria 7855
271 Ga0495680_0226024 3300047322 Bacteria 1334
272 Ga0495680_0868877 3300047322 Unclassified 585
273 Ga0495675_0091264 3300047444 Bacteria 1912
274 Ga0495684_0090063 3300047471 Bacteria 2324
275 Ga0495602_0009371 3300048088 Bacteria 10186
276 Ga0496100_0000940 3300048903 Bacteria 13919
277 Ga0496100_0038900 3300048903 Bacteria 3017
278 Ga0496100_0151582 3300048903 Bacteria 1654
279 Ga0496101_0010152 3300048904 Bacteria 6211
280 Ga0496101_0013314 3300048904 Bacteria 5508
281 Ga0496101_1115790 3300048904 Bacteria 619
282 Ga0496102_0003910 3300048905 Bacteria 12617
283 Ga0496102_0019827 3300048905 Bacteria 5928
284 Ga0496102_0088305 3300048905 Bacteria 2866
285 Ga0496102_0925957 3300048905 Unclassified 793
286 Ga0496103_0059230 3300048906 Bacteria 2379
287 Ga0496103_0165372 3300048906 Bacteria 1419
288 Ga0496104_1201017 3300048907 Bacteria 662
289 Ga0496105_0078179 3300048908 Bacteria 2732
290 Ga0496105_0178305 3300048908 Bacteria 1740
291 Ga0496105_0306450 3300048908 Bacteria 1276
292 Ga0496105_0619238 3300048908 Bacteria 838
293 Ga0496106_0000189 3300048909 Bacteria 43320
294 Ga0496106_0030997 3300048909 Bacteria 3986
295 Ga0496107_0020039 3300048910 Bacteria 4723
296 Ga0496107_0024754 3300048910 Bacteria 4247
297 Ga0496108_0131206 3300048911 Bacteria 2154
298 Ga0496108_0138068 3300048911 Bacteria 2099
299 Ga0496108_0160864 3300048911 Bacteria 1940
300 Ga0496108_0216558 3300048911 Bacteria 1663
301 Ga0496108_0933356 3300048911 Bacteria 744
302 Ga0496109_0165101 3300048912 Bacteria 2075
303 Ga0496109_0197740 3300048912 Unclassified 1890
304 Ga0496109_0931722 3300048912 Bacteria 806
305 Ga0496110_0130605 3300048913 Bacteria 2268
306 Ga0496110_0327734 3300048913 Bacteria 1395
307 Ga0496110_0640008 3300048913 Bacteria 963
308 Ga0496110_0875362 3300048913 Bacteria 804
309 Ga0496112_0035748 3300048915 Bacteria 4842
310 Ga0496112_0042276 3300048915 Bacteria 4458
311 Ga0496112_0581680 3300048915 Bacteria 1052
312 Ga0496113_0072635 3300048916 Bacteria 2619
313 Ga0496113_0584622 3300048916 Bacteria 894
314 Ga0496114_0152402 3300048917 Bacteria 2006
315 Ga0496114_0395134 3300048917 Bacteria 1224
316 Ga0496115_0007944 3300048918 Bacteria 7828
317 Ga0496115_0099555 3300048918 Bacteria 2382
318 Ga0501306_045465 3300049127 Bacteria 692
319 Ga0501318_035883 3300049534 Bacteria 692
320 Ga0501321_055759 3300049537 Bacteria 587
321 Ga0501031_0029188 3300049568 Bacteria 3598
322 Ga0501032_0168461 3300049569 Bacteria 1437
323 Ga0501039_0013431 3300049575 Bacteria 6263
324 Ga0501040_0105182 3300049576 Bacteria 1971
325 Ga0501041_0106555 3300049577 Bacteria 1737
326 Ga0501042_0020748 3300049578 Bacteria 4574
327 Ga0501046_0329033 3300049580 Bacteria 1112
328 Ga0501048_0011760 3300049582 Bacteria 6525
329 Ga0501068_0168786 3300049584 Bacteria 1380
330 Ga0501070_0130212 3300049586 Bacteria 2079
331 Ga0501071_0011657 3300049587 Bacteria 5933
332 Ga0501072_0012643 3300049588 Bacteria 6454
333 Ga0501074_0120380 3300049590 Bacteria 1877
334 Ga0501075_0018402 3300049591 Bacteria 5058
335 Ga0501076_0034966 3300049592 Bacteria 3930
336 Ga0501077_0026057 3300049593 Bacteria 3710
337 Ga0501080_0188826 3300049742 Bacteria 1894
338 Ga0501081_0103748 3300049743 Bacteria 2012
339 Ga0501083_0132478 3300049744 Bacteria 1634
340 Ga0501035_0069139 3300049822 Bacteria 3131
341 Ga0501045_0118185 3300049824 Bacteria 1967
342 nmdc:mga0n895_488366_c1 3300050512 Bacteria 1241
343 nmdc:mga0n895_52957_c1 3300050512 Bacteria 3985
344 nmdc:mga0rr50_509332_c1 3300050513 Bacteria 1024
345 nmdc:mga0a205_7064_c1 3300050515 Bacteria 10140
346 Ga0495601_0370244 3300053077 Bacteria 930
347 Ga0495595_0011775 3300053084 Bacteria 3664
348 Ga0495595_0288894 3300053084 Bacteria 824
349 Ga0495619_0009306 3300053085 Bacteria 6201
350 Ga0501084_0000010 3300054114 Bacteria 187712
351 Ga0501084_0014988 3300054114 Bacteria 6427
352 Ga0501082_0084044 3300060353 Bacteria 2746
353 Ga0466962_0043954 3300061719 Bacteria 2137
354 Ga0530510_0066698 3300061734 Bacteria 2610
355 2791915543 2791354901 Bacteria 8322202
356 Ga0501076_0566694
357 Ga0058860_10827547
358 Ga0058862_10019255
359 Ga0070658_10077007
360 Ga0070676_10580766
361 Ga0070683_100050345
362 Ga0070683_100087803
363 Ga0070683_100788307
364 Ga0070690_100099237
365 Ga0070670_100849444
366 Ga0070680_100001049
367 Ga0070682_100078382
368 Ga0070682_100097407
369 Ga0070682_100270794
370 Ga0070682_101993830
371 Ga0068868_100114338
372 Ga0068868_100465458
373 Ga0070660_100616825
374 Ga0070689_100181793
375 Ga0070689_101147781
376 Ga0070661_100215224
377 Ga0070671_100446850
378 Ga0070674_100290461
379 Ga0070688_100071023
380 Ga0070659_100000855
381 Ga0070709_10273056
382 Ga0070714_100076496
383 Ga0070714_100417532
384 Ga0070713_100013565
385 Ga0070713_100082866
386 Ga0070710_10013083
387 Ga0070711_100014522
388 Ga0070711_100041864
389 Ga0070700_100101404
390 Ga0070663_100252884
391 Ga0070678_100143968
392 Ga0070662_100194740
393 Ga0070681_10025800
394 Ga0068867_100063345
395 Ga0068867_100400444
396 Ga0070685_10400870
397 Ga0070707_101150632
398 Ga0070679_100093208
399 Ga0070684_100208423
400 Ga0070684_101190380
401 Ga0068853_100033530
402 Ga0070672_100152584
403 Ga0070686_100032572
404 Ga0070693_100323370
405 Ga0070693_100391453
406 Ga0070665_100190193
407 Ga0070665_101201211
408 Ga0070664_100132515
409 Ga0068854_100106889
410 Ga0068856_100163741
411 Ga0068856_100386460
412 Ga0070702_100107900
413 Ga0070702_100389316
414 Ga0068852_100031151
415 Ga0068852_100204734
416 Ga0068866_10366841
417 Ga0068861_100132873
418 Ga0068861_101110825
419 Ga0068851_10263964
420 Ga0070717_10055769
421 Ga0070716_100488300
422 Ga0070712_100064972
423 Ga0070712_100099901
424 Ga0070712_100846359
425 Ga0097621_100107769
426 Ga0075433_10044333
427 Ga0068865_100311704
428 Ga0075436_100130957
429 Ga0105240_10036906
430 Ga0105240_10615519
431 Ga0105245_10111548
432 Ga0105245_10385845
433 Ga0105247_10587656
434 Ga0105243_10392336
435 Ga0105243_10767439
436 Ga0105241_10582089
437 Ga0105242_10214512
438 Ga0105242_10377636
439 Ga0105248_10142797
440 Ga0105237_10015524
441 Ga0105238_10016144
442 Ga0105238_10341392
443 Ga0105238_10916176
444 Ga0105239_10103115
445 Ga0105239_11298133
446 Ga0105246_10009222
447 Ga0157371_10420182
448 Ga0157370_10018827
449 Ga0157369_10002546
450 Ga0157369_10781475
451 Ga0157374_10925268
452 Ga0157374_11110160
453 Ga0157374_11642897
454 Ga0157378_10294905
455 Ga0163162_10415100
456 Ga0157372_10233162
457 Ga0157372_11397152
458 Ga0157375_10193119
459 Ga0157375_10338196
460 Ga0157375_11179655
461 Ga0163163_10910361
462 Ga0182008_10001349
463 Ga0157377_10152162
464 Ga0157376_11106222
465 Ga0182006_1032792
466 Ga0182007_10042658
467 Ga0163161_10278535
468 Ga0163161_10435304
469 Ga0206355_1459899
470 Ga0206350_11462873
471 Ga0206354_10061152
472 Ga0206353_11064138
473 Ga0154015_1083708
474 Ga0154015_1412171
475 Ga0213876_10017284
476 Ga0213875_10019480
477 Ga0213875_10198154
478 Ga0224712_10291319
479 Ga0207692_10477494
480 Ga0207642_10240749
481 Ga0207688_10030337
482 Ga0207707_10107969
483 Ga0207695_10042997
484 Ga0207695_10080406
485 Ga0207693_10011512
486 Ga0207693_10033507
487 Ga0207693_10585916
488 Ga0207663_10008304
489 Ga0207663_10046489
490 Ga0207657_10064358
491 Ga0207657_10142270
492 Ga0207649_10007926
493 Ga0207652_10570009
494 Ga0207652_10616560
495 Ga0207694_10072071
496 Ga0207694_10418588
497 Ga0207687_10297817
498 Ga0207687_10934199
499 Ga0207700_10040908
500 Ga0207700_11009843
501 Ga0207664_10029252
502 Ga0207664_10082022
503 Ga0207664_11164616
504 Ga0207690_10014302
505 Ga0207706_10217166
506 Ga0207686_10210329
507 Ga0207709_10027671
508 Ga0207709_10235807
509 Ga0207670_10132061
510 Ga0207670_10721075
511 Ga0207669_11023434
512 Ga0207665_10196576
513 Ga0207665_10225023
514 Ga0207691_10156386
515 Ga0207711_10358695
516 Ga0207661_10014362
517 Ga0207661_10125074
518 Ga0207667_11266846
519 Ga0207651_10169407
520 Ga0207668_10345256
521 Ga0207677_10088391
522 Ga0207677_10168671
523 Ga0207639_10026375
524 Ga0207708_10100245
525 Ga0207702_10051312
526 Ga0207648_10059501
527 Ga0207648_10242010
528 Ga0207648_10527597
529 Ga0207675_100131245
530 Ga0207675_100727962
531 Ga0207683_10208592
532 Ga0207698_10140653
533 Ga0207698_10839408
534 Ga0268266_10164655
535 Ga0268266_11033259
536 Ga0265338_10007250
537 Ga0265327_10128798
538 Ga0316576_10018212
539 Ga0307407_10760755
540 Ga0307415_100724149
541 Ga0373939_0151659
542 Ga0373960_0182197
543 Ga0373955_0908945
544 Ga0316574_0000699
545 Ga0373924_0027036
546 Ga0373935_0550192
547 Ga0373937_0005099
548 Ga0316582_0430259
549 Ga0316584_0009078
550 Ga0373925_0861220
551 Ga0395899_0144915
552 Ga0395900_0042894
553 Ga0395900_0291178
554 Ga0395898_0008433
555 Ga0395898_0276508
556 Ga0395905_0141905
557 Ga0395905_0724829
558 Ga0436364_0158021
559 Ga0436364_1043112
560 Ga0436364_1460093
561 Ga0395901_0156273
562 Ga0395901_0187879
563 Ga0395901_0630664
564 Ga0436365_0973085
565 Ga0436360_0008642
566 Ga0436363_1047621
567 Ga0466969_0172570
568 Ga0466965_0230701
569 Ga0466966_0079290
570 Ga0466966_0196517
571 Ga0466961_0045052
572 Ga0466961_0930167
573 Ga0466963_0008351
574 Ga0466963_0039059
575 Ga0466963_0286251
576 Ga0466964_0163019
577 Ga0466971_0130952
578 Ga0466968_0087613
579 Ga0466968_0100558
580 Ga0466970_0128663
581 Ga0466970_0569545
582 Ga0466957_0099374
583 Ga0466957_0155674
584 Ga0466957_0366653
585 Ga0466960_0009852
586 Ga0466959_0137068
587 Ga0466958_0013580
588 Ga0466958_0075722
589 Ga0466958_0089917
590 Ga0466958_0140850
591 Ga0466958_0503988
592 Ga0466958_0841552
593 Ga0466967_0001572
594 Ga0466967_0081716
595 Ga0466967_0216474
596 Ga0466967_0430798
597 Ga0466967_0455328
598 Ga0466967_0555999
599 Ga0495592_0018710
600 Ga0495641_0072662
601 Ga0495651_0034946
602 Ga0495653_0065081
603 Ga0495582_0094158
604 Ga0495664_0000007
605 Ga0495664_0040135
606 Ga0495594_0437474
607 Ga0495608_0044838
608 Ga0495608_0470004
609 Ga0495618_0022916
610 Ga0495628_0026822
611 Ga0495630_0750907
612 Ga0495652_0029029
613 Ga0495652_0218085
614 Ga0495640_0083481
615 Ga0495587_0056285
616 Ga0495667_0032285
617 Ga0495635_0009571
618 Ga0495657_0001496
619 Ga0495599_0024408
620 Ga0495646_0099497
621 Ga0495658_0565989
622 Ga0495613_0319229
623 Ga0495604_0017806
624 Ga0495674_0048796
625 Ga0495680_0011442
626 Ga0495680_0226024
627 Ga0495680_0868877
628 Ga0495675_0091264
629 Ga0495684_0090063
630 Ga0495602_0009371
631 Ga0496100_0000940
632 Ga0496100_0038900
633 Ga0496100_0151582
634 Ga0496101_0010152
635 Ga0496101_0013314
636 Ga0496101_1115790
637 Ga0496102_0003910
638 Ga0496102_0019827
639 Ga0496102_0088305
640 Ga0496102_0925957
641 Ga0496103_0059230
642 Ga0496103_0165372
643 Ga0496104_1201017
644 Ga0496105_0078179
645 Ga0496105_0178305
646 Ga0496105_0306450
647 Ga0496105_0619238
648 Ga0496106_0000189
649 Ga0496106_0030997
650 Ga0496107_0020039
651 Ga0496107_0024754
652 Ga0496108_0131206
653 Ga0496108_0138068
654 Ga0496108_0160864
655 Ga0496108_0216558
656 Ga0496108_0933356
657 Ga0496109_0165101
658 Ga0496109_0197740
659 Ga0496109_0931722
660 Ga0496110_0130605
661 Ga0496110_0327734
662 Ga0496110_0640008
663 Ga0496110_0875362
664 Ga0496112_0035748
665 Ga0496112_0042276
666 Ga0496112_0581680
667 Ga0496113_0072635
668 Ga0496113_0584622
669 Ga0496114_0152402
670 Ga0496114_0395134
671 Ga0496115_0007944
672 Ga0496115_0099555
673 Ga0501306_045465
674 Ga0501318_035883
675 Ga0501321_055759
676 Ga0501031_0029188
677 Ga0501032_0168461
678 Ga0501039_0013431
679 Ga0501040_0105182
680 Ga0501041_0106555
681 Ga0501042_0020748
682 Ga0501046_0329033
683 Ga0501048_0011760
684 Ga0501068_0168786
685 Ga0501070_0130212
686 Ga0501071_0011657
687 Ga0501072_0012643
688 Ga0501074_0120380
689 Ga0501075_0018402
690 Ga0501076_0034966
691 Ga0501077_0026057
692 Ga0501080_0188826
693 Ga0501081_0103748
694 Ga0501083_0132478
695 Ga0501035_0069139
696 Ga0501045_0118185
697 nmdc:mga0n895_488366_c1
698 nmdc:mga0n895_52957_c1
699 nmdc:mga0rr50_509332_c1
700 nmdc:mga0a205_7064_c1
701 Ga0495601_0370244
702 Ga0495595_0011775
703 Ga0495595_0288894
704 Ga0495619_0009306
705 Ga0501084_0000010
706 Ga0501084_0014988
707 Ga0501082_0084044
708 Ga0466962_0043954
709 Ga0530510_0066698
710 2791915543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

31

193

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.9298 18 189
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9184 17 189
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9131 17 189
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9097 21 184
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9082 17 188
ID Description Score Start End Superfamily
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9298 18 189 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9241 17 189 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9207 21 184 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9188 17 189 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9043 18 189 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A7Y3CSM6-F1-model_v4 YceI family protein 0.9791 13 149
AF-A0A3M2DXZ1-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9778 16 188
AF-A0A7V9Q3E2-F1-model_v4 YceI family protein 0.9764 14 142
AF-A0A537YMS8-F1-model_v4 YceI family protein 0.9759 9 188
AF-A0A101NYX5-F1-model_v4 deleted 0.9739 16 191

Map