F420302

General Info

Members Datasets Scaffolds Average Seq Length
355 228 710 158

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0034247|Ga0501076_0034247_3314_3919
Length 186
Sequence MIAMDGRAVALNHVSVPARDLEESRRFYVDVLGLEPVPSPDFAFPVEWLRCGDLQVHLYRRDGDAAPGLYQHFGLTIDDFMAVYRRVRALGIHEPTAYYSAVYELPDGGVQMYLRDPAGNLVELDHPDASTVIRAEVPEYRVLADDNPQSETARRSTLFLALRPRPGQEISLKLVPSGSAACARRP

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
227 2643221651 Afipia sp. Root123D2 Isolate Unclassified
228 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0.56
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0.56
Rhizoplane 14.37
Rhizosphere 78.59
Stem 0
Stem Tuber 0
Unclassified 17.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0034247 3300049592 Bacteria 3969
2 LJQas_1002329 3300000549 Bacteria 2660
3 JGI25407J50210_10014178 3300003373 Unclassified 2054
4 JGI25407J50210_10014655 3300003373 Unclassified 2021
5 JGI25407J50210_10052173 3300003373 Unclassified 1035
6 Ga0070683_100022297 3300005329 Bacteria 5657
7 Ga0070690_100602231 3300005330 Bacteria 834
8 Ga0068869_100507320 3300005334 Bacteria 1008
9 Ga0070680_100094102 3300005336 Bacteria 2483
10 Ga0070682_100179524 3300005337 Bacteria 1477
11 Ga0068868_100150558 3300005338 Unclassified 1916
12 Ga0068868_101335759 3300005338 Bacteria 667
13 Ga0070660_100117530 3300005339 Bacteria 2121
14 Ga0070661_100082876 3300005344 Bacteria 2369
15 Ga0070661_100652023 3300005344 Bacteria 855
16 Ga0070668_101173412 3300005347 Bacteria 695
17 Ga0070671_100383259 3300005355 Bacteria 1202
18 Ga0070674_100122036 3300005356 Unclassified 1930
19 Ga0070659_100201693 3300005366 Bacteria 1638
20 Ga0070714_100618991 3300005435 Bacteria 1041
21 Ga0070713_101708085 3300005436 Bacteria 611
22 Ga0070694_100938997 3300005444 Bacteria 716
23 Ga0070663_100376062 3300005455 Bacteria 1156
24 Ga0070663_100722766 3300005455 Bacteria 848
25 Ga0070678_100129004 3300005456 Bacteria 2006
26 Ga0070681_10011452 3300005458 Bacteria 8777
27 Ga0070698_100226922 3300005471 Unclassified 1801
28 Ga0070679_100024534 3300005530 Bacteria 5910
29 Ga0070684_100025545 3300005535 Bacteria 4967
30 Ga0070684_100278689 3300005535 Bacteria 1532
31 Ga0070686_100193251 3300005544 Bacteria 1454
32 Ga0070686_100304197 3300005544 Unclassified 1183
33 Ga0070693_100003759 3300005547 Bacteria 7106
34 Ga0070665_101021311 3300005548 Bacteria 839
35 Ga0068855_100557240 3300005563 Bacteria 1240
36 Ga0068855_101185781 3300005563 Unclassified 795
37 Ga0070664_100184366 3300005564 Bacteria 1857
38 Ga0068854_100805304 3300005578 Bacteria 819
39 Ga0068856_100020311 3300005614 Bacteria 6452
40 Ga0068856_100052463 3300005614 Bacteria 4021
41 Ga0068856_101156003 3300005614 Bacteria 791
42 Ga0068852_100419328 3300005616 Bacteria 1320
43 Ga0068863_100524517 3300005841 Bacteria 1168
44 Ga0068862_100589378 3300005844 Unclassified 1066
45 Ga0081455_10941095 3300005937 Bacteria 536
46 Ga0081538_10001715 3300005981 Bacteria 22319
47 Ga0081538_10001992 3300005981 Bacteria 20409
48 Ga0081538_10007878 3300005981 Bacteria 9130
49 Ga0081538_10031235 3300005981 Bacteria 3597
50 Ga0081540_1200468 3300005983 Bacteria 726
51 Ga0081539_10009547 3300005985 Bacteria 8079
52 Ga0070717_10681411 3300006028 Bacteria 934
53 Ga0075368_10007771 3300006042 Bacteria 3798
54 Ga0075364_10373509 3300006051 Unclassified 972
55 Ga0070712_100322274 3300006175 Bacteria 1257
56 Ga0075367_10444859 3300006178 Bacteria 821
57 Ga0075366_10148110 3300006195 Bacteria 1421
58 Ga0097621_100074872 3300006237 Bacteria 2805
59 Ga0068871_100091517 3300006358 Bacteria 2535
60 Ga0075430_100992029 3300006846 Unclassified 692
61 Ga0105240_10007889 3300009093 Bacteria 15352
62 Ga0105245_10038773 3300009098 Bacteria 4240
63 Ga0105245_10329854 3300009098 Bacteria 1506
64 Ga0105245_10690243 3300009098 Unclassified 1053
65 Ga0105245_10852185 3300009098 Bacteria 951
66 Ga0105243_10248358 3300009148 Bacteria 1587
67 Ga0105238_10566529 3300009551 Bacteria 1141
68 Ga0105239_10228129 3300010375 Bacteria 2089
69 Ga0105239_11028331 3300010375 Unclassified 948
70 Ga0157374_10141106 3300013296 Bacteria 2339
71 Ga0157378_10870768 3300013297 Bacteria 930
72 Ga0163162_10319145 3300013306 Bacteria 1686
73 Ga0163162_11140218 3300013306 Unclassified 884
74 Ga0157375_10355645 3300013308 Bacteria 1631
75 Ga0157375_10422053 3300013308 Bacteria 1500
76 Ga0163163_10445522 3300014325 Bacteria 1355
77 Ga0182008_10094826 3300014497 Bacteria 1472
78 Ga0157377_10625810 3300014745 Bacteria 771
79 Ga0157376_10230472 3300014969 Bacteria 1720
80 Ga0157376_10686556 3300014969 Bacteria 1027
81 Ga0206350_10952067 3300020080 Bacteria 802
82 Ga0213874_10004394 3300021377 Unclassified 3214
83 Ga0213876_10024129 3300021384 Bacteria 3210
84 Ga0213876_10031202 3300021384 Unclassified 2813
85 Ga0213875_10378449 3300021388 Bacteria 674
86 Ga0224712_10232710 3300022467 Bacteria 846
87 Ga0207692_10367202 3300025898 Bacteria 890
88 Ga0207693_10424275 3300025915 Bacteria 1039
89 Ga0207660_10011603 3300025917 Bacteria 5744
90 Ga0207657_10151937 3300025919 Bacteria 1885
91 Ga0207649_10032374 3300025920 Bacteria 3117
92 Ga0207649_10697390 3300025920 Bacteria 787
93 Ga0207652_10004638 3300025921 Bacteria 11139
94 Ga0207646_10278839 3300025922 Unclassified 1510
95 Ga0207694_10364790 3300025924 Unclassified 1197
96 Ga0207659_10739390 3300025926 Bacteria 843
97 Ga0207687_10027675 3300025927 Bacteria 3805
98 Ga0207687_10116567 3300025927 Bacteria 1991
99 Ga0207687_10700586 3300025927 Bacteria 859
100 Ga0207644_10313384 3300025931 Bacteria 1267
101 Ga0207690_10496954 3300025932 Bacteria 986
102 Ga0207706_10362424 3300025933 Unclassified 1259
103 Ga0207686_10187721 3300025934 Bacteria 1471
104 Ga0207709_10231293 3300025935 Bacteria 1339
105 Ga0207661_10007531 3300025944 Bacteria 7742
106 Ga0207679_10014918 3300025945 Bacteria 5119
107 Ga0207667_10178675 3300025949 Bacteria 2180
108 Ga0207667_10806549 3300025949 Unclassified 935
109 Ga0207640_10175830 3300025981 Bacteria 1600
110 Ga0207640_10753655 3300025981 Bacteria 840
111 Ga0207677_10452814 3300026023 Unclassified 1100
112 Ga0207678_10108796 3300026067 Bacteria 2365
113 Ga0207678_10354780 3300026067 Bacteria 1265
114 Ga0207702_10191423 3300026078 Bacteria 1890
115 Ga0207702_10525515 3300026078 Bacteria 1155
116 Ga0207641_10624156 3300026088 Bacteria 1057
117 Ga0207683_10093577 3300026121 Bacteria 2678
118 Ga0207698_10393046 3300026142 Bacteria 1323
119 Ga0307409_100584727 3300031995 Bacteria 1101
120 Ga0307416_100105276 3300032002 Bacteria 2469
121 Ga0307416_100151414 3300032002 Bacteria 2128
122 Ga0307411_10570368 3300032005 Bacteria 969
123 Ga0307415_101014899 3300032126 Bacteria 772
124 Ga0373934_0020238 3300035086 Bacteria 2557
125 Ga0373923_0011617 3300035111 Bacteria 3236
126 Ga0373953_0007293 3300035117 Bacteria 3697
127 Ga0373954_0059739 3300035118 Bacteria 1797
128 Ga0373956_0023731 3300035119 Bacteria 2635
129 Ga0373957_0008387 3300035120 Bacteria 3344
130 Ga0373955_0010243 3300035172 Bacteria 4420
131 Ga0373924_0005907 3300035410 Bacteria 4362
132 Ga0373931_0372261 3300035691 Bacteria 899
133 Ga0373935_0182278 3300035692 Bacteria 1442
134 Ga0373933_0003745 3300035724 Bacteria 8404
135 Ga0373947_0789030 3300035725 Bacteria 648
136 Ga0373937_0045198 3300036401 Bacteria 4023
137 Ga0373925_0153123 3300037068 Bacteria 1812
138 Ga0395900_0019382 3300037418 Bacteria 6938
139 Ga0395900_0052070 3300037418 Bacteria 4215
140 Ga0395900_0488246 3300037418 Bacteria 1183
141 Ga0395898_0025631 3300037466 Bacteria 5940
142 Ga0395898_0128103 3300037466 Bacteria 2432
143 Ga0395898_0366350 3300037466 Bacteria 1374
144 Ga0395898_0748986 3300037466 Archaea 918
145 Ga0395905_0234124 3300037471 Bacteria 1717
146 Ga0395905_0310525 3300037471 Bacteria 1465
147 Ga0395905_1643752 3300037471 Unclassified 547
148 Ga0436364_0012543 3300037853 Bacteria 1298
149 Ga0436364_0151232 3300037853 Bacteria 6664
150 Ga0436364_0422383 3300037853 Bacteria 1091
151 Ga0436364_0943450 3300037853 Unclassified 1061
152 Ga0436364_0995303 3300037853 Bacteria 979
153 Ga0395901_0034199 3300038443 Bacteria 5248
154 Ga0395901_0178484 3300038443 Bacteria 2227
155 Ga0395901_0865798 3300038443 Bacteria 888
156 Ga0436365_0879258 3300039437 Unclassified 1525
157 Ga0436365_1572415 3300039437 Bacteria 5603
158 Ga0436363_0614756 3300039450 Bacteria 852
159 Ga0436363_1338885 3300039450 Bacteria 10208
160 Ga0436362_0267184 3300039453 Bacteria 1752
161 Ga0466966_0218923 3300044684 Unclassified 1150
162 Ga0466963_0452516 3300044694 Bacteria 906
163 Ga0466964_0488715 3300044706 Unclassified 659
164 Ga0466957_0151539 3300044842 Bacteria 1500
165 Ga0466967_0079932 3300045976 Bacteria 2949
166 Ga0495592_0063222 3300046454 Bacteria 2715
167 Ga0495603_0047301 3300046455 Bacteria 2562
168 Ga0495603_0313425 3300046455 Unclassified 901
169 Ga0495629_0044606 3300046459 Bacteria 3111
170 Ga0495629_0135118 3300046459 Bacteria 1717
171 Ga0495629_0145088 3300046459 Bacteria 1651
172 Ga0495638_0107190 3300046460 Bacteria 1664
173 Ga0495638_0444718 3300046460 Bacteria 663
174 Ga0495651_0246123 3300046462 Bacteria 1223
175 Ga0495653_0062167 3300046463 Bacteria 2822
176 Ga0495605_0120993 3300046474 Unclassified 1187
177 Ga0495664_0016506 3300046477 Bacteria 4208
178 Ga0495584_0221481 3300046491 Unclassified 962
179 Ga0495608_0005383 3300046511 Bacteria 9145
180 Ga0495618_0123552 3300046514 Bacteria 1657
181 Ga0495620_0166098 3300046515 Unclassified 857
182 Ga0495628_0140041 3300046516 Bacteria 1846
183 Ga0495630_0067335 3300046517 Bacteria 2692
184 Ga0495631_0178941 3300046518 Unclassified 909
185 Ga0495663_0168285 3300046525 Unclassified 755
186 Ga0495642_0150241 3300046528 Unclassified 1007
187 Ga0495652_0123516 3300046529 Bacteria 2060
188 Ga0495640_0040622 3300046533 Bacteria 3256
189 Ga0495586_0016184 3300046535 Bacteria 3968
190 Ga0495587_0041047 3300046536 Bacteria 2761
191 Ga0495609_0279722 3300046538 Unclassified 683
192 Ga0495645_0028009 3300046543 Bacteria 4093
193 Ga0495667_0011446 3300046559 Bacteria 6003
194 Ga0495634_0026028 3300046642 Bacteria 4086
195 Ga0495634_0087445 3300046642 Bacteria 2028
196 Ga0495625_0636899 3300046660 Bacteria 636
197 Ga0495635_0024237 3300046663 Bacteria 4230
198 Ga0495657_0181257 3300046675 Bacteria 1292
199 Ga0495599_0004729 3300046678 Bacteria 8089
200 Ga0495623_0025313 3300046679 Bacteria 3822
201 Ga0495646_0004063 3300046680 Bacteria 9180
202 Ga0495658_0297545 3300046683 Bacteria 1020
203 Ga0495613_0209286 3300046689 Bacteria 1372
204 Ga0495670_0509671 3300046691 Unclassified 654
205 Ga0495600_0034178 3300046809 Bacteria 3300
206 Ga0495604_0133165 3300047317 Bacteria 1784
207 Ga0495674_0010537 3300047319 Bacteria 8749
208 Ga0495676_0334485 3300047321 Unclassified 1015
209 Ga0495680_0014945 3300047322 Bacteria 6706
210 Ga0495675_0004414 3300047444 Bacteria 8510
211 Ga0495684_0005066 3300047471 Bacteria 10283
212 Ga0495593_0342721 3300047673 Bacteria 747
213 Ga0495602_0040441 3300048088 Bacteria 4275
214 Ga0495626_0140247 3300048091 Bacteria 1026
215 Ga0496100_0186457 3300048903 Bacteria 1503
216 Ga0496100_0224873 3300048903 Bacteria 1379
217 Ga0496100_0268365 3300048903 Unclassified 1268
218 Ga0496100_0387043 3300048903 Bacteria 1063
219 Ga0496101_0012110 3300048904 Bacteria 5748
220 Ga0496101_0064203 3300048904 Bacteria 2674
221 Ga0496101_0992258 3300048904 Bacteria 660
222 Ga0496102_0008870 3300048905 Bacteria 8629
223 Ga0496102_0050824 3300048905 Bacteria 3775
224 Ga0496102_0088213 3300048905 Bacteria 2867
225 Ga0496102_0191801 3300048905 Bacteria 1926
226 Ga0496103_0028725 3300048906 Bacteria 3377
227 Ga0496103_0210263 3300048906 Bacteria 1251
228 Ga0496104_0000151 3300048907 Bacteria 64587
229 Ga0496104_0031906 3300048907 Bacteria 4901
230 Ga0496104_0113395 3300048907 Bacteria 2599
231 Ga0496104_0722439 3300048907 Unclassified 904
232 Ga0496105_0000049 3300048908 Bacteria 94762
233 Ga0496105_0025522 3300048908 Unclassified 4811
234 Ga0496105_0279563 3300048908 Unclassified 1346
235 Ga0496105_0869171 3300048908 Bacteria 681
236 Ga0496106_0042730 3300048909 Bacteria 3399
237 Ga0496106_0309444 3300048909 Unclassified 1267
238 Ga0496107_0011734 3300048910 Bacteria 6113
239 Ga0496107_0096446 3300048910 Bacteria 2164
240 Ga0496107_0494228 3300048910 Bacteria 908
241 Ga0496108_0002166 3300048911 Bacteria 15743
242 Ga0496108_0014111 3300048911 Bacteria 6516
243 Ga0496108_0158951 3300048911 Bacteria 1952
244 Ga0496108_0192932 3300048911 Bacteria 1766
245 Ga0496109_0000205 3300048912 Bacteria 58240
246 Ga0496109_0013350 3300048912 Bacteria 7121
247 Ga0496109_0061402 3300048912 Bacteria 3436
248 Ga0496109_0635935 3300048912 Unclassified 1004
249 Ga0496110_0002691 3300048913 Bacteria 13422
250 Ga0496110_0010296 3300048913 Bacteria 7599
251 Ga0496111_0016130 3300048914 Bacteria 5145
252 Ga0496111_0019366 3300048914 Bacteria 4725
253 Ga0496111_0032664 3300048914 Bacteria 3711
254 Ga0496111_0146858 3300048914 Bacteria 1748
255 Ga0496112_0048672 3300048915 Bacteria 4155
256 Ga0496113_0083161 3300048916 Bacteria 2456
257 Ga0496113_0893634 3300048916 Bacteria 703
258 Ga0496114_0000129 3300048917 Bacteria 54506
259 Ga0496114_0004229 3300048917 Bacteria 11123
260 Ga0496114_1252531 3300048917 Unclassified 628
261 Ga0496115_0063777 3300048918 Bacteria 2973
262 Ga0496115_0077978 3300048918 Unclassified 2695
263 Ga0496115_0462166 3300048918 Bacteria 1024
264 Ga0496115_0507830 3300048918 Bacteria 968
265 Ga0496115_0889880 3300048918 Bacteria 687
266 Ga0496126_0267559 3300048929 Bacteria 1419
267 Ga0501031_0043212 3300049568 Bacteria 2941
268 Ga0501032_0035307 3300049569 Bacteria 3418
269 Ga0501033_0017491 3300049570 Bacteria 5416
270 Ga0501034_0067509 3300049571 Bacteria 3589
271 Ga0501034_0560125 3300049571 Bacteria 1052
272 Ga0501037_0262872 3300049573 Bacteria 1205
273 Ga0501037_0705006 3300049573 Bacteria 671
274 Ga0501038_0027546 3300049574 Bacteria 5055
275 Ga0501039_0081706 3300049575 Bacteria 2516
276 Ga0501039_0540376 3300049575 Bacteria 914
277 Ga0501040_0038524 3300049576 Bacteria 3250
278 Ga0501040_0060416 3300049576 Bacteria 2604
279 Ga0501040_0145003 3300049576 Bacteria 1673
280 Ga0501040_0557093 3300049576 Bacteria 827
281 Ga0501041_0096383 3300049577 Bacteria 1829
282 Ga0501041_0578281 3300049577 Bacteria 716
283 Ga0501042_0054533 3300049578 Bacteria 2852
284 Ga0501042_0237919 3300049578 Unclassified 1314
285 Ga0501042_0260616 3300049578 Bacteria 1251
286 Ga0501043_0049994 3300049579 Bacteria 3286
287 Ga0501046_0110575 3300049580 Bacteria 2100
288 Ga0501046_0340981 3300049580 Bacteria 1089
289 Ga0501046_0972219 3300049580 Bacteria 590
290 Ga0501047_0630840 3300049581 Bacteria 892
291 Ga0501048_0023920 3300049582 Bacteria 4461
292 Ga0501048_0203382 3300049582 Bacteria 1404
293 Ga0501067_0030430 3300049583 Bacteria 2994
294 Ga0501068_0004859 3300049584 Bacteria 7318
295 Ga0501069_0014672 3300049585 Bacteria 4191
296 Ga0501070_0427458 3300049586 Bacteria 1069
297 Ga0501070_0489725 3300049586 Bacteria 988
298 Ga0501071_0047808 3300049587 Bacteria 3074
299 Ga0501071_0333443 3300049587 Unclassified 1153
300 Ga0501071_1010076 3300049587 Bacteria 642
301 Ga0501072_0053691 3300049588 Bacteria 3174
302 Ga0501072_0106222 3300049588 Bacteria 2233
303 Ga0501072_0117111 3300049588 Bacteria 2122
304 Ga0501072_0405326 3300049588 Unclassified 1081
305 Ga0501073_0022764 3300049589 Bacteria 4507
306 Ga0501074_0284906 3300049590 Bacteria 1174
307 Ga0501075_0048544 3300049591 Bacteria 3189
308 Ga0501075_0174588 3300049591 Unclassified 1640
309 Ga0501075_1257560 3300049591 Bacteria 561
310 Ga0501076_0137758 3300049592 Bacteria 1982
311 Ga0501076_0224374 3300049592 Bacteria 1535
312 Ga0501077_0086745 3300049593 Unclassified 1984
313 Ga0501077_0165924 3300049593 Bacteria 1403
314 Ga0501079_0169139 3300049741 Bacteria 1704
315 Ga0501079_0530492 3300049741 Unclassified 925
316 Ga0501079_0680415 3300049741 Bacteria 810
317 Ga0501080_0192225 3300049742 Bacteria 1875
318 Ga0501080_0435874 3300049742 Unclassified 1176
319 Ga0501080_0542457 3300049742 Unclassified 1036
320 Ga0501080_1599345 3300049742 Unclassified 552
321 Ga0501083_0016899 3300049744 Bacteria 5096
322 Ga0501035_0025347 3300049822 Bacteria 5437
323 Ga0501035_0449803 3300049822 Unclassified 1066
324 Ga0501044_0045353 3300049823 Bacteria 4555
325 Ga0501044_1074499 3300049823 Bacteria 675
326 Ga0501045_0390800 3300049824 Unclassified 1035
327 Ga0501045_0489224 3300049824 Bacteria 914
328 Ga0501045_0687471 3300049824 Bacteria 755
329 Ga0501045_0736921 3300049824 Unclassified 726
330 Ga0501045_0764786 3300049824 Unclassified 712
331 nmdc:mga03n38_28151_c1 3300050490 Bacteria 2339
332 nmdc:mga00v17_347708_c1 3300050491 Unclassified 964
333 nmdc:mga0k408_78214_c1 3300050493 Bacteria 1934
334 nmdc:mga06z11_2242_c1 3300050494 Bacteria 7351
335 nmdc:mga0n895_412090_c1 3300050512 Unclassified 1366
336 nmdc:mga0a205_1265323_c1 3300050515 Bacteria 585
337 Ga0495601_0036767 3300053077 Bacteria 3059
338 Ga0495612_0011579 3300053078 Bacteria 3552
339 Ga0495595_0022021 3300053084 Bacteria 2792
340 Ga0495619_0191237 3300053085 Bacteria 1416
341 Ga0501084_0065213 3300054114 Bacteria 3047
342 Ga0501084_0259484 3300054114 Unclassified 1467
343 Ga0501084_0575977 3300054114 Unclassified 951
344 Ga0501084_0630331 3300054114 Bacteria 905
345 Ga0501082_0036003 3300060353 Bacteria 4265
346 Ga0501082_0095460 3300060353 Bacteria 2570
347 Ga0501082_0202103 3300060353 Unclassified 1729
348 Ga0501082_0715315 3300060353 Bacteria 876
349 Ga0530510_0075678 3300061734 Bacteria 2445
350 Ga0530510_0134705 3300061734 Bacteria 1818
351 Ga0530510_0627180 3300061734 Unclassified 818
352 Ga0530510_1051040 3300061734 Bacteria 623
353 2524464992 2524023210 Bacteria 9029266
354 2644291220 2643221651 Bacteria 4798932
355 8056681921 8056681323 Bacteria 8472857
356 Ga0501076_0034247
357 LJQas_1002329
358 JGI25407J50210_10014178
359 JGI25407J50210_10014655
360 JGI25407J50210_10052173
361 Ga0070683_100022297
362 Ga0070690_100602231
363 Ga0068869_100507320
364 Ga0070680_100094102
365 Ga0070682_100179524
366 Ga0068868_100150558
367 Ga0068868_101335759
368 Ga0070660_100117530
369 Ga0070661_100082876
370 Ga0070661_100652023
371 Ga0070668_101173412
372 Ga0070671_100383259
373 Ga0070674_100122036
374 Ga0070659_100201693
375 Ga0070714_100618991
376 Ga0070713_101708085
377 Ga0070694_100938997
378 Ga0070663_100376062
379 Ga0070663_100722766
380 Ga0070678_100129004
381 Ga0070681_10011452
382 Ga0070698_100226922
383 Ga0070679_100024534
384 Ga0070684_100025545
385 Ga0070684_100278689
386 Ga0070686_100193251
387 Ga0070686_100304197
388 Ga0070693_100003759
389 Ga0070665_101021311
390 Ga0068855_100557240
391 Ga0068855_101185781
392 Ga0070664_100184366
393 Ga0068854_100805304
394 Ga0068856_100020311
395 Ga0068856_100052463
396 Ga0068856_101156003
397 Ga0068852_100419328
398 Ga0068863_100524517
399 Ga0068862_100589378
400 Ga0081455_10941095
401 Ga0081538_10001715
402 Ga0081538_10001992
403 Ga0081538_10007878
404 Ga0081538_10031235
405 Ga0081540_1200468
406 Ga0081539_10009547
407 Ga0070717_10681411
408 Ga0075368_10007771
409 Ga0075364_10373509
410 Ga0070712_100322274
411 Ga0075367_10444859
412 Ga0075366_10148110
413 Ga0097621_100074872
414 Ga0068871_100091517
415 Ga0075430_100992029
416 Ga0105240_10007889
417 Ga0105245_10038773
418 Ga0105245_10329854
419 Ga0105245_10690243
420 Ga0105245_10852185
421 Ga0105243_10248358
422 Ga0105238_10566529
423 Ga0105239_10228129
424 Ga0105239_11028331
425 Ga0157374_10141106
426 Ga0157378_10870768
427 Ga0163162_10319145
428 Ga0163162_11140218
429 Ga0157375_10355645
430 Ga0157375_10422053
431 Ga0163163_10445522
432 Ga0182008_10094826
433 Ga0157377_10625810
434 Ga0157376_10230472
435 Ga0157376_10686556
436 Ga0206350_10952067
437 Ga0213874_10004394
438 Ga0213876_10024129
439 Ga0213876_10031202
440 Ga0213875_10378449
441 Ga0224712_10232710
442 Ga0207692_10367202
443 Ga0207693_10424275
444 Ga0207660_10011603
445 Ga0207657_10151937
446 Ga0207649_10032374
447 Ga0207649_10697390
448 Ga0207652_10004638
449 Ga0207646_10278839
450 Ga0207694_10364790
451 Ga0207659_10739390
452 Ga0207687_10027675
453 Ga0207687_10116567
454 Ga0207687_10700586
455 Ga0207644_10313384
456 Ga0207690_10496954
457 Ga0207706_10362424
458 Ga0207686_10187721
459 Ga0207709_10231293
460 Ga0207661_10007531
461 Ga0207679_10014918
462 Ga0207667_10178675
463 Ga0207667_10806549
464 Ga0207640_10175830
465 Ga0207640_10753655
466 Ga0207677_10452814
467 Ga0207678_10108796
468 Ga0207678_10354780
469 Ga0207702_10191423
470 Ga0207702_10525515
471 Ga0207641_10624156
472 Ga0207683_10093577
473 Ga0207698_10393046
474 Ga0307409_100584727
475 Ga0307416_100105276
476 Ga0307416_100151414
477 Ga0307411_10570368
478 Ga0307415_101014899
479 Ga0373934_0020238
480 Ga0373923_0011617
481 Ga0373953_0007293
482 Ga0373954_0059739
483 Ga0373956_0023731
484 Ga0373957_0008387
485 Ga0373955_0010243
486 Ga0373924_0005907
487 Ga0373931_0372261
488 Ga0373935_0182278
489 Ga0373933_0003745
490 Ga0373947_0789030
491 Ga0373937_0045198
492 Ga0373925_0153123
493 Ga0395900_0019382
494 Ga0395900_0052070
495 Ga0395900_0488246
496 Ga0395898_0025631
497 Ga0395898_0128103
498 Ga0395898_0366350
499 Ga0395898_0748986
500 Ga0395905_0234124
501 Ga0395905_0310525
502 Ga0395905_1643752
503 Ga0436364_0012543
504 Ga0436364_0151232
505 Ga0436364_0422383
506 Ga0436364_0943450
507 Ga0436364_0995303
508 Ga0395901_0034199
509 Ga0395901_0178484
510 Ga0395901_0865798
511 Ga0436365_0879258
512 Ga0436365_1572415
513 Ga0436363_0614756
514 Ga0436363_1338885
515 Ga0436362_0267184
516 Ga0466966_0218923
517 Ga0466963_0452516
518 Ga0466964_0488715
519 Ga0466957_0151539
520 Ga0466967_0079932
521 Ga0495592_0063222
522 Ga0495603_0047301
523 Ga0495603_0313425
524 Ga0495629_0044606
525 Ga0495629_0135118
526 Ga0495629_0145088
527 Ga0495638_0107190
528 Ga0495638_0444718
529 Ga0495651_0246123
530 Ga0495653_0062167
531 Ga0495605_0120993
532 Ga0495664_0016506
533 Ga0495584_0221481
534 Ga0495608_0005383
535 Ga0495618_0123552
536 Ga0495620_0166098
537 Ga0495628_0140041
538 Ga0495630_0067335
539 Ga0495631_0178941
540 Ga0495663_0168285
541 Ga0495642_0150241
542 Ga0495652_0123516
543 Ga0495640_0040622
544 Ga0495586_0016184
545 Ga0495587_0041047
546 Ga0495609_0279722
547 Ga0495645_0028009
548 Ga0495667_0011446
549 Ga0495634_0026028
550 Ga0495634_0087445
551 Ga0495625_0636899
552 Ga0495635_0024237
553 Ga0495657_0181257
554 Ga0495599_0004729
555 Ga0495623_0025313
556 Ga0495646_0004063
557 Ga0495658_0297545
558 Ga0495613_0209286
559 Ga0495670_0509671
560 Ga0495600_0034178
561 Ga0495604_0133165
562 Ga0495674_0010537
563 Ga0495676_0334485
564 Ga0495680_0014945
565 Ga0495675_0004414
566 Ga0495684_0005066
567 Ga0495593_0342721
568 Ga0495602_0040441
569 Ga0495626_0140247
570 Ga0496100_0186457
571 Ga0496100_0224873
572 Ga0496100_0268365
573 Ga0496100_0387043
574 Ga0496101_0012110
575 Ga0496101_0064203
576 Ga0496101_0992258
577 Ga0496102_0008870
578 Ga0496102_0050824
579 Ga0496102_0088213
580 Ga0496102_0191801
581 Ga0496103_0028725
582 Ga0496103_0210263
583 Ga0496104_0000151
584 Ga0496104_0031906
585 Ga0496104_0113395
586 Ga0496104_0722439
587 Ga0496105_0000049
588 Ga0496105_0025522
589 Ga0496105_0279563
590 Ga0496105_0869171
591 Ga0496106_0042730
592 Ga0496106_0309444
593 Ga0496107_0011734
594 Ga0496107_0096446
595 Ga0496107_0494228
596 Ga0496108_0002166
597 Ga0496108_0014111
598 Ga0496108_0158951
599 Ga0496108_0192932
600 Ga0496109_0000205
601 Ga0496109_0013350
602 Ga0496109_0061402
603 Ga0496109_0635935
604 Ga0496110_0002691
605 Ga0496110_0010296
606 Ga0496111_0016130
607 Ga0496111_0019366
608 Ga0496111_0032664
609 Ga0496111_0146858
610 Ga0496112_0048672
611 Ga0496113_0083161
612 Ga0496113_0893634
613 Ga0496114_0000129
614 Ga0496114_0004229
615 Ga0496114_1252531
616 Ga0496115_0063777
617 Ga0496115_0077978
618 Ga0496115_0462166
619 Ga0496115_0507830
620 Ga0496115_0889880
621 Ga0496126_0267559
622 Ga0501031_0043212
623 Ga0501032_0035307
624 Ga0501033_0017491
625 Ga0501034_0067509
626 Ga0501034_0560125
627 Ga0501037_0262872
628 Ga0501037_0705006
629 Ga0501038_0027546
630 Ga0501039_0081706
631 Ga0501039_0540376
632 Ga0501040_0038524
633 Ga0501040_0060416
634 Ga0501040_0145003
635 Ga0501040_0557093
636 Ga0501041_0096383
637 Ga0501041_0578281
638 Ga0501042_0054533
639 Ga0501042_0237919
640 Ga0501042_0260616
641 Ga0501043_0049994
642 Ga0501046_0110575
643 Ga0501046_0340981
644 Ga0501046_0972219
645 Ga0501047_0630840
646 Ga0501048_0023920
647 Ga0501048_0203382
648 Ga0501067_0030430
649 Ga0501068_0004859
650 Ga0501069_0014672
651 Ga0501070_0427458
652 Ga0501070_0489725
653 Ga0501071_0047808
654 Ga0501071_0333443
655 Ga0501071_1010076
656 Ga0501072_0053691
657 Ga0501072_0106222
658 Ga0501072_0117111
659 Ga0501072_0405326
660 Ga0501073_0022764
661 Ga0501074_0284906
662 Ga0501075_0048544
663 Ga0501075_0174588
664 Ga0501075_1257560
665 Ga0501076_0137758
666 Ga0501076_0224374
667 Ga0501077_0086745
668 Ga0501077_0165924
669 Ga0501079_0169139
670 Ga0501079_0530492
671 Ga0501079_0680415
672 Ga0501080_0192225
673 Ga0501080_0435874
674 Ga0501080_0542457
675 Ga0501080_1599345
676 Ga0501083_0016899
677 Ga0501035_0025347
678 Ga0501035_0449803
679 Ga0501044_0045353
680 Ga0501044_1074499
681 Ga0501045_0390800
682 Ga0501045_0489224
683 Ga0501045_0687471
684 Ga0501045_0736921
685 Ga0501045_0764786
686 nmdc:mga03n38_28151_c1
687 nmdc:mga00v17_347708_c1
688 nmdc:mga0k408_78214_c1
689 nmdc:mga06z11_2242_c1
690 nmdc:mga0n895_412090_c1
691 nmdc:mga0a205_1265323_c1
692 Ga0495601_0036767
693 Ga0495612_0011579
694 Ga0495595_0022021
695 Ga0495619_0191237
696 Ga0501084_0065213
697 Ga0501084_0259484
698 Ga0501084_0575977
699 Ga0501084_0630331
700 Ga0501082_0036003
701 Ga0501082_0095460
702 Ga0501082_0202103
703 Ga0501082_0715315
704 Ga0530510_0075678
705 Ga0530510_0134705
706 Ga0530510_0627180
707 Ga0530510_1051040
708 2524464992
709 2644291220
710 8056681921

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

13

125

0.88

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

124

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8269 1 117
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8126 1 117
1r9c-assembly1.cif.gz_B crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.8073 2 123
2p7q-assembly4.cif.gz_A crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8051 2 117
7w5e-assembly1.cif.gz_A oxidase chap d49l mutant 0.7959 2 118
ID Description Score Start End Superfamily
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8269 63 119 3.30.720.110
af_Q10FQ7_7_135_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8244 7 119 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8159 2 56 3.10.180.10
af_Q9SKZ0_1_135_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7945 3 118 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7923 1 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1H1UB47-F1-model_v4 Catechol 2,3-dioxygenase 0.9761 1 160 GO:0051213
AF-A0A2V2SSY5-F1-model_v4 deleted 0.9694 1 152
AF-A0A1Q7UGU9-F1-model_v4 Glyoxalase 0.9631 16 152
AF-A0A7C9RHC7-F1-model_v4 VOC family protein 0.9612 1 108
AF-A0A504BUU3-F1-model_v4 VOC domain-containing protein 0.9602 2 153 GO:0004493
GO:0046491

Map