F420269

General Info

Members Datasets Scaffolds Average Seq Length
355 211 710 263

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0049475|Ga0495658_0049475_106_936
Length 276
Sequence VTTATSRPSSTRRPDGEVGERIGRLERPAIGGVLMRELINYSSFWRSSAFSSVMEPVIYLLAFGFGVGALVSQVAGQRYLFYVATGTVGMSVMYSGAFPAMFSTFVKYKFQRTYDAIIAAPVDCEELVTAEALWIGVRVGVYGCAPIVVALFFGLPPSWGMLALPFVCFLSGIGWALFGITVAATLNSIDNFSYVITGFLTPMMLTAGTFFPIDNLPTWAQVVALFNPLYNSVELVRGAVFGWHGAADLWHLGYLIVWAFVLWRFAVRQMTRRLVD

Samples

Sample ID Description Type Environment
1 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 13.52
Rhizosphere 84.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495658_0049475 3300046683 Bacteria 2374
2 JGI25407J50210_10000691 3300003373 Bacteria 6999
3 Ga0070683_100004231 3300005329 Bacteria 11769
4 Ga0070690_100026926 3300005330 Bacteria 3551
5 Ga0068869_100343108 3300005334 Bacteria 1216
6 Ga0070680_100072653 3300005336 Bacteria 2828
7 Ga0070682_100281322 3300005337 Bacteria 1213
8 Ga0068868_100108627 3300005338 Bacteria 2252
9 Ga0070660_100117859 3300005339 Bacteria 2117
10 Ga0070689_100316755 3300005340 Bacteria 1302
11 Ga0070671_100197489 3300005355 Bacteria 1705
12 Ga0070673_100070360 3300005364 Bacteria 2807
13 Ga0070673_100419932 3300005364 Bacteria 1199
14 Ga0070659_100225795 3300005366 Bacteria 1547
15 Ga0070667_100115510 3300005367 Bacteria 2331
16 Ga0070713_100089122 3300005436 Bacteria 2649
17 Ga0070711_100241528 3300005439 Bacteria 1412
18 Ga0070700_100004744 3300005441 Bacteria 7132
19 Ga0070700_100035685 3300005441 Bacteria 3010
20 Ga0070663_100153273 3300005455 Bacteria 1769
21 Ga0070663_100166265 3300005455 Bacteria 1702
22 Ga0068867_100107584 3300005459 Bacteria 2137
23 Ga0068867_100352960 3300005459 Bacteria 1228
24 Ga0070706_100022157 3300005467 Bacteria 5849
25 Ga0070698_100034825 3300005471 Bacteria 5209
26 Ga0070699_100010554 3300005518 Bacteria 7995
27 Ga0070684_100007284 3300005535 Bacteria 8600
28 Ga0070684_100238395 3300005535 Bacteria 1661
29 Ga0070697_100397987 3300005536 Bacteria 1195
30 Ga0070695_100060705 3300005545 Bacteria 2450
31 Ga0070696_100006125 3300005546 Bacteria 8031
32 Ga0070696_100065635 3300005546 Bacteria 2544
33 Ga0070693_100024042 3300005547 Bacteria 3264
34 Ga0070693_100208852 3300005547 Bacteria 1273
35 Ga0070665_100003756 3300005548 Bacteria 16075
36 Ga0068857_100007322 3300005577 Bacteria 9506
37 Ga0068854_100133570 3300005578 Bacteria 1897
38 Ga0068856_100044488 3300005614 Bacteria 4370
39 Ga0070702_100085320 3300005615 Bacteria 1901
40 Ga0068852_100018482 3300005616 Bacteria 5492
41 Ga0068852_100623073 3300005616 Bacteria 1084
42 Ga0068859_100127245 3300005617 Bacteria 2617
43 Ga0068861_100032964 3300005719 Bacteria 3818
44 Ga0068851_10158130 3300005834 Bacteria 1243
45 Ga0068863_100389387 3300005841 Bacteria 1362
46 Ga0068860_100272620 3300005843 Bacteria 1652
47 Ga0068862_100492601 3300005844 Bacteria 1162
48 Ga0068862_100613956 3300005844 Bacteria 1045
49 Ga0081455_10005632 3300005937 Bacteria 13680
50 Ga0081455_10067722 3300005937 Bacteria 2974
51 Ga0081538_10000223 3300005981 Bacteria 63727
52 Ga0081539_10002827 3300005985 Bacteria 23201
53 Ga0081539_10033824 3300005985 Bacteria 3104
54 Ga0070717_10456054 3300006028 Bacteria 1152
55 Ga0075365_10037213 3300006038 Bacteria 3158
56 Ga0075365_10040543 3300006038 Bacteria 3037
57 Ga0070715_10006044 3300006163 Bacteria 4085
58 Ga0075367_10231950 3300006178 Bacteria 1156
59 Ga0097621_100028031 3300006237 Bacteria 4435
60 Ga0075428_100043063 3300006844 Bacteria 4964
61 Ga0075428_100178715 3300006844 Bacteria 2298
62 Ga0075428_100484904 3300006844 Bacteria 1323
63 Ga0075431_100019117 3300006847 Bacteria 6980
64 Ga0068865_100145267 3300006881 Bacteria 1793
65 Ga0068865_100202394 3300006881 Bacteria 1542
66 Ga0097620_100127248 3300006931 Bacteria 2617
67 Ga0075435_100003948 3300007076 Bacteria 10136
68 Ga0075435_100244512 3300007076 Bacteria 1527
69 Ga0111539_10003693 3300009094 Bacteria 20135
70 Ga0111539_10044505 3300009094 Bacteria 5318
71 Ga0111539_10131036 3300009094 Bacteria 2936
72 Ga0105245_10030644 3300009098 Bacteria 4758
73 Ga0105245_10082181 3300009098 Bacteria 2947
74 Ga0105245_10130059 3300009098 Bacteria 2360
75 Ga0105247_10014358 3300009101 Bacteria 4755
76 Ga0114129_10040696 3300009147 Bacteria 6551
77 Ga0114129_10346516 3300009147 Bacteria 1969
78 Ga0105243_10258259 3300009148 Bacteria 1559
79 Ga0105241_10012195 3300009174 Bacteria 6307
80 Ga0105242_10046853 3300009176 Bacteria 3509
81 Ga0105249_10230579 3300009553 Bacteria 1826
82 Ga0105249_10382363 3300009553 Bacteria 1434
83 Ga0105249_10507331 3300009553 Bacteria 1252
84 Ga0105249_10529488 3300009553 Bacteria 1227
85 Ga0105239_10088246 3300010375 Bacteria 3420
86 Ga0105239_10129299 3300010375 Bacteria 2808
87 Ga0105239_10161510 3300010375 Bacteria 2503
88 Ga0105239_10521638 3300010375 Bacteria 1352
89 Ga0105246_10070138 3300011119 Bacteria 2464
90 Ga0157373_10258768 3300013100 Bacteria 1231
91 Ga0157369_10319360 3300013105 Bacteria 1614
92 Ga0157374_10145428 3300013296 Bacteria 2302
93 Ga0157374_10282679 3300013296 Bacteria 1638
94 Ga0163162_10176157 3300013306 Bacteria 2264
95 Ga0157372_10638855 3300013307 Bacteria 1240
96 Ga0163163_10028176 3300014325 Bacteria 5390
97 Ga0157377_10067955 3300014745 Bacteria 2052
98 Ga0163161_10232508 3300017792 Bacteria 1431
99 Ga0207426_1021776 3300025302 Bacteria 2211
100 Ga0207710_10023865 3300025900 Bacteria 2630
101 Ga0207688_10015730 3300025901 Bacteria 4104
102 Ga0207688_10279250 3300025901 Bacteria 1017
103 Ga0207699_10052917 3300025906 Bacteria 2406
104 Ga0207643_10121157 3300025908 Bacteria 1550
105 Ga0207654_10132509 3300025911 Bacteria 1579
106 Ga0207693_10057531 3300025915 Bacteria 3047
107 Ga0207663_10012059 3300025916 Bacteria 4660
108 Ga0207660_10191264 3300025917 Bacteria 1594
109 Ga0207657_10126172 3300025919 Bacteria 2102
110 Ga0207649_10283776 3300025920 Bacteria 1205
111 Ga0207650_10087043 3300025925 Bacteria 2380
112 Ga0207687_10043522 3300025927 Bacteria 3094
113 Ga0207687_10046098 3300025927 Bacteria 3017
114 Ga0207687_10090124 3300025927 Bacteria 2234
115 Ga0207687_10192206 3300025927 Bacteria 1589
116 Ga0207644_10152771 3300025931 Bacteria 1788
117 Ga0207690_10122682 3300025932 Bacteria 1890
118 Ga0207706_10215985 3300025933 Bacteria 1680
119 Ga0207686_10079909 3300025934 Bacteria 2130
120 Ga0207709_10221838 3300025935 Bacteria 1364
121 Ga0207709_10280385 3300025935 Bacteria 1231
122 Ga0207670_10238339 3300025936 Bacteria 1400
123 Ga0207665_10002419 3300025939 Bacteria 12632
124 Ga0207689_10123358 3300025942 Bacteria 2131
125 Ga0207689_10302621 3300025942 Bacteria 1325
126 Ga0207661_10006866 3300025944 Bacteria 8072
127 Ga0207712_10009214 3300025961 Bacteria 6252
128 Ga0207712_10030638 3300025961 Bacteria 3618
129 Ga0207712_10329543 3300025961 Bacteria 1262
130 Ga0207668_10050179 3300025972 Bacteria 2874
131 Ga0207668_10215356 3300025972 Bacteria 1539
132 Ga0207640_10398087 3300025981 Bacteria 1121
133 Ga0207703_10616580 3300026035 Bacteria 1027
134 Ga0207639_10079772 3300026041 Bacteria 2588
135 Ga0207678_10044741 3300026067 Bacteria 3829
136 Ga0207678_10137108 3300026067 Bacteria 2088
137 Ga0207708_10006507 3300026075 Bacteria 8649
138 Ga0207708_10061048 3300026075 Bacteria 2878
139 Ga0207708_10062083 3300026075 Bacteria 2854
140 Ga0207702_10013218 3300026078 Bacteria 6865
141 Ga0207702_10055969 3300026078 Bacteria 3347
142 Ga0207702_10398595 3300026078 Bacteria 1327
143 Ga0207648_10189272 3300026089 Bacteria 1823
144 Ga0207648_10529837 3300026089 Bacteria 1080
145 Ga0207676_10099840 3300026095 Bacteria 2403
146 Ga0207676_10411593 3300026095 Bacteria 1266
147 Ga0207674_10001018 3300026116 Bacteria 36636
148 Ga0207674_10280997 3300026116 Bacteria 1612
149 Ga0207675_100115577 3300026118 Bacteria 2535
150 Ga0207675_100160875 3300026118 Bacteria 2141
151 Ga0207683_10001522 3300026121 Bacteria 20883
152 Ga0207683_10632878 3300026121 Bacteria 991
153 Ga0207698_10061221 3300026142 Bacteria 2932
154 Ga0207428_10045884 3300027907 Bacteria 3516
155 Ga0207428_10386510 3300027907 Bacteria 1026
156 Ga0268266_10015613 3300028379 Bacteria 6508
157 Ga0307408_100356960 3300031548 Bacteria 1242
158 Ga0307405_10001746 3300031731 Bacteria 9285
159 Ga0307405_10059432 3300031731 Bacteria 2409
160 Ga0307413_10045806 3300031824 Bacteria 2596
161 Ga0307413_10223853 3300031824 Bacteria 1376
162 Ga0307410_10036392 3300031852 Bacteria 3205
163 Ga0307410_10205537 3300031852 Bacteria 1506
164 Ga0307410_10328217 3300031852 Bacteria 1216
165 Ga0307406_10010463 3300031901 Bacteria 5233
166 Ga0307406_10028208 3300031901 Bacteria 3390
167 Ga0307407_10160375 3300031903 Bacteria 1471
168 Ga0307412_10032463 3300031911 Bacteria 3309
169 Ga0307409_100002794 3300031995 Bacteria 9224
170 Ga0307409_100079840 3300031995 Bacteria 2638
171 Ga0307409_100153779 3300031995 Bacteria 2001
172 Ga0307416_100101633 3300032002 Bacteria 2504
173 Ga0307416_100132185 3300032002 Bacteria 2249
174 Ga0307416_100288287 3300032002 Bacteria 1623
175 Ga0307411_10047986 3300032005 Bacteria 2764
176 Ga0307411_10250117 3300032005 Bacteria 1393
177 Ga0307415_100019447 3300032126 Bacteria 4123
178 Ga0307415_100051323 3300032126 Bacteria 2798
179 Ga0307415_100139367 3300032126 Bacteria 1850
180 Ga0307415_100443348 3300032126 Bacteria 1120
181 Ga0373945_0017908 3300035116 Bacteria 2404
182 Ga0373943_0003407 3300035170 Bacteria 7240
183 Ga0373961_0007734 3300035241 Bacteria 2604
184 Ga0373962_0008022 3300035242 Bacteria 2594
185 Ga0373931_0263862 3300035691 Bacteria 1052
186 Ga0373935_0086802 3300035692 Bacteria 2042
187 Ga0373947_0004356 3300035725 Bacteria 8306
188 Ga0373925_0008298 3300037068 Bacteria 7561
189 Ga0395899_0001601 3300037312 Bacteria 18987
190 Ga0395899_0004793 3300037312 Bacteria 10540
191 Ga0395899_0021149 3300037312 Bacteria 4935
192 Ga0395899_0074079 3300037312 Bacteria 2488
193 Ga0395900_0004880 3300037418 Bacteria 14121
194 Ga0395900_0012547 3300037418 Bacteria 8669
195 Ga0395900_0023403 3300037418 Bacteria 6323
196 Ga0395900_0129245 3300037418 Bacteria 2590
197 Ga0395900_0337477 3300037418 Bacteria 1483
198 Ga0395898_0001382 3300037466 Bacteria 34742
199 Ga0395898_0036961 3300037466 Bacteria 4846
200 Ga0395898_0183112 3300037466 Bacteria 2002
201 Ga0395898_0246653 3300037466 Bacteria 1703
202 Ga0395905_0012816 3300037471 Bacteria 8060
203 Ga0395905_0121983 3300037471 Bacteria 2450
204 Ga0395901_0002672 3300038443 Bacteria 17998
205 Ga0395901_0005244 3300038443 Bacteria 13085
206 Ga0395901_0038014 3300038443 Bacteria 4978
207 Ga0395901_0202329 3300038443 Bacteria 2081
208 Ga0395901_0353204 3300038443 Bacteria 1517
209 Ga0466964_0104902 3300044706 Bacteria 1252
210 Ga0466960_0133923 3300044901 Bacteria 1311
211 Ga0466960_0219349 3300044901 Bacteria 1046
212 Ga0466960_0239525 3300044901 Bacteria 1004
213 Ga0466967_0032310 3300045976 Bacteria 4418
214 Ga0466967_0033323 3300045976 Bacteria 4359
215 Ga0466967_0051614 3300045976 Bacteria 3605
216 Ga0466967_0123855 3300045976 Bacteria 2392
217 Ga0466967_0313364 3300045976 Bacteria 1512
218 Ga0466967_0693427 3300045976 Bacteria 1008
219 Ga0495592_0302475 3300046454 Bacteria 1039
220 Ga0495603_0000523 3300046455 Bacteria 21326
221 Ga0495641_0001734 3300046461 Bacteria 18194
222 Ga0495641_0081865 3300046461 Bacteria 1446
223 Ga0495641_0085019 3300046461 Bacteria 1416
224 Ga0495580_0167392 3300046472 Bacteria 1520
225 Ga0495582_0076900 3300046473 Bacteria 1851
226 Ga0495582_0084354 3300046473 Bacteria 1766
227 Ga0495594_0002831 3300046499 Bacteria 9020
228 Ga0495608_0182793 3300046511 Bacteria 1326
229 Ga0495620_0060737 3300046515 Bacteria 1575
230 Ga0495663_0028861 3300046525 Bacteria 1635
231 Ga0495663_0068086 3300046525 Bacteria 1130
232 Ga0495642_0057962 3300046528 Bacteria 1603
233 Ga0495665_0102101 3300046531 Bacteria 1505
234 Ga0495587_0178467 3300046536 Bacteria 1205
235 Ga0495667_0066273 3300046559 Bacteria 2361
236 Ga0495656_0290779 3300046615 Bacteria 835
237 Ga0495635_0071825 3300046663 Bacteria 2372
238 Ga0495588_0001015 3300046674 Bacteria 12198
239 Ga0495658_0119870 3300046683 Bacteria 1590
240 Ga0495624_0042916 3300046690 Bacteria 2888
241 Ga0495671_0104433 3300046692 Bacteria 1384
242 Ga0495581_0084074 3300047315 Bacteria 1844
243 Ga0495636_0169158 3300047318 Bacteria 988
244 Ga0495676_0005187 3300047321 Bacteria 11921
245 Ga0495676_0264968 3300047321 Bacteria 1168
246 Ga0495680_0068892 3300047322 Bacteria 2701
247 Ga0495680_0194953 3300047322 Bacteria 1456
248 Ga0495593_0150554 3300047673 Bacteria 1177
249 Ga0496100_0031012 3300048903 Bacteria 3320
250 Ga0496100_0052742 3300048903 Bacteria 2645
251 Ga0496100_0162162 3300048903 Bacteria 1603
252 Ga0496100_0526304 3300048903 Bacteria 913
253 Ga0496101_0004254 3300048904 Bacteria 8982
254 Ga0496101_0056872 3300048904 Bacteria 2827
255 Ga0496101_0110328 3300048904 Bacteria 2070
256 Ga0496102_0026201 3300048905 Bacteria 5197
257 Ga0496102_0428840 3300048905 Bacteria 1242
258 Ga0496103_0008508 3300048906 Bacteria 6094
259 Ga0496104_0021030 3300048907 Bacteria 5986
260 Ga0496104_0028807 3300048907 Bacteria 5147
261 Ga0496104_0035266 3300048907 Bacteria 4671
262 Ga0496105_0019379 3300048908 Bacteria 5487
263 Ga0496106_0059651 3300048909 Bacteria 2891
264 Ga0496106_0131346 3300048909 Bacteria 1964
265 Ga0496106_0385250 3300048909 Bacteria 1126
266 Ga0496106_0420142 3300048909 Bacteria 1074
267 Ga0496107_0132238 3300048910 Bacteria 1842
268 Ga0496107_0172283 3300048910 Bacteria 1606
269 Ga0496107_0203917 3300048910 Bacteria 1470
270 Ga0496108_0020521 3300048911 Bacteria 5432
271 Ga0496108_0024662 3300048911 Bacteria 4953
272 Ga0496108_0038365 3300048911 Bacteria 3990
273 Ga0496108_0159745 3300048911 Bacteria 1947
274 Ga0496109_0019875 3300048912 Bacteria 5928
275 Ga0496109_0034566 3300048912 Bacteria 4554
276 Ga0496109_0508492 3300048912 Bacteria 1137
277 Ga0496109_0514882 3300048912 Bacteria 1129
278 Ga0496110_0029784 3300048913 Bacteria 4702
279 Ga0496110_0044148 3300048913 Bacteria 3892
280 Ga0496110_0089957 3300048913 Bacteria 2744
281 Ga0496110_0385149 3300048913 Bacteria 1278
282 Ga0496110_0599483 3300048913 Bacteria 999
283 Ga0496111_0005493 3300048914 Bacteria 8135
284 Ga0496111_0034159 3300048914 Bacteria 3630
285 Ga0496111_0219068 3300048914 Bacteria 1414
286 Ga0496112_0004124 3300048915 Bacteria 12222
287 Ga0496112_0010678 3300048915 Bacteria 8345
288 Ga0496112_0031074 3300048915 Bacteria 5175
289 Ga0496112_0254019 3300048915 Bacteria 1708
290 Ga0496113_0004698 3300048916 Bacteria 8426
291 Ga0496113_0031676 3300048916 Bacteria 3839
292 Ga0496113_0063737 3300048916 Bacteria 2786
293 Ga0496114_0025518 3300048917 Bacteria 4830
294 Ga0496114_0026277 3300048917 Bacteria 4765
295 Ga0496114_0169626 3300048917 Bacteria 1901
296 Ga0496115_0026810 3300048918 Bacteria 4501
297 Ga0501031_0014533 3300049568 Bacteria 5120
298 Ga0501032_0155890 3300049569 Bacteria 1500
299 Ga0501033_0084579 3300049570 Bacteria 2325
300 Ga0501036_0082523 3300049572 Bacteria 2717
301 Ga0501036_0223347 3300049572 Bacteria 1581
302 Ga0501036_0353373 3300049572 Bacteria 1227
303 Ga0501037_0146187 3300049573 Bacteria 1691
304 Ga0501038_0272164 3300049574 Bacteria 1335
305 Ga0501039_0023496 3300049575 Bacteria 4731
306 Ga0501039_0036169 3300049575 Bacteria 3810
307 Ga0501039_0265366 3300049575 Bacteria 1349
308 Ga0501040_0017593 3300049576 Bacteria 4745
309 Ga0501041_0026654 3300049577 Bacteria 3477
310 Ga0501041_0140635 3300049577 Bacteria 1505
311 Ga0501042_0114933 3300049578 Bacteria 1938
312 Ga0501048_0020216 3300049582 Bacteria 4880
313 Ga0501067_0030771 3300049583 Bacteria 2977
314 Ga0501068_0020614 3300049584 Bacteria 3843
315 Ga0501068_0199738 3300049584 Bacteria 1268
316 Ga0501069_0021720 3300049585 Bacteria 3486
317 Ga0501071_0043157 3300049587 Bacteria 3232
318 Ga0501071_0044005 3300049587 Bacteria 3202
319 Ga0501071_0126266 3300049587 Bacteria 1899
320 Ga0501071_0126601 3300049587 Bacteria 1896
321 Ga0501072_0038849 3300049588 Bacteria 3736
322 Ga0501074_0399728 3300049590 Bacteria 974
323 Ga0501074_0447044 3300049590 Bacteria 916
324 Ga0501075_0031507 3300049591 Bacteria 3936
325 Ga0501076_0142305 3300049592 Bacteria 1949
326 Ga0501076_0325601 3300049592 Bacteria 1261
327 Ga0501217_034392 3300049661 Bacteria 1264
328 Ga0501079_0018722 3300049741 Bacteria 5290
329 Ga0501079_0047269 3300049741 Bacteria 3320
330 Ga0501079_0060217 3300049741 Bacteria 2929
331 Ga0501080_0637775 3300049742 Bacteria 943
332 Ga0501081_0011284 3300049743 Bacteria 5845
333 Ga0501081_0166033 3300049743 Bacteria 1592
334 Ga0501035_0114250 3300049822 Bacteria 2365
335 Ga0501045_0007395 3300049824 Bacteria 7635
336 Ga0501045_0016040 3300049824 Bacteria 5315
337 nmdc:mga05p37_31507_c1 3300050507 Bacteria 6476
338 nmdc:mga05p37_551447_c1 3300050507 Bacteria 1312
339 nmdc:mga05p37_592076_c1 3300050507 Bacteria 1253
340 nmdc:mga08y16_1127716_c1 3300050511 Bacteria 758
341 nmdc:mga08y16_130418_c1 3300050511 Bacteria 2614
342 nmdc:mga08y16_45419_c1 3300050511 Bacteria 4603
343 nmdc:mga0rr50_29214_c1 3300050513 Bacteria 3885
344 nmdc:mga0rr50_45677_c1 3300050513 Bacteria 3221
345 nmdc:mga0a205_672007_c1 3300050515 Bacteria 886
346 Ga0495655_0018833 3300053083 Bacteria 1524
347 Ga0495595_0204248 3300053084 Bacteria 984
348 Ga0495619_0090887 3300053085 Bacteria 2067
349 Ga0500641_0121574 3300053096 Bacteria 1126
350 Ga0500616_0034588 3300053153 Bacteria 2752
351 Ga0501084_0040781 3300054114 Bacteria 3884
352 Ga0501084_0227703 3300054114 Bacteria 1573
353 Ga0501084_0303994 3300054114 Bacteria 1347
354 Ga0501082_0073909 3300060353 Bacteria 2935
355 Ga0530510_0038156 3300061734 Bacteria 3468
356 Ga0495658_0049475
357 JGI25407J50210_10000691
358 Ga0070683_100004231
359 Ga0070690_100026926
360 Ga0068869_100343108
361 Ga0070680_100072653
362 Ga0070682_100281322
363 Ga0068868_100108627
364 Ga0070660_100117859
365 Ga0070689_100316755
366 Ga0070671_100197489
367 Ga0070673_100070360
368 Ga0070673_100419932
369 Ga0070659_100225795
370 Ga0070667_100115510
371 Ga0070713_100089122
372 Ga0070711_100241528
373 Ga0070700_100004744
374 Ga0070700_100035685
375 Ga0070663_100153273
376 Ga0070663_100166265
377 Ga0068867_100107584
378 Ga0068867_100352960
379 Ga0070706_100022157
380 Ga0070698_100034825
381 Ga0070699_100010554
382 Ga0070684_100007284
383 Ga0070684_100238395
384 Ga0070697_100397987
385 Ga0070695_100060705
386 Ga0070696_100006125
387 Ga0070696_100065635
388 Ga0070693_100024042
389 Ga0070693_100208852
390 Ga0070665_100003756
391 Ga0068857_100007322
392 Ga0068854_100133570
393 Ga0068856_100044488
394 Ga0070702_100085320
395 Ga0068852_100018482
396 Ga0068852_100623073
397 Ga0068859_100127245
398 Ga0068861_100032964
399 Ga0068851_10158130
400 Ga0068863_100389387
401 Ga0068860_100272620
402 Ga0068862_100492601
403 Ga0068862_100613956
404 Ga0081455_10005632
405 Ga0081455_10067722
406 Ga0081538_10000223
407 Ga0081539_10002827
408 Ga0081539_10033824
409 Ga0070717_10456054
410 Ga0075365_10037213
411 Ga0075365_10040543
412 Ga0070715_10006044
413 Ga0075367_10231950
414 Ga0097621_100028031
415 Ga0075428_100043063
416 Ga0075428_100178715
417 Ga0075428_100484904
418 Ga0075431_100019117
419 Ga0068865_100145267
420 Ga0068865_100202394
421 Ga0097620_100127248
422 Ga0075435_100003948
423 Ga0075435_100244512
424 Ga0111539_10003693
425 Ga0111539_10044505
426 Ga0111539_10131036
427 Ga0105245_10030644
428 Ga0105245_10082181
429 Ga0105245_10130059
430 Ga0105247_10014358
431 Ga0114129_10040696
432 Ga0114129_10346516
433 Ga0105243_10258259
434 Ga0105241_10012195
435 Ga0105242_10046853
436 Ga0105249_10230579
437 Ga0105249_10382363
438 Ga0105249_10507331
439 Ga0105249_10529488
440 Ga0105239_10088246
441 Ga0105239_10129299
442 Ga0105239_10161510
443 Ga0105239_10521638
444 Ga0105246_10070138
445 Ga0157373_10258768
446 Ga0157369_10319360
447 Ga0157374_10145428
448 Ga0157374_10282679
449 Ga0163162_10176157
450 Ga0157372_10638855
451 Ga0163163_10028176
452 Ga0157377_10067955
453 Ga0163161_10232508
454 Ga0207426_1021776
455 Ga0207710_10023865
456 Ga0207688_10015730
457 Ga0207688_10279250
458 Ga0207699_10052917
459 Ga0207643_10121157
460 Ga0207654_10132509
461 Ga0207693_10057531
462 Ga0207663_10012059
463 Ga0207660_10191264
464 Ga0207657_10126172
465 Ga0207649_10283776
466 Ga0207650_10087043
467 Ga0207687_10043522
468 Ga0207687_10046098
469 Ga0207687_10090124
470 Ga0207687_10192206
471 Ga0207644_10152771
472 Ga0207690_10122682
473 Ga0207706_10215985
474 Ga0207686_10079909
475 Ga0207709_10221838
476 Ga0207709_10280385
477 Ga0207670_10238339
478 Ga0207665_10002419
479 Ga0207689_10123358
480 Ga0207689_10302621
481 Ga0207661_10006866
482 Ga0207712_10009214
483 Ga0207712_10030638
484 Ga0207712_10329543
485 Ga0207668_10050179
486 Ga0207668_10215356
487 Ga0207640_10398087
488 Ga0207703_10616580
489 Ga0207639_10079772
490 Ga0207678_10044741
491 Ga0207678_10137108
492 Ga0207708_10006507
493 Ga0207708_10061048
494 Ga0207708_10062083
495 Ga0207702_10013218
496 Ga0207702_10055969
497 Ga0207702_10398595
498 Ga0207648_10189272
499 Ga0207648_10529837
500 Ga0207676_10099840
501 Ga0207676_10411593
502 Ga0207674_10001018
503 Ga0207674_10280997
504 Ga0207675_100115577
505 Ga0207675_100160875
506 Ga0207683_10001522
507 Ga0207683_10632878
508 Ga0207698_10061221
509 Ga0207428_10045884
510 Ga0207428_10386510
511 Ga0268266_10015613
512 Ga0307408_100356960
513 Ga0307405_10001746
514 Ga0307405_10059432
515 Ga0307413_10045806
516 Ga0307413_10223853
517 Ga0307410_10036392
518 Ga0307410_10205537
519 Ga0307410_10328217
520 Ga0307406_10010463
521 Ga0307406_10028208
522 Ga0307407_10160375
523 Ga0307412_10032463
524 Ga0307409_100002794
525 Ga0307409_100079840
526 Ga0307409_100153779
527 Ga0307416_100101633
528 Ga0307416_100132185
529 Ga0307416_100288287
530 Ga0307411_10047986
531 Ga0307411_10250117
532 Ga0307415_100019447
533 Ga0307415_100051323
534 Ga0307415_100139367
535 Ga0307415_100443348
536 Ga0373945_0017908
537 Ga0373943_0003407
538 Ga0373961_0007734
539 Ga0373962_0008022
540 Ga0373931_0263862
541 Ga0373935_0086802
542 Ga0373947_0004356
543 Ga0373925_0008298
544 Ga0395899_0001601
545 Ga0395899_0004793
546 Ga0395899_0021149
547 Ga0395899_0074079
548 Ga0395900_0004880
549 Ga0395900_0012547
550 Ga0395900_0023403
551 Ga0395900_0129245
552 Ga0395900_0337477
553 Ga0395898_0001382
554 Ga0395898_0036961
555 Ga0395898_0183112
556 Ga0395898_0246653
557 Ga0395905_0012816
558 Ga0395905_0121983
559 Ga0395901_0002672
560 Ga0395901_0005244
561 Ga0395901_0038014
562 Ga0395901_0202329
563 Ga0395901_0353204
564 Ga0466964_0104902
565 Ga0466960_0133923
566 Ga0466960_0219349
567 Ga0466960_0239525
568 Ga0466967_0032310
569 Ga0466967_0033323
570 Ga0466967_0051614
571 Ga0466967_0123855
572 Ga0466967_0313364
573 Ga0466967_0693427
574 Ga0495592_0302475
575 Ga0495603_0000523
576 Ga0495641_0001734
577 Ga0495641_0081865
578 Ga0495641_0085019
579 Ga0495580_0167392
580 Ga0495582_0076900
581 Ga0495582_0084354
582 Ga0495594_0002831
583 Ga0495608_0182793
584 Ga0495620_0060737
585 Ga0495663_0028861
586 Ga0495663_0068086
587 Ga0495642_0057962
588 Ga0495665_0102101
589 Ga0495587_0178467
590 Ga0495667_0066273
591 Ga0495656_0290779
592 Ga0495635_0071825
593 Ga0495588_0001015
594 Ga0495658_0119870
595 Ga0495624_0042916
596 Ga0495671_0104433
597 Ga0495581_0084074
598 Ga0495636_0169158
599 Ga0495676_0005187
600 Ga0495676_0264968
601 Ga0495680_0068892
602 Ga0495680_0194953
603 Ga0495593_0150554
604 Ga0496100_0031012
605 Ga0496100_0052742
606 Ga0496100_0162162
607 Ga0496100_0526304
608 Ga0496101_0004254
609 Ga0496101_0056872
610 Ga0496101_0110328
611 Ga0496102_0026201
612 Ga0496102_0428840
613 Ga0496103_0008508
614 Ga0496104_0021030
615 Ga0496104_0028807
616 Ga0496104_0035266
617 Ga0496105_0019379
618 Ga0496106_0059651
619 Ga0496106_0131346
620 Ga0496106_0385250
621 Ga0496106_0420142
622 Ga0496107_0132238
623 Ga0496107_0172283
624 Ga0496107_0203917
625 Ga0496108_0020521
626 Ga0496108_0024662
627 Ga0496108_0038365
628 Ga0496108_0159745
629 Ga0496109_0019875
630 Ga0496109_0034566
631 Ga0496109_0508492
632 Ga0496109_0514882
633 Ga0496110_0029784
634 Ga0496110_0044148
635 Ga0496110_0089957
636 Ga0496110_0385149
637 Ga0496110_0599483
638 Ga0496111_0005493
639 Ga0496111_0034159
640 Ga0496111_0219068
641 Ga0496112_0004124
642 Ga0496112_0010678
643 Ga0496112_0031074
644 Ga0496112_0254019
645 Ga0496113_0004698
646 Ga0496113_0031676
647 Ga0496113_0063737
648 Ga0496114_0025518
649 Ga0496114_0026277
650 Ga0496114_0169626
651 Ga0496115_0026810
652 Ga0501031_0014533
653 Ga0501032_0155890
654 Ga0501033_0084579
655 Ga0501036_0082523
656 Ga0501036_0223347
657 Ga0501036_0353373
658 Ga0501037_0146187
659 Ga0501038_0272164
660 Ga0501039_0023496
661 Ga0501039_0036169
662 Ga0501039_0265366
663 Ga0501040_0017593
664 Ga0501041_0026654
665 Ga0501041_0140635
666 Ga0501042_0114933
667 Ga0501048_0020216
668 Ga0501067_0030771
669 Ga0501068_0020614
670 Ga0501068_0199738
671 Ga0501069_0021720
672 Ga0501071_0043157
673 Ga0501071_0044005
674 Ga0501071_0126266
675 Ga0501071_0126601
676 Ga0501072_0038849
677 Ga0501074_0399728
678 Ga0501074_0447044
679 Ga0501075_0031507
680 Ga0501076_0142305
681 Ga0501076_0325601
682 Ga0501217_034392
683 Ga0501079_0018722
684 Ga0501079_0047269
685 Ga0501079_0060217
686 Ga0501080_0637775
687 Ga0501081_0011284
688 Ga0501081_0166033
689 Ga0501035_0114250
690 Ga0501045_0007395
691 Ga0501045_0016040
692 nmdc:mga05p37_31507_c1
693 nmdc:mga05p37_551447_c1
694 nmdc:mga05p37_592076_c1
695 nmdc:mga08y16_1127716_c1
696 nmdc:mga08y16_130418_c1
697 nmdc:mga08y16_45419_c1
698 nmdc:mga0rr50_29214_c1
699 nmdc:mga0rr50_45677_c1
700 nmdc:mga0a205_672007_c1
701 Ga0495655_0018833
702 Ga0495595_0204248
703 Ga0495619_0090887
704 Ga0500641_0121574
705 Ga0500616_0034588
706 Ga0501084_0040781
707 Ga0501084_0227703
708 Ga0501084_0303994
709 Ga0501082_0073909
710 Ga0530510_0038156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

29

241

0.94

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

72

268

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.719 8 250
6ffc-assembly1.cif.gz_A structure of an inhibitor-bound abc transporter 0.7135 9 250
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.6982 8 251
8wam-assembly1.cif.gz_B cryo-em structure of the abcg25 e232q mutant bound to atp and magnesium 0.6914 8 251
8i3a-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in outward conformation 0.6887 8 252
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8294 55 249 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.755 55 243 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6977 34 248 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6483 55 249 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5989 34 248 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7W0JLX3-F1-model_v4 ABC transporter permease 0.9751 48 255 GO:0043190
GO:0140359
AF-A0A7V9FL22-F1-model_v4 Transport permease protein 0.9623 81 255 GO:0043190
GO:0140359
AF-A0A7W0JLX3-F1-model_v4 ABC transporter permease 0.9614 48 255 GO:0043190
GO:0140359
AF-A0A2M7C2L9-F1-model_v4 Transport permease protein 0.9468 53 255 GO:0043190
GO:0140359
AF-A0A7V9FL22-F1-model_v4 Transport permease protein 0.9464 81 255 GO:0043190
GO:0140359

Map