F420233

General Info

Members Datasets Scaffolds Average Seq Length
355 212 355 317

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0347128|Ga0453684_0347128_517_1533
Length 338
Sequence MVWSVCLPGDKINSLERGTMRILITGAAGFLGSHLCDRLLKEGHEVIGMDNFITGNPENLAHLAGHQKFTFIRHDVANFIFVPGKVDAVMHFASPASPNPNSPYGYTNLPIQTMKAGALGTHNTLGVARAHKARFLLASTSEIYGDPVEHPQKETYWGHCDPIGVRSVYDEAKRFAEALTMAYHGAHGIDTRIIRIFNTYGPRMRLDDGRVVPNFIQQALRKEPLTIYGDGMQTRSFCFVDDLVEGIYRLLLSDEHYPVNVGNPSETTIKQFAETINRITNNPAGIQIKMDQRLGDDPQMRQPDITRARSILKWEPKTNLEDGINKTIPYFKEKLGFS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
106 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
128 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
129 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 96.34
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100001586 3300005329 Bacteria 17595
2 Ga0070683_100011459 3300005329 Bacteria 7667
3 Ga0070683_100063482 3300005329 Bacteria 3435
4 Ga0070690_100164214 3300005330 Bacteria 1524
5 Ga0068869_100016418 3300005334 Bacteria 4991
6 Ga0070680_100023013 3300005336 Bacteria 4965
7 Ga0070682_100185381 3300005337 Bacteria 1457
8 Ga0068868_100177054 3300005338 Bacteria 1768
9 Ga0070661_100001425 3300005344 Bacteria 16625
10 Ga0070673_100044504 3300005364 Bacteria 3438
11 Ga0070709_10011777 3300005434 Bacteria 4883
12 Ga0070714_100007547 3300005435 Bacteria 8465
13 Ga0070713_100104683 3300005436 Bacteria 2457
14 Ga0070711_100052817 3300005439 Bacteria 2798
15 Ga0070708_100062164 3300005445 Bacteria 3338
16 Ga0070681_10003971 3300005458 Bacteria 13950
17 Ga0070681_10014759 3300005458 Bacteria 7767
18 Ga0070681_10189998 3300005458 Bacteria 1973
19 Ga0070706_100065334 3300005467 Bacteria 3364
20 Ga0070706_100154035 3300005467 Bacteria 2146
21 Ga0070707_100015237 3300005468 Bacteria 7216
22 Ga0070698_100002152 3300005471 Bacteria 21855
23 Ga0070698_100343617 3300005471 Bacteria 1424
24 Ga0070698_100579595 3300005471 Bacteria 1062
25 Ga0070679_100006650 3300005530 Bacteria 10779
26 Ga0070684_100034109 3300005535 Bacteria 4349
27 Ga0070684_100182192 3300005535 Bacteria 1910
28 Ga0070672_100011075 3300005543 Bacteria 6279
29 Ga0070695_100086814 3300005545 Bacteria 2080
30 Ga0070696_100014899 3300005546 Bacteria 5220
31 Ga0070693_100024250 3300005547 Bacteria 3251
32 Ga0068855_100016019 3300005563 Bacteria 9018
33 Ga0068854_100057295 3300005578 Bacteria 2810
34 Ga0070702_100107178 3300005615 Bacteria 1725
35 Ga0068852_100029715 3300005616 Bacteria 4492
36 Ga0068859_100000008 3300005617 Bacteria 383750
37 Ga0068859_100726906 3300005617 Bacteria 1082
38 Ga0068864_100052061 3300005618 Bacteria 3528
39 Ga0068863_100001127 3300005841 Bacteria 26704
40 Ga0068858_100272607 3300005842 Bacteria 1610
41 Ga0068862_100017637 3300005844 Bacteria 5944
42 Ga0081455_10094904 3300005937 Bacteria 2408
43 Ga0070717_10005658 3300006028 Bacteria 9130
44 Ga0075428_100010479 3300006844 Bacteria 10299
45 Ga0075428_100400247 3300006844 Bacteria 1472
46 Ga0075430_100088796 3300006846 Bacteria 2586
47 Ga0075431_100004650 3300006847 Bacteria 13484
48 Ga0075431_100007072 3300006847 Bacteria 11148
49 Ga0075431_100025166 3300006847 Bacteria 6100
50 Ga0075431_100037698 3300006847 Bacteria 4978
51 Ga0075433_10002977 3300006852 Bacteria 13011
52 Ga0075433_10470312 3300006852 Bacteria 1107
53 Ga0075434_100031405 3300006871 Bacteria 5236
54 Ga0075434_100035243 3300006871 Bacteria 4946
55 Ga0075434_100299411 3300006871 Bacteria 1629
56 Ga0075434_100422887 3300006871 Bacteria 1353
57 Ga0075429_100001050 3300006880 Bacteria 22051
58 Ga0075436_100000150 3300006914 Bacteria 43045
59 Ga0075436_100024239 3300006914 Bacteria 4170
60 Ga0075436_100025316 3300006914 Bacteria 4083
61 Ga0097620_100000008 3300006931 Bacteria 383750
62 Ga0097620_100726906 3300006931 Bacteria 1082
63 Ga0075435_100042813 3300007076 Bacteria 3623
64 Ga0075435_100083647 3300007076 Bacteria 2624
65 Ga0075435_100331131 3300007076 Bacteria 1304
66 Ga0105240_10006496 3300009093 Bacteria 17175
67 Ga0111539_10113760 3300009094 Bacteria 3174
68 Ga0105245_10259695 3300009098 Bacteria 1690
69 Ga0114129_10000620 3300009147 Bacteria 44046
70 Ga0114129_10018933 3300009147 Bacteria 9809
71 Ga0114129_10037291 3300009147 Bacteria 6864
72 Ga0114129_10042090 3300009147 Bacteria 6432
73 Ga0114129_10048317 3300009147 Bacteria 5978
74 Ga0114129_10064524 3300009147 Bacteria 5111
75 Ga0114129_10074946 3300009147 Bacteria 4712
76 Ga0114129_10081837 3300009147 Bacteria 4488
77 Ga0105241_10100953 3300009174 Bacteria 2293
78 Ga0105248_10081353 3300009177 Bacteria 3641
79 Ga0105248_10099554 3300009177 Bacteria 3276
80 Ga0105249_10365055 3300009553 Unclassified 1466
81 Ga0157373_10016457 3300013100 Bacteria 5393
82 Ga0157370_10141497 3300013104 Bacteria 2242
83 Ga0157370_10148827 3300013104 Bacteria 2179
84 Ga0157378_10092815 3300013297 Bacteria 2747
85 Ga0157378_10209842 3300013297 Bacteria 1846
86 Ga0157378_10333902 3300013297 Bacteria 1476
87 Ga0163162_10835459 3300013306 Bacteria 1037
88 Ga0157372_10011054 3300013307 Bacteria 9605
89 Ga0157372_10021691 3300013307 Bacteria 6942
90 Ga0163163_10265613 3300014325 Bacteria 1767
91 Ga0157380_10000021 3300014326 Bacteria 114368
92 Ga0213874_10000429 3300021377 Bacteria 8412
93 Ga0213876_10004346 3300021384 Bacteria 7940
94 Ga0207699_10006700 3300025906 Bacteria 5590
95 Ga0207684_10116941 3300025910 Bacteria 2285
96 Ga0207654_10036211 3300025911 Bacteria 2755
97 Ga0207707_10000519 3300025912 Bacteria 39417
98 Ga0207707_10006897 3300025912 Bacteria 9908
99 Ga0207707_10094275 3300025912 Bacteria 2615
100 Ga0207695_10001473 3300025913 Bacteria 39382
101 Ga0207695_10073138 3300025913 Bacteria 3494
102 Ga0207663_10122753 3300025916 Bacteria 1781
103 Ga0207660_10000107 3300025917 Bacteria 46998
104 Ga0207660_10019837 3300025917 Bacteria 4502
105 Ga0207657_10322210 3300025919 Bacteria 1222
106 Ga0207652_10000440 3300025921 Bacteria 43016
107 Ga0207652_10257625 3300025921 Bacteria 1574
108 Ga0207681_10011409 3300025923 Bacteria 5461
109 Ga0207694_10000045 3300025924 Bacteria 165875
110 Ga0207650_10080005 3300025925 Bacteria 2477
111 Ga0207659_10031368 3300025926 Bacteria 3638
112 Ga0207700_10000503 3300025928 Bacteria 22914
113 Ga0207664_10005274 3300025929 Bacteria 8831
114 Ga0207691_10033474 3300025940 Bacteria 4784
115 Ga0207711_10057973 3300025941 Bacteria 3330
116 Ga0207711_10374662 3300025941 Bacteria 1320
117 Ga0207661_10019331 3300025944 Bacteria 5076
118 Ga0207661_10070934 3300025944 Bacteria 2845
119 Ga0207661_10400165 3300025944 Bacteria 1245
120 Ga0207667_10045992 3300025949 Bacteria 4621
121 Ga0207640_10013361 3300025981 Bacteria 4702
122 Ga0207658_10040265 3300025986 Bacteria 3377
123 Ga0207703_10094560 3300026035 Bacteria 2520
124 Ga0207641_10000732 3300026088 Bacteria 35244
125 Ga0207676_10041057 3300026095 Bacteria 3549
126 Ga0207698_10051228 3300026142 Bacteria 3155
127 Ga0268265_10025367 3300028380 Bacteria 4206
128 Ga0268264_10207827 3300028381 Bacteria 1795
129 Ga0268264_10475203 3300028381 Bacteria 1215
130 Ga0265318_10037203 3300028577 Bacteria 1865
131 Ga0265338_10077007 3300028800 Bacteria 2821
132 Ga0265320_10018432 3300031240 Bacteria 3843
133 Ga0265340_10003674 3300031247 Bacteria 8638
134 Ga0265331_10010932 3300031250 Bacteria 4991
135 Ga0307408_100134107 3300031548 Bacteria 1935
136 Ga0316575_10028102 3300031665 Unclassified 2191
137 Ga0316575_10059509 3300031665 Bacteria 1525
138 Ga0316579_10008297 3300031691 Bacteria 4328
139 Ga0316579_10026215 3300031691 Unclassified 2637
140 Ga0316579_10113781 3300031691 Bacteria 1299
141 Ga0316576_10004835 3300031727 Bacteria 8139
142 Ga0316576_10014917 3300031727 Bacteria 5199
143 Ga0316576_10019896 3300031727 Bacteria 4606
144 Ga0316576_10022787 3300031727 Bacteria 4354
145 Ga0316576_10060891 3300031727 Bacteria 2766
146 Ga0316578_10001614 3300031728 Bacteria 9325
147 Ga0316578_10003056 3300031728 Bacteria 7550
148 Ga0316578_10023727 3300031728 Bacteria 3435
149 Ga0316578_10032857 3300031728 Bacteria 2967
150 Ga0316578_10172306 3300031728 Bacteria 1304
151 Ga0307405_10045870 3300031731 Bacteria 2681
152 Ga0307405_10200203 3300031731 Bacteria 1450
153 Ga0316577_10008149 3300031733 Bacteria 5605
154 Ga0316577_10019734 3300031733 Unclassified 3733
155 Ga0316577_10020968 3300031733 Bacteria 3622
156 Ga0316577_10023497 3300031733 Bacteria 3423
157 Ga0316577_10087440 3300031733 Unclassified 1744
158 Ga0307406_10202149 3300031901 Bacteria 1463
159 Ga0307412_10037484 3300031911 Bacteria 3115
160 Ga0307416_100075741 3300032002 Bacteria 2817
161 Ga0307416_100386635 3300032002 Bacteria 1431
162 Ga0307411_10374130 3300032005 Bacteria 1169
163 Ga0316583_10062126 3300032133 Bacteria 1308
164 Ga0316585_10001677 3300032137 Bacteria 5875
165 Ga0316580_10009271 3300032139 Bacteria 2956
166 Ga0316212_1003317 3300033547 Bacteria 2320
167 Ga0373959_0000304 3300034820 Bacteria 10240
168 Ga0373934_0000516 3300035086 Bacteria 13574
169 Ga0373932_0081889 3300035112 Bacteria 1021
170 Ga0373939_0020565 3300035114 Bacteria 1795
171 Ga0373945_0021837 3300035116 Unclassified 2202
172 Ga0373953_0096151 3300035117 Bacteria 1243
173 Ga0373954_0040992 3300035118 Bacteria 2158
174 Ga0373956_0000814 3300035119 Bacteria 12998
175 Ga0373956_0163419 3300035119 Bacteria 1050
176 Ga0373943_0046454 3300035170 Bacteria 2119
177 Ga0316574_0000509 3300035398 Bacteria 15797
178 Ga0316574_0001015 3300035398 Bacteria 12665
179 Ga0316574_0002455 3300035398 Bacteria 9316
180 Ga0316574_0050818 3300035398 Bacteria 2582
181 Ga0316574_0090061 3300035398 Bacteria 1955
182 Ga0316574_0107061 3300035398 Bacteria 1791
183 Ga0373924_0003336 3300035410 Bacteria 5512
184 Ga0373935_0007270 3300035692 Bacteria 6617
185 Ga0373935_0012915 3300035692 Bacteria 5033
186 Ga0373927_0014150 3300035695 Bacteria 5290
187 Ga0373933_0000210 3300035724 Bacteria 38699
188 Ga0373947_0000297 3300035725 Bacteria 27913
189 Ga0373937_0000142 3300036401 Bacteria 69511
190 Ga0373937_0302100 3300036401 Bacteria 1513
191 Ga0316582_0003858 3300036647 Bacteria 7457
192 Ga0316582_0003972 3300036647 Bacteria 7388
193 Ga0316582_0004399 3300036647 Bacteria 7113
194 Ga0316582_0011641 3300036647 Bacteria 4872
195 Ga0316582_0016308 3300036647 Bacteria 4271
196 Ga0316582_0037636 3300036647 Bacteria 3001
197 Ga0316582_0039225 3300036647 Bacteria 2948
198 Ga0316582_0118978 3300036647 Bacteria 1766
199 Ga0316582_0309568 3300036647 Bacteria 1086
200 Ga0316584_0004717 3300036712 Bacteria 9039
201 Ga0316584_0019202 3300036712 Bacteria 4938
202 Ga0316584_0023671 3300036712 Bacteria 4488
203 Ga0316584_0050310 3300036712 Bacteria 3115
204 Ga0373925_0026916 3300037068 Bacteria 4210
205 Ga0395905_0347592 3300037471 Bacteria 1375
206 Ga0316581_0036549 3300037588 Bacteria 1491
207 Ga0400483_123400 3300039062 Bacteria 1929
208 Ga0400489_37175 3300039093 Bacteria 3964
209 Ga0436365_1685504 3300039437 Bacteria 28560
210 Ga0436363_1146019 3300039450 Bacteria 6374
211 Ga0436362_0402136 3300039453 Bacteria 19589
212 Ga0439453_0014747 3300041408 Bacteria 1344
213 Ga0451577_0014744 3300042876 Bacteria 7282
214 Ga0451577_0079676 3300042876 Bacteria 2920
215 Ga0451577_0125977 3300042876 Bacteria 2295
216 Ga0451577_0132655 3300042876 Bacteria 2235
217 Ga0451577_0729535 3300042876 Bacteria 897
218 Ga0466972_0062308 3300044658 Bacteria 1787
219 Ga0453683_0051384 3300044673 Bacteria 2582
220 Ga0466965_0204426 3300044683 Bacteria 1049
221 Ga0453684_0000007 3300044712 Bacteria 1301482
222 Ga0453684_0000021 3300044712 Bacteria 873490
223 Ga0453684_0000640 3300044712 Bacteria 126342
224 Ga0453684_0002619 3300044712 Bacteria 43004
225 Ga0453684_0003171 3300044712 Bacteria 37779
226 Ga0453684_0003566 3300044712 Bacteria 34788
227 Ga0453684_0004713 3300044712 Bacteria 28211
228 Ga0453684_0005494 3300044712 Bacteria 25049
229 Ga0453684_0007683 3300044712 Bacteria 19721
230 Ga0453684_0011794 3300044712 Bacteria 14562
231 Ga0453684_0023227 3300044712 Bacteria 9148
232 Ga0453684_0026886 3300044712 Bacteria 8289
233 Ga0453684_0053541 3300044712 Bacteria 5267
234 Ga0453684_0077956 3300044712 Bacteria 4149
235 Ga0453684_0111981 3300044712 Bacteria 3314
236 Ga0453684_0150194 3300044712 Bacteria 2770
237 Ga0453684_0171942 3300044712 Bacteria 2552
238 Ga0453684_0178425 3300044712 Bacteria 2496
239 Ga0453684_0195663 3300044712 Bacteria 2361
240 Ga0453684_0305881 3300044712 Unclassified 1806
241 Ga0453684_0347128 3300044712 Bacteria 1674
242 Ga0453684_0824595 3300044712 Bacteria 999
243 Ga0466968_0000734 3300044735 Bacteria 11333
244 Ga0466960_0024866 3300044901 Bacteria 2705
245 Ga0466959_0150585 3300045049 Bacteria 1640
246 Ga0451576_0001278 3300045051 Bacteria 43871
247 Ga0495592_0012659 3300046454 Bacteria 6411
248 Ga0495592_0034215 3300046454 Bacteria 3831
249 Ga0495603_0012483 3300046455 Bacteria 5143
250 Ga0495603_0043960 3300046455 Bacteria 2666
251 Ga0495629_0047877 3300046459 Bacteria 2998
252 Ga0495651_0053659 3300046462 Bacteria 3102
253 Ga0495653_0004105 3300046463 Bacteria 11776
254 Ga0495580_0000268 3300046472 Bacteria 41849
255 Ga0495582_0017189 3300046473 Bacteria 3959
256 Ga0495639_0007416 3300046475 Bacteria 4708
257 Ga0495608_0004142 3300046511 Bacteria 10393
258 Ga0495608_0068960 3300046511 Bacteria 2311
259 Ga0495628_0004757 3300046516 Bacteria 11961
260 Ga0495630_0001501 3300046517 Bacteria 16139
261 Ga0495630_0001593 3300046517 Bacteria 15773
262 Ga0495652_0130331 3300046529 Bacteria 1992
263 Ga0495665_0019190 3300046531 Bacteria 3675
264 Ga0495587_0001266 3300046536 Bacteria 16797
265 Ga0495645_0000095 3300046543 Bacteria 61733
266 Ga0495645_0041867 3300046543 Bacteria 3339
267 Ga0495645_0127057 3300046543 Bacteria 1791
268 Ga0495667_0013888 3300046559 Bacteria 5438
269 Ga0495634_0040032 3300046642 Bacteria 3190
270 Ga0495635_0000378 3300046663 Bacteria 28211
271 Ga0495588_0066533 3300046674 Bacteria 1870
272 Ga0495657_0000682 3300046675 Bacteria 30444
273 Ga0495657_0116022 3300046675 Bacteria 1691
274 Ga0495599_0000764 3300046678 Bacteria 18103
275 Ga0495599_0159256 3300046678 Bacteria 1396
276 Ga0495623_0010785 3300046679 Bacteria 5916
277 Ga0495658_0090021 3300046683 Bacteria 1815
278 Ga0495669_0114654 3300046684 Bacteria 1260
279 Ga0495613_0000291 3300046689 Bacteria 46041
280 Ga0495600_0000067 3300046809 Bacteria 59521
281 Ga0495581_0001089 3300047315 Bacteria 14780
282 Ga0495581_0093931 3300047315 Bacteria 1741
283 Ga0495604_0000192 3300047317 Bacteria 54981
284 Ga0495604_0092650 3300047317 Bacteria 2238
285 Ga0495674_0015100 3300047319 Bacteria 7225
286 Ga0495674_0028309 3300047319 Bacteria 5112
287 Ga0495674_0210958 3300047319 Bacteria 1608
288 Ga0495680_0029822 3300047322 Bacteria 4463
289 Ga0495675_0002539 3300047444 Bacteria 10925
290 Ga0495673_0136943 3300047469 Bacteria 957
291 Ga0495684_0000138 3300047471 Bacteria 53459
292 Ga0495684_0000396 3300047471 Bacteria 35592
293 Ga0495602_0034248 3300048088 Bacteria 4754
294 Ga0495614_0042133 3300048089 Bacteria 1957
295 Ga0496108_0000889 3300048911 Bacteria 23268
296 Ga0496108_0200184 3300048911 Bacteria 1733
297 Ga0496110_0073607 3300048913 Bacteria 3032
298 Ga0496110_0092175 3300048913 Bacteria 2711
299 Ga0496112_0001487 3300048915 Bacteria 18039
300 Ga0496113_0084418 3300048916 Bacteria 2438
301 Ga0501034_0194097 3300049571 Bacteria 1991
302 Ga0501036_0127622 3300049572 Bacteria 2148
303 Ga0501037_0103977 3300049573 Bacteria 2048
304 Ga0501041_0107294 3300049577 Bacteria 1731
305 Ga0501042_0318169 3300049578 Bacteria 1124
306 Ga0501068_0250889 3300049584 Bacteria 1128
307 Ga0501071_0222020 3300049587 Bacteria 1422
308 Ga0501072_0014221 3300049588 Bacteria 6097
309 Ga0501072_0302780 3300049588 Bacteria 1271
310 Ga0501074_0103409 3300049590 Bacteria 2039
311 Ga0501075_0105477 3300049591 Bacteria 2142
312 Ga0501075_0259865 3300049591 Bacteria 1323
313 Ga0501076_0010296 3300049592 Bacteria 6931
314 Ga0501077_0044397 3300049593 Bacteria 2823
315 Ga0501077_0046033 3300049593 Bacteria 2772
316 Ga0501079_0222564 3300049741 Bacteria 1474
317 Ga0501081_0011841 3300049743 Bacteria 5713
318 Ga0501083_0179874 3300049744 Bacteria 1381
319 Ga0501044_0059008 3300049823 Bacteria 3933
320 Ga0501045_0068410 3300049824 Bacteria 2609
321 nmdc:mga05p37_100983_c1 3300050507 Bacteria 3553
322 nmdc:mga05p37_198_c1 3300050507 Bacteria 59977
323 nmdc:mga05p37_28599_c1 3300050507 Bacteria 6798
324 nmdc:mga05p37_384841_c1 3300050507 Bacteria 1642
325 nmdc:mga05p37_385714_c1 3300050507 Bacteria 1640
326 nmdc:mga05p37_46824_c1 3300050507 Bacteria 5317
327 nmdc:mga05p37_525421_c1 3300050507 Bacteria 1353
328 nmdc:mga09592_169395_c1 3300050508 Bacteria 1888
329 nmdc:mga09592_323598_c1 3300050508 Bacteria 1336
330 nmdc:mga09592_434713_c1 3300050508 Bacteria 1133
331 nmdc:mga0qj67_7323_c1 3300050509 Bacteria 8158
332 nmdc:mga06r32_133832_c1 3300050510 Bacteria 2453
333 nmdc:mga06r32_1740_c1 3300050510 Bacteria 19577
334 nmdc:mga06r32_227208_c1 3300050510 Bacteria 1855
335 nmdc:mga06r32_2555_c1 3300050510 Bacteria 16286
336 nmdc:mga06r32_52655_c1 3300050510 Bacteria 3898
337 nmdc:mga08y16_550560_c1 3300050511 Bacteria 1168
338 nmdc:mga0n895_1342_c1 3300050512 Bacteria 18240
339 nmdc:mga0n895_14778_c1 3300050512 Bacteria 7103
340 nmdc:mga0n895_91369_c1 3300050512 Bacteria 3047
341 nmdc:mga0rr50_477_c1 3300050513 Bacteria 21201
342 nmdc:mga0rr50_96255_c1 3300050513 Bacteria 2316
343 nmdc:mga08x19_274_c1 3300050514 Bacteria 38873
344 nmdc:mga0a205_117_c1 3300050515 Bacteria 47476
345 nmdc:mga0a205_806_c1 3300050515 Bacteria 21572
346 Ga0495601_0008554 3300053077 Bacteria 6045
347 Ga0495601_0031046 3300053077 Bacteria 3320
348 Ga0495612_0043153 3300053078 Bacteria 1842
349 Ga0495612_0055580 3300053078 Bacteria 1632
350 Ga0495619_0010894 3300053085 Bacteria 5722
351 Ga0495619_0054341 3300053085 Bacteria 2650
352 Ga0501084_0010496 3300054114 Bacteria 7657
353 Ga0501084_0034428 3300054114 Bacteria 4236
354 Ga0501084_0059319 3300054114 Bacteria 3203
355 Ga0501082_0009001 3300060353 Bacteria 8614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10333902 Ga0157378_103339023 282
2 3300014326 Ga0157380_10000021 Ga0157380_1000002176 282
3 3300031733 Ga0316577_10087440 Ga0316577_100874403 282
4 3300035112 Ga0373932_0081889 Ga0373932_0081889_30_878 282
5 3300037588 Ga0316581_0036549 Ga0316581_0036549_264_1133 282
6 3300042876 Ga0451577_0729535 Ga0451577_0729535_15_884 282
7 3300044712 Ga0453684_0824595 Ga0453684_0824595_73_945 282
8 3300046684 Ga0495669_0114654 Ga0495669_0114654_73_921 282
9 3300031665 Ga0316575_10028102 Ga0316575_100281024 283
10 3300036647 Ga0316582_0309568 Ga0316582_0309568_91_945 284
11 3300044712 Ga0453684_0000021 Ga0453684_0000021_497544_498497 284
12 3300047469 Ga0495673_0136943 Ga0495673_0136943_49_933 287
13 3300039450 Ga0436363_1146019 Ga0436363_1146019_738_1637 292
14 3300039453 Ga0436362_0402136 Ga0436362_0402136_10078_10977 292
15 3300044712 Ga0453684_0178425 Ga0453684_0178425_818_1720 293
16 3300053078 Ga0495612_0043153 Ga0495612_0043153_760_1683 306
17 3300046454 Ga0495592_0034215 Ga0495592_0034215_1941_2864 307
18 3300046529 Ga0495652_0130331 Ga0495652_0130331_404_1327 307
19 3300046543 Ga0495645_0041867 Ga0495645_0041867_1551_2474 307
20 3300046675 Ga0495657_0116022 Ga0495657_0116022_243_1166 307
21 3300046678 Ga0495599_0159256 Ga0495599_0159256_204_1127 307
22 3300047317 Ga0495604_0092650 Ga0495604_0092650_747_1670 307
23 3300047319 Ga0495674_0028309 Ga0495674_0028309_2996_3919 307
24 3300047471 Ga0495684_0000138 Ga0495684_0000138_32185_33108 307
25 3300050507 nmdc:mga05p37_385714_c1 nmdc:mga05p37_385714_c1_187_1116 307
26 3300005458 Ga0070681_10014759 Ga0070681_100147593 308
27 3300005547 Ga0070693_100024250 Ga0070693_1000242503 308
28 3300025912 Ga0207707_10006897 Ga0207707_100068979 308
29 3300025921 Ga0207652_10257625 Ga0207652_102576251 308
30 3300005334 Ga0068869_100016418 Ga0068869_1000164184 309
31 3300005338 Ga0068868_100177054 Ga0068868_1001770541 309
32 3300005471 Ga0070698_100002152 Ga0070698_1000021526 309
33 3300005615 Ga0070702_100107178 Ga0070702_1001071782 309
34 3300005617 Ga0068859_100000008 Ga0068859_10000000835 309
35 3300006931 Ga0097620_100000008 Ga0097620_10000000835 309
36 3300009147 Ga0114129_10048317 Ga0114129_100483173 309
37 3300009553 Ga0105249_10365055 Ga0105249_103650552 309
38 3300013306 Ga0163162_10835459 Ga0163162_108354591 309
39 3300025925 Ga0207650_10080005 Ga0207650_100800051 309
40 3300025944 Ga0207661_10400165 Ga0207661_104001651 309
41 3300031727 Ga0316576_10004835 Ga0316576_100048352 309
42 3300031727 Ga0316576_10019896 Ga0316576_100198962 309
43 3300031728 Ga0316578_10001614 Ga0316578_100016146 309
44 3300031728 Ga0316578_10023727 Ga0316578_100237272 309
45 3300031731 Ga0307405_10200203 Ga0307405_102002031 309
46 3300031901 Ga0307406_10202149 Ga0307406_102021491 309
47 3300031911 Ga0307412_10037484 Ga0307412_100374844 309
48 3300032002 Ga0307416_100075741 Ga0307416_1000757412 309
49 3300035119 Ga0373956_0163419 Ga0373956_0163419_25_966 309
50 3300035398 Ga0316574_0050818 Ga0316574_0050818_332_1273 309
51 3300036712 Ga0316584_0019202 Ga0316584_0019202_3794_4735 309
52 3300039062 Ga0400483_123400 Ga0400483_123400_645_1586 309
53 3300039093 Ga0400489_37175 Ga0400489_37175_2816_3769 309
54 3300042876 Ga0451577_0125977 Ga0451577_0125977_156_1106 309
55 3300042876 Ga0451577_0132655 Ga0451577_0132655_857_1792 309
56 3300044712 Ga0453684_0005494 Ga0453684_0005494_7592_8527 309
57 3300044712 Ga0453684_0026886 Ga0453684_0026886_1610_2560 309
58 3300046511 Ga0495608_0068960 Ga0495608_0068960_1323_2264 309
59 3300046642 Ga0495634_0040032 Ga0495634_0040032_1228_2169 309
60 3300046689 Ga0495613_0000291 Ga0495613_0000291_27881_28822 309
61 3300049571 Ga0501034_0194097 Ga0501034_0194097_882_1817 309
62 3300050508 nmdc:mga09592_169395_c1 nmdc:mga09592_169395_c1_878_1810 309
63 3300053077 Ga0495601_0008554 Ga0495601_0008554_3038_3979 309
64 3300053085 Ga0495619_0010894 Ga0495619_0010894_1874_2815 309
65 3300005330 Ga0070690_100164214 Ga0070690_1001642142 310
66 3300006847 Ga0075431_100004650 Ga0075431_1000046508 310
67 3300009147 Ga0114129_10037291 Ga0114129_100372912 310
68 3300025926 Ga0207659_10031368 Ga0207659_100313682 310
69 3300035398 Ga0316574_0001015 Ga0316574_0001015_2080_3024 310
70 3300036401 Ga0373937_0302100 Ga0373937_0302100_89_1042 310
71 3300036647 Ga0316582_0118978 Ga0316582_0118978_701_1645 310
72 3300037471 Ga0395905_0347592 Ga0395905_0347592_398_1330 310
73 3300044712 Ga0453684_0053541 Ga0453684_0053541_4201_5154 310
74 3300044712 Ga0453684_0111981 Ga0453684_0111981_692_1645 310
75 3300048911 Ga0496108_0000889 Ga0496108_0000889_9253_10188 310
76 3300048913 Ga0496110_0092175 Ga0496110_0092175_287_1222 310
77 3300050507 nmdc:mga05p37_28599_c1 nmdc:mga05p37_28599_c1_5109_6062 310
78 3300050510 nmdc:mga06r32_2555_c1 nmdc:mga06r32_2555_c1_5011_5964 310
79 3300050515 nmdc:mga0a205_806_c1 nmdc:mga0a205_806_c1_4604_5539 310
80 3300005467 Ga0070706_100065334 Ga0070706_1000653343 311
81 3300005844 Ga0068862_100017637 Ga0068862_1000176373 311
82 3300006847 Ga0075431_100025166 Ga0075431_1000251665 311
83 3300006847 Ga0075431_100037698 Ga0075431_1000376982 311
84 3300006871 Ga0075434_100031405 Ga0075434_1000314055 311
85 3300006880 Ga0075429_100001050 Ga0075429_1000010506 311
86 3300009094 Ga0111539_10113760 Ga0111539_101137602 311
87 3300009147 Ga0114129_10018933 Ga0114129_100189337 311
88 3300009147 Ga0114129_10064524 Ga0114129_100645243 311
89 3300009147 Ga0114129_10074946 Ga0114129_100749463 311
90 3300009147 Ga0114129_10081837 Ga0114129_100818372 311
91 3300009177 Ga0105248_10081353 Ga0105248_100813533 311
92 3300021384 Ga0213876_10004346 Ga0213876_100043467 311
93 3300025923 Ga0207681_10011409 Ga0207681_100114092 311
94 3300025941 Ga0207711_10057973 Ga0207711_100579732 311
95 3300028380 Ga0268265_10025367 Ga0268265_100253673 311
96 3300031727 Ga0316576_10014917 Ga0316576_100149174 311
97 3300035114 Ga0373939_0020565 Ga0373939_0020565_224_1165 311
98 3300036647 Ga0316582_0003972 Ga0316582_0003972_5269_6225 311
99 3300039437 Ga0436365_1685504 Ga0436365_1685504_13998_14957 311
100 3300044673 Ga0453683_0051384 Ga0453683_0051384_703_1659 311
101 3300044712 Ga0453684_0011794 Ga0453684_0011794_1910_2866 311
102 3300045051 Ga0451576_0001278 Ga0451576_0001278_13405_14361 311
103 3300046455 Ga0495603_0012483 Ga0495603_0012483_3706_4641 311
104 3300049572 Ga0501036_0127622 Ga0501036_0127622_987_1922 311
105 3300049577 Ga0501041_0107294 Ga0501041_0107294_114_1049 311
106 3300049578 Ga0501042_0318169 Ga0501042_0318169_162_1097 311
107 3300049587 Ga0501071_0222020 Ga0501071_0222020_200_1135 311
108 3300049588 Ga0501072_0014221 Ga0501072_0014221_3739_4674 311
109 3300049590 Ga0501074_0103409 Ga0501074_0103409_96_1031 311
110 3300049591 Ga0501075_0259865 Ga0501075_0259865_49_984 311
111 3300049592 Ga0501076_0010296 Ga0501076_0010296_4614_5549 311
112 3300049593 Ga0501077_0044397 Ga0501077_0044397_795_1730 311
113 3300049593 Ga0501077_0046033 Ga0501077_0046033_1087_2022 311
114 3300049741 Ga0501079_0222564 Ga0501079_0222564_203_1138 311
115 3300049743 Ga0501081_0011841 Ga0501081_0011841_1427_2362 311
116 3300049744 Ga0501083_0179874 Ga0501083_0179874_85_1020 311
117 3300050507 nmdc:mga05p37_100983_c1 nmdc:mga05p37_100983_c1_1168_2103 311
118 3300050507 nmdc:mga05p37_46824_c1 nmdc:mga05p37_46824_c1_815_1750 311
119 3300050508 nmdc:mga09592_323598_c1 nmdc:mga09592_323598_c1_307_1251 311
120 3300050508 nmdc:mga09592_434713_c1 nmdc:mga09592_434713_c1_25_960 311
121 3300050509 nmdc:mga0qj67_7323_c1 nmdc:mga0qj67_7323_c1_4203_5147 311
122 3300050510 nmdc:mga06r32_133832_c1 nmdc:mga06r32_133832_c1_1357_2292 311
123 3300050510 nmdc:mga06r32_1740_c1 nmdc:mga06r32_1740_c1_2220_3155 311
124 3300050510 nmdc:mga06r32_227208_c1 nmdc:mga06r32_227208_c1_757_1701 311
125 3300050510 nmdc:mga06r32_52655_c1 nmdc:mga06r32_52655_c1_1518_2453 311
126 3300050511 nmdc:mga08y16_550560_c1 nmdc:mga08y16_550560_c1_57_998 311
127 3300050512 nmdc:mga0n895_91369_c1 nmdc:mga0n895_91369_c1_138_1073 311
128 3300050513 nmdc:mga0rr50_96255_c1 nmdc:mga0rr50_96255_c1_276_1211 311
129 3300054114 Ga0501084_0010496 Ga0501084_0010496_5917_6852 311
130 3300060353 Ga0501082_0009001 Ga0501082_0009001_5070_6005 311
131 3300005364 Ga0070673_100044504 Ga0070673_1000445042 312
132 3300005468 Ga0070707_100015237 Ga0070707_1000152374 312
133 3300005543 Ga0070672_100011075 Ga0070672_1000110754 312
134 3300005841 Ga0068863_100001127 Ga0068863_1000011272 312
135 3300005842 Ga0068858_100272607 Ga0068858_1002726072 312
136 3300005937 Ga0081455_10094904 Ga0081455_100949043 312
137 3300006844 Ga0075428_100010479 Ga0075428_1000104798 312
138 3300006844 Ga0075428_100400247 Ga0075428_1004002472 312
139 3300006852 Ga0075433_10002977 Ga0075433_100029774 312
140 3300006852 Ga0075433_10470312 Ga0075433_104703121 312
141 3300006871 Ga0075434_100035243 Ga0075434_1000352433 312
142 3300006871 Ga0075434_100422887 Ga0075434_1004228872 312
143 3300006914 Ga0075436_100000150 Ga0075436_10000015026 312
144 3300006914 Ga0075436_100024239 Ga0075436_1000242392 312
145 3300007076 Ga0075435_100042813 Ga0075435_1000428134 312
146 3300007076 Ga0075435_100083647 Ga0075435_1000836472 312
147 3300009147 Ga0114129_10000620 Ga0114129_100006202 312
148 3300009177 Ga0105248_10099554 Ga0105248_100995543 312
149 3300013297 Ga0157378_10092815 Ga0157378_100928152 312
150 3300021377 Ga0213874_10000429 Ga0213874_100004295 312
151 3300025940 Ga0207691_10033474 Ga0207691_100334744 312
152 3300025941 Ga0207711_10374662 Ga0207711_103746622 312
153 3300025986 Ga0207658_10040265 Ga0207658_100402652 312
154 3300026035 Ga0207703_10094560 Ga0207703_100945602 312
155 3300026088 Ga0207641_10000732 Ga0207641_1000073211 312
156 3300028381 Ga0268264_10207827 Ga0268264_102078271 312
157 3300028577 Ga0265318_10037203 Ga0265318_100372032 312
158 3300028800 Ga0265338_10077007 Ga0265338_100770074 312
159 3300031240 Ga0265320_10018432 Ga0265320_100184322 312
160 3300031247 Ga0265340_10003674 Ga0265340_100036745 312
161 3300031250 Ga0265331_10010932 Ga0265331_100109323 312
162 3300031665 Ga0316575_10059509 Ga0316575_100595091 312
163 3300031691 Ga0316579_10008297 Ga0316579_100082972 312
164 3300031691 Ga0316579_10026215 Ga0316579_100262152 312
165 3300031727 Ga0316576_10022787 Ga0316576_100227872 312
166 3300031727 Ga0316576_10060891 Ga0316576_100608913 312
167 3300031728 Ga0316578_10003056 Ga0316578_100030565 312
168 3300031728 Ga0316578_10032857 Ga0316578_100328572 312
169 3300031728 Ga0316578_10172306 Ga0316578_101723061 312
170 3300031733 Ga0316577_10008149 Ga0316577_100081493 312
171 3300031733 Ga0316577_10019734 Ga0316577_100197345 312
172 3300031733 Ga0316577_10023497 Ga0316577_100234971 312
173 3300032133 Ga0316583_10062126 Ga0316583_100621261 312
174 3300032137 Ga0316585_10001677 Ga0316585_100016775 312
175 3300032139 Ga0316580_10009271 Ga0316580_100092712 312
176 3300033547 Ga0316212_1003317 Ga0316212_10033172 312
177 3300035398 Ga0316574_0000509 Ga0316574_0000509_11231_12190 312
178 3300035398 Ga0316574_0002455 Ga0316574_0002455_5269_6219 312
179 3300035398 Ga0316574_0090061 Ga0316574_0090061_605_1564 312
180 3300035398 Ga0316574_0107061 Ga0316574_0107061_619_1569 312
181 3300035692 Ga0373935_0012915 Ga0373935_0012915_3580_4533 312
182 3300036647 Ga0316582_0003858 Ga0316582_0003858_2452_3411 312
183 3300036647 Ga0316582_0004399 Ga0316582_0004399_2537_3487 312
184 3300036647 Ga0316582_0016308 Ga0316582_0016308_260_1219 312
185 3300036647 Ga0316582_0039225 Ga0316582_0039225_616_1575 312
186 3300036712 Ga0316584_0004717 Ga0316584_0004717_2765_3724 312
187 3300036712 Ga0316584_0050310 Ga0316584_0050310_179_1138 312
188 3300041408 Ga0439453_0014747 Ga0439453_0014747_300_1247 312
189 3300042876 Ga0451577_0014744 Ga0451577_0014744_3809_4768 312
190 3300042876 Ga0451577_0079676 Ga0451577_0079676_1623_2582 312
191 3300044712 Ga0453684_0000007 Ga0453684_0000007_301021_301980 312
192 3300044712 Ga0453684_0000640 Ga0453684_0000640_77616_78575 312
193 3300044712 Ga0453684_0002619 Ga0453684_0002619_18517_19476 312
194 3300044712 Ga0453684_0003171 Ga0453684_0003171_26424_27413 312
195 3300044712 Ga0453684_0003566 Ga0453684_0003566_6842_7801 312
196 3300044712 Ga0453684_0007683 Ga0453684_0007683_16846_17835 312
197 3300044712 Ga0453684_0023227 Ga0453684_0023227_713_1672 312
198 3300044712 Ga0453684_0077956 Ga0453684_0077956_2531_3490 312
199 3300044712 Ga0453684_0171942 Ga0453684_0171942_913_1872 312
200 3300044712 Ga0453684_0195663 Ga0453684_0195663_554_1513 312
201 3300044712 Ga0453684_0305881 Ga0453684_0305881_525_1484 312
202 3300044712 Ga0453684_0347128 Ga0453684_0347128_517_1533 312
203 3300050507 nmdc:mga05p37_198_c1 nmdc:mga05p37_198_c1_42947_43885 312
204 3300050512 nmdc:mga0n895_1342_c1 nmdc:mga0n895_1342_c1_13399_14337 312
205 3300050512 nmdc:mga0n895_14778_c1 nmdc:mga0n895_14778_c1_1689_2639 312
206 3300050513 nmdc:mga0rr50_477_c1 nmdc:mga0rr50_477_c1_9894_10832 312
207 3300050514 nmdc:mga08x19_274_c1 nmdc:mga08x19_274_c1_24810_25748 312
208 3300050515 nmdc:mga0a205_117_c1 nmdc:mga0a205_117_c1_23813_24751 312
209 3300005445 Ga0070708_100062164 Ga0070708_1000621642 313
210 3300005467 Ga0070706_100154035 Ga0070706_1001540352 313
211 3300005471 Ga0070698_100343617 Ga0070698_1003436172 313
212 3300005471 Ga0070698_100579595 Ga0070698_1005795951 313
213 3300005617 Ga0068859_100726906 Ga0068859_1007269061 313
214 3300006846 Ga0075430_100088796 Ga0075430_1000887963 313
215 3300006847 Ga0075431_100007072 Ga0075431_1000070726 313
216 3300006871 Ga0075434_100299411 Ga0075434_1002994112 313
217 3300006914 Ga0075436_100025316 Ga0075436_1000253163 313
218 3300006931 Ga0097620_100726906 Ga0097620_1007269061 313
219 3300009098 Ga0105245_10259695 Ga0105245_102596952 313
220 3300009147 Ga0114129_10042090 Ga0114129_100420906 313
221 3300013297 Ga0157378_10209842 Ga0157378_102098422 313
222 3300025910 Ga0207684_10116941 Ga0207684_101169412 313
223 3300028381 Ga0268264_10475203 Ga0268264_104752032 313
224 3300031691 Ga0316579_10113781 Ga0316579_101137811 313
225 3300031733 Ga0316577_10020968 Ga0316577_100209682 313
226 3300036647 Ga0316582_0011641 Ga0316582_0011641_1406_2353 313
227 3300036647 Ga0316582_0037636 Ga0316582_0037636_902_1864 313
228 3300036712 Ga0316584_0023671 Ga0316584_0023671_571_1527 313
229 3300044658 Ga0466972_0062308 Ga0466972_0062308_20_1006 313
230 3300044683 Ga0466965_0204426 Ga0466965_0204426_43_999 313
231 3300044712 Ga0453684_0004713 Ga0453684_0004713_19894_20856 313
232 3300044712 Ga0453684_0150194 Ga0453684_0150194_219_1184 313
233 3300044735 Ga0466968_0000734 Ga0466968_0000734_9706_10662 313
234 3300044901 Ga0466960_0024866 Ga0466960_0024866_1681_2667 313
235 3300048913 Ga0496110_0073607 Ga0496110_0073607_513_1466 313
236 3300049584 Ga0501068_0250889 Ga0501068_0250889_95_1057 313
237 3300049588 Ga0501072_0302780 Ga0501072_0302780_275_1219 313
238 3300049591 Ga0501075_0105477 Ga0501075_0105477_294_1256 313
239 3300049824 Ga0501045_0068410 Ga0501045_0068410_741_1703 313
240 3300050507 nmdc:mga05p37_384841_c1 nmdc:mga05p37_384841_c1_469_1422 313
241 3300050507 nmdc:mga05p37_525421_c1 nmdc:mga05p37_525421_c1_212_1177 313
242 3300054114 Ga0501084_0034428 Ga0501084_0034428_3017_3979 313
243 3300054114 Ga0501084_0059319 Ga0501084_0059319_1486_2448 313
244 3300035116 Ga0373945_0021837 Ga0373945_0021837_1108_2091 314
245 3300035170 Ga0373943_0046454 Ga0373943_0046454_714_1697 314
246 3300035692 Ga0373935_0007270 Ga0373935_0007270_2737_3720 314
247 3300035695 Ga0373927_0014150 Ga0373927_0014150_3709_4692 314
248 3300035725 Ga0373947_0000297 Ga0373947_0000297_605_1588 314
249 3300037068 Ga0373925_0026916 Ga0373925_0026916_334_1317 314
250 3300046455 Ga0495603_0043960 Ga0495603_0043960_1475_2458 314
251 3300046472 Ga0495580_0000268 Ga0495580_0000268_1983_2966 314
252 3300046473 Ga0495582_0017189 Ga0495582_0017189_210_1193 314
253 3300046475 Ga0495639_0007416 Ga0495639_0007416_201_1184 314
254 3300046517 Ga0495630_0001501 Ga0495630_0001501_14948_15931 314
255 3300046531 Ga0495665_0019190 Ga0495665_0019190_2429_3412 314
256 3300046674 Ga0495588_0066533 Ga0495588_0066533_484_1467 314
257 3300046683 Ga0495658_0090021 Ga0495658_0090021_751_1734 314
258 3300047315 Ga0495581_0001089 Ga0495581_0001089_13271_14254 314
259 3300048089 Ga0495614_0042133 Ga0495614_0042133_604_1587 314
260 3300009174 Ga0105241_10100953 Ga0105241_101009532 315
261 3300013100 Ga0157373_10016457 Ga0157373_100164573 315
262 3300013104 Ga0157370_10141497 Ga0157370_101414972 315
263 3300013307 Ga0157372_10021691 Ga0157372_100216912 315
264 3300025924 Ga0207694_10000045 Ga0207694_1000004598 316
265 3300031548 Ga0307408_100134107 Ga0307408_1001341072 316
266 3300031731 Ga0307405_10045870 Ga0307405_100458702 316
267 3300032002 Ga0307416_100386635 Ga0307416_1003866352 316
268 3300032005 Ga0307411_10374130 Ga0307411_103741302 316
269 3300034820 Ga0373959_0000304 Ga0373959_0000304_7527_8486 316
270 3300005329 Ga0070683_100001586 Ga0070683_1000015867 317
271 3300005329 Ga0070683_100011459 Ga0070683_1000114593 317
272 3300005329 Ga0070683_100063482 Ga0070683_1000634823 317
273 3300005336 Ga0070680_100023013 Ga0070680_1000230133 317
274 3300005337 Ga0070682_100185381 Ga0070682_1001853812 317
275 3300005344 Ga0070661_100001425 Ga0070661_1000014254 317
276 3300005434 Ga0070709_10011777 Ga0070709_100117774 317
277 3300005435 Ga0070714_100007547 Ga0070714_1000075474 317
278 3300005436 Ga0070713_100104683 Ga0070713_1001046832 317
279 3300005439 Ga0070711_100052817 Ga0070711_1000528172 317
280 3300005458 Ga0070681_10003971 Ga0070681_100039719 317
281 3300005458 Ga0070681_10189998 Ga0070681_101899982 317
282 3300005530 Ga0070679_100006650 Ga0070679_1000066506 317
283 3300005535 Ga0070684_100034109 Ga0070684_1000341093 317
284 3300005535 Ga0070684_100182192 Ga0070684_1001821922 317
285 3300005545 Ga0070695_100086814 Ga0070695_1000868142 317
286 3300005546 Ga0070696_100014899 Ga0070696_1000148993 317
287 3300005563 Ga0068855_100016019 Ga0068855_1000160195 317
288 3300005578 Ga0068854_100057295 Ga0068854_1000572953 317
289 3300005616 Ga0068852_100029715 Ga0068852_1000297154 317
290 3300005618 Ga0068864_100052061 Ga0068864_1000520612 317
291 3300006028 Ga0070717_10005658 Ga0070717_100056584 317
292 3300007076 Ga0075435_100331131 Ga0075435_1003311311 317
293 3300009093 Ga0105240_10006496 Ga0105240_100064966 317
294 3300013104 Ga0157370_10148827 Ga0157370_101488272 317
295 3300013307 Ga0157372_10011054 Ga0157372_100110544 317
296 3300014325 Ga0163163_10265613 Ga0163163_102656132 317
297 3300025906 Ga0207699_10006700 Ga0207699_100067002 317
298 3300025911 Ga0207654_10036211 Ga0207654_100362112 317
299 3300025912 Ga0207707_10000519 Ga0207707_1000051917 317
300 3300025912 Ga0207707_10094275 Ga0207707_100942752 317
301 3300025913 Ga0207695_10001473 Ga0207695_1000147322 317
302 3300025913 Ga0207695_10073138 Ga0207695_100731382 317
303 3300025916 Ga0207663_10122753 Ga0207663_101227532 317
304 3300025917 Ga0207660_10000107 Ga0207660_1000010720 317
305 3300025917 Ga0207660_10019837 Ga0207660_100198374 317
306 3300025919 Ga0207657_10322210 Ga0207657_103222101 317
307 3300025921 Ga0207652_10000440 Ga0207652_100004403 317
308 3300025928 Ga0207700_10000503 Ga0207700_100005034 317
309 3300025929 Ga0207664_10005274 Ga0207664_100052743 317
310 3300025944 Ga0207661_10019331 Ga0207661_100193314 317
311 3300025944 Ga0207661_10070934 Ga0207661_100709343 317
312 3300025949 Ga0207667_10045992 Ga0207667_100459924 317
313 3300025981 Ga0207640_10013361 Ga0207640_100133614 317
314 3300026095 Ga0207676_10041057 Ga0207676_100410572 317
315 3300026142 Ga0207698_10051228 Ga0207698_100512283 317
316 3300035086 Ga0373934_0000516 Ga0373934_0000516_10595_11587 317
317 3300035117 Ga0373953_0096151 Ga0373953_0096151_27_1019 317
318 3300035118 Ga0373954_0040992 Ga0373954_0040992_597_1589 317
319 3300035119 Ga0373956_0000814 Ga0373956_0000814_1271_2263 317
320 3300035410 Ga0373924_0003336 Ga0373924_0003336_3381_4373 317
321 3300035724 Ga0373933_0000210 Ga0373933_0000210_16970_17962 317
322 3300036401 Ga0373937_0000142 Ga0373937_0000142_9216_10208 317
323 3300045049 Ga0466959_0150585 Ga0466959_0150585_46_1038 317
324 3300046454 Ga0495592_0012659 Ga0495592_0012659_1520_2512 317
325 3300046459 Ga0495629_0047877 Ga0495629_0047877_1918_2910 317
326 3300046462 Ga0495651_0053659 Ga0495651_0053659_1952_2944 317
327 3300046463 Ga0495653_0004105 Ga0495653_0004105_3270_4262 317
328 3300046511 Ga0495608_0004142 Ga0495608_0004142_8654_9646 317
329 3300046516 Ga0495628_0004757 Ga0495628_0004757_8530_9522 317
330 3300046517 Ga0495630_0001593 Ga0495630_0001593_13057_14049 317
331 3300046536 Ga0495587_0001266 Ga0495587_0001266_12981_13973 317
332 3300046543 Ga0495645_0000095 Ga0495645_0000095_23159_24151 317
333 3300046543 Ga0495645_0127057 Ga0495645_0127057_714_1706 317
334 3300046559 Ga0495667_0013888 Ga0495667_0013888_4061_5053 317
335 3300046663 Ga0495635_0000378 Ga0495635_0000378_749_1741 317
336 3300046675 Ga0495657_0000682 Ga0495657_0000682_1460_2452 317
337 3300046678 Ga0495599_0000764 Ga0495599_0000764_13187_14179 317
338 3300046679 Ga0495623_0010785 Ga0495623_0010785_3382_4374 317
339 3300046809 Ga0495600_0000067 Ga0495600_0000067_38212_39204 317
340 3300047315 Ga0495581_0093931 Ga0495581_0093931_298_1290 317
341 3300047317 Ga0495604_0000192 Ga0495604_0000192_15455_16447 317
342 3300047319 Ga0495674_0015100 Ga0495674_0015100_586_1578 317
343 3300047319 Ga0495674_0210958 Ga0495674_0210958_45_1037 317
344 3300047322 Ga0495680_0029822 Ga0495680_0029822_1138_2130 317
345 3300047444 Ga0495675_0002539 Ga0495675_0002539_1426_2418 317
346 3300047471 Ga0495684_0000396 Ga0495684_0000396_1952_2944 317
347 3300048088 Ga0495602_0034248 Ga0495602_0034248_2303_3295 317
348 3300048911 Ga0496108_0200184 Ga0496108_0200184_592_1569 317
349 3300048915 Ga0496112_0001487 Ga0496112_0001487_16316_17293 317
350 3300048916 Ga0496113_0084418 Ga0496113_0084418_432_1409 317
351 3300049573 Ga0501037_0103977 Ga0501037_0103977_198_1163 317
352 3300049823 Ga0501044_0059008 Ga0501044_0059008_2423_3388 317
353 3300053077 Ga0495601_0031046 Ga0495601_0031046_158_1150 317
354 3300053078 Ga0495612_0055580 Ga0495612_0055580_407_1399 317
355 3300053085 Ga0495619_0054341 Ga0495619_0054341_737_1729 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

23

327

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

22

262

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

23

248

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9873 2 308
4lk3-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236a substitution 0.9811 2 308
4m55-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236h substitution 0.9789 2 308
4lk3-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236a substitution 0.9779 2 308
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.9773 2 308
ID Description Score Start End Superfamily
af_B7ZXP4_113_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9842 2 126 3.40.50.720
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9826 90 308 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9813 1 308 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 123 308 3.40.50.720
4m55E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9744 2 236 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A533Z8Y5-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9948 1 216 GO:0005737
GO:0042732
GO:0048040
GO:0070403
AF-A0A521KXB2-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.994 1 180 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A5C4MPF4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9938 168 308 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A0S8DSQ3-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9934 1 181 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A5C4MTY4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9933 168 308 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403

Feature Viewer

pLDDT pTM Quality
91.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map