F420103

General Info

Members Datasets Scaffolds Average Seq Length
355 181 355 184

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10012848|Ga0114129_100128486
Length 211
Sequence MPKENAMTQTSASQNRSNQTAEKNTVRTFHVNLRLTVIVTVGLAVLAGVAIAAQDKYTVKVPGGLAFSEFRGYEGWQAISISRNEKVMAMILGNPVMIDAYQAGIPGNGKPVPDGAKMAKIHWTPKPNQFFPDATVPGNLLNVDFMVKDSKRFADGGGWGYAVFDYDAASDTFKPGTTTGTPPQGNDAKCGVACHTRAKARDYVFTEYGKR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10094135 3300002459 Bacteria 624
2 JGI25406J46586_10009870 3300003203 Unclassified 4263
3 Ga0065714_10079991 3300005288 Bacteria 2473
4 Ga0065714_10122565 3300005288 Bacteria 1331
5 Ga0065704_10096293 3300005289 Bacteria 2448
6 Ga0065712_10000354 3300005290 Bacteria 15286
7 Ga0065712_10039941 3300005290 Bacteria 1105
8 Ga0065712_10067958 3300005290 Bacteria 19110
9 Ga0065715_10119031 3300005293 Bacteria 2293
10 Ga0065715_10238310 3300005293 Bacteria 1208
11 Ga0065715_10263986 3300005293 Bacteria 1130
12 Ga0065715_10475492 3300005293 Bacteria 795
13 Ga0065715_10567684 3300005293 Bacteria 729
14 Ga0065707_10083969 3300005295 Bacteria 7871
15 Ga0065707_10085126 3300005295 Bacteria 6432
16 Ga0065707_10154324 3300005295 Bacteria 1624
17 Ga0065707_10218261 3300005295 Bacteria 1236
18 Ga0070690_100592231 3300005330 Bacteria 841
19 Ga0070670_100006367 3300005331 Bacteria 9989
20 Ga0070670_100025248 3300005331 Bacteria 5113
21 Ga0070670_100090766 3300005331 Bacteria 2625
22 Ga0070670_100138764 3300005331 Bacteria 2102
23 Ga0070677_10185877 3300005333 Bacteria 993
24 Ga0070666_10374145 3300005335 Bacteria 1022
25 Ga0070680_100015392 3300005336 Bacteria 5995
26 Ga0070689_100177856 3300005340 Bacteria 1727
27 Ga0070687_100087783 3300005343 Bacteria 1713
28 Ga0070661_100086695 3300005344 Bacteria 2315
29 Ga0070668_100223597 3300005347 Bacteria 1553
30 Ga0070668_101005372 3300005347 Bacteria 749
31 Ga0070669_100240309 3300005353 Bacteria 1438
32 Ga0070675_100007961 3300005354 Bacteria 8215
33 Ga0070675_100016041 3300005354 Bacteria 5936
34 Ga0070675_100023852 3300005354 Bacteria 4896
35 Ga0070675_100088927 3300005354 Bacteria 2585
36 Ga0070675_100130700 3300005354 Bacteria 2140
37 Ga0070671_100893255 3300005355 Bacteria 776
38 Ga0070674_100029429 3300005356 Bacteria 3618
39 Ga0070674_100142030 3300005356 Bacteria 1803
40 Ga0070674_100278658 3300005356 Bacteria 1324
41 Ga0070673_100597237 3300005364 Bacteria 1006
42 Ga0070673_100609089 3300005364 Bacteria 997
43 Ga0070659_100231808 3300005366 Bacteria 1526
44 Ga0070703_10000492 3300005406 Bacteria 15541
45 Ga0070714_100227284 3300005435 Bacteria 1718
46 Ga0070701_10057288 3300005438 Bacteria 2042
47 Ga0070701_10202992 3300005438 Bacteria 1173
48 Ga0070705_100745615 3300005440 Bacteria 774
49 Ga0070694_100365247 3300005444 Bacteria 1122
50 Ga0070708_100134938 3300005445 Bacteria 2286
51 Ga0070663_100512129 3300005455 Bacteria 998
52 Ga0070678_100049300 3300005456 Bacteria 3038
53 Ga0070678_100053931 3300005456 Bacteria 2927
54 Ga0070678_100104482 3300005456 Bacteria 2203
55 Ga0070678_100188575 3300005456 Bacteria 1694
56 Ga0070678_100583339 3300005456 Bacteria 996
57 Ga0070681_10872523 3300005458 Bacteria 818
58 Ga0070706_100000180 3300005467 Bacteria 80488
59 Ga0070707_100510816 3300005468 Unclassified 1163
60 Ga0070698_100621954 3300005471 Bacteria 1021
61 Ga0070699_100009674 3300005518 Bacteria 8347
62 Ga0070699_100098354 3300005518 Unclassified 2564
63 Ga0070679_100074600 3300005530 Bacteria 3383
64 Ga0070684_100621123 3300005535 Bacteria 1005
65 Ga0070672_100048058 3300005543 Bacteria 3314
66 Ga0070672_100170160 3300005543 Bacteria 1811
67 Ga0070672_100503636 3300005543 Bacteria 1048
68 Ga0070672_100736408 3300005543 Bacteria 865
69 Ga0070686_100586423 3300005544 Bacteria 877
70 Ga0070695_100217088 3300005545 Bacteria 1376
71 Ga0070695_100490074 3300005545 Bacteria 949
72 Ga0070696_100001465 3300005546 Bacteria 15434
73 Ga0070696_100021814 3300005546 Bacteria 4344
74 Ga0070696_100218300 3300005546 Bacteria 1430
75 Ga0070665_100492462 3300005548 Bacteria 1237
76 Ga0070665_100494032 3300005548 Bacteria 1235
77 Ga0070704_100490098 3300005549 Bacteria 1065
78 Ga0068855_100010999 3300005563 Bacteria 10920
79 Ga0070664_100075427 3300005564 Bacteria 2896
80 Ga0070664_100405060 3300005564 Bacteria 1248
81 Ga0070664_100409073 3300005564 Bacteria 1241
82 Ga0070664_100585936 3300005564 Bacteria 1034
83 Ga0070702_100271412 3300005615 Bacteria 1160
84 Ga0068852_100332891 3300005616 Bacteria 1478
85 Ga0068859_100221787 3300005617 Bacteria 1978
86 Ga0068859_100608305 3300005617 Bacteria 1186
87 Ga0068864_100000698 3300005618 Bacteria 28165
88 Ga0068864_100196238 3300005618 Bacteria 1852
89 Ga0068861_100069818 3300005719 Bacteria 2719
90 Ga0068861_100836797 3300005719 Bacteria 866
91 Ga0068870_10105419 3300005840 Bacteria 1601
92 Ga0068870_10208225 3300005840 Bacteria 1190
93 Ga0068870_10393653 3300005840 Bacteria 900
94 Ga0068863_100021542 3300005841 Bacteria 6150
95 Ga0068863_100093208 3300005841 Bacteria 2858
96 Ga0068863_100124666 3300005841 Bacteria 2457
97 Ga0068863_101234298 3300005841 Bacteria 754
98 Ga0068858_100001507 3300005842 Bacteria 23922
99 Ga0068858_100155908 3300005842 Bacteria 2148
100 Ga0068858_100889212 3300005842 Bacteria 871
101 Ga0068862_100040412 3300005844 Bacteria 3964
102 Ga0068862_100171497 3300005844 Bacteria 1942
103 Ga0068862_100206449 3300005844 Bacteria 1773
104 Ga0081539_10000336 3300005985 Bacteria 104057
105 Ga0070717_10943152 3300006028 Bacteria 786
106 Ga0097621_100019697 3300006237 Bacteria 5186
107 Ga0097621_100140273 3300006237 Unclassified 2065
108 Ga0097621_100194535 3300006237 Bacteria 1758
109 Ga0097621_100932654 3300006237 Bacteria 810
110 Ga0068871_100003453 3300006358 Bacteria 10857
111 Ga0068871_100075364 3300006358 Unclassified 2785
112 Ga0068871_100148791 3300006358 Bacteria 1996
113 Ga0068871_100328786 3300006358 Bacteria 1348
114 Ga0068871_100436934 3300006358 Bacteria 1171
115 Ga0075428_100037867 3300006844 Bacteria 5307
116 Ga0075428_100607894 3300006844 Bacteria 1167
117 Ga0075428_100884952 3300006844 Bacteria 947
118 Ga0075431_100047564 3300006847 Bacteria 4422
119 Ga0075434_100059806 3300006871 Bacteria 3789
120 Ga0075434_100079541 3300006871 Bacteria 3275
121 Ga0075434_100235812 3300006871 Bacteria 1849
122 Ga0075429_100230109 3300006880 Bacteria 1624
123 Ga0075429_100240473 3300006880 Bacteria 1586
124 Ga0075429_101127445 3300006880 Unclassified 685
125 Ga0068865_100042607 3300006881 Bacteria 3096
126 Ga0097620_100221765 3300006931 Bacteria 1978
127 Ga0097620_100608310 3300006931 Bacteria 1186
128 Ga0105251_10094376 3300009011 Bacteria 1372
129 Ga0111539_10019197 3300009094 Bacteria 8446
130 Ga0111539_10109228 3300009094 Bacteria 3246
131 Ga0111539_10180057 3300009094 Unclassified 2469
132 Ga0111539_10345182 3300009094 Bacteria 1733
133 Ga0111539_11106985 3300009094 Bacteria 920
134 Ga0105245_10149619 3300009098 Bacteria 2206
135 Ga0114129_10012848 3300009147 Bacteria 11916
136 Ga0114129_11758987 3300009147 Bacteria 755
137 Ga0105243_10507888 3300009148 Bacteria 1144
138 Ga0105242_10011761 3300009176 Bacteria 6733
139 Ga0105242_10024853 3300009176 Bacteria 4734
140 Ga0105242_10126935 3300009176 Bacteria 2197
141 Ga0105242_10739353 3300009176 Bacteria 967
142 Ga0105242_10826980 3300009176 Bacteria 919
143 Ga0105248_10000505 3300009177 Bacteria 44403
144 Ga0105248_10024455 3300009177 Bacteria 6715
145 Ga0105248_10105193 3300009177 Bacteria 3182
146 Ga0105248_10137303 3300009177 Bacteria 2758
147 Ga0105248_10151780 3300009177 Bacteria 2614
148 Ga0105248_10511664 3300009177 Bacteria 1354
149 Ga0105248_10697909 3300009177 Bacteria 1145
150 Ga0105248_10817995 3300009177 Bacteria 1051
151 Ga0105248_10883824 3300009177 Bacteria 1009
152 Ga0105248_11079958 3300009177 Bacteria 907
153 Ga0105238_11296540 3300009551 Unclassified 754
154 Ga0105249_10142945 3300009553 Bacteria 2296
155 Ga0105239_10326222 3300010375 Bacteria 1731
156 Ga0105246_10894560 3300011119 Bacteria 796
157 Ga0157370_10017941 3300013104 Bacteria 7127
158 Ga0157369_10098356 3300013105 Bacteria 3121
159 Ga0157378_10296281 3300013297 Bacteria 1564
160 Ga0163162_10335574 3300013306 Bacteria 1644
161 Ga0163162_10609216 3300013306 Unclassified 1218
162 Ga0157372_10240934 3300013307 Bacteria 2099
163 Ga0157375_10191493 3300013308 Bacteria 2200
164 Ga0157375_10584666 3300013308 Bacteria 1277
165 Ga0157375_10735192 3300013308 Bacteria 1139
166 Ga0163163_10000664 3300014325 Bacteria 29497
167 Ga0163163_10001466 3300014325 Bacteria 19953
168 Ga0163163_10064983 3300014325 Bacteria 3620
169 Ga0163163_10169582 3300014325 Bacteria 2229
170 Ga0157377_10144147 3300014745 Bacteria 1466
171 Ga0157376_10016507 3300014969 Bacteria 5609
172 Ga0157376_10031769 3300014969 Unclassified 4233
173 Ga0157376_10036097 3300014969 Bacteria 4001
174 Ga0157376_10377010 3300014969 Bacteria 1365
175 Ga0157376_11960789 3300014969 Bacteria 623
176 Ga0163161_10290793 3300017792 Unclassified 1284
177 Ga0163161_10629754 3300017792 Unclassified 887
178 Ga0163161_10918660 3300017792 Bacteria 743
179 Ga0207697_10062438 3300025315 Bacteria 1551
180 Ga0207653_10000330 3300025885 Bacteria 24931
181 Ga0207682_10046614 3300025893 Bacteria 1782
182 Ga0207682_10210291 3300025893 Bacteria 897
183 Ga0207645_10384083 3300025907 Bacteria 943
184 Ga0207643_10132636 3300025908 Bacteria 1483
185 Ga0207643_10132710 3300025908 Bacteria 1483
186 Ga0207684_10002309 3300025910 Bacteria 19387
187 Ga0207660_10013642 3300025917 Bacteria 5327
188 Ga0207662_10661678 3300025918 Bacteria 730
189 Ga0207652_10194786 3300025921 Bacteria 1823
190 Ga0207681_10010540 3300025923 Bacteria 5663
191 Ga0207681_10013159 3300025923 Bacteria 5115
192 Ga0207681_10361225 3300025923 Bacteria 1165
193 Ga0207681_10663648 3300025923 Bacteria 865
194 Ga0207694_11349276 3300025924 Unclassified 603
195 Ga0207650_10056099 3300025925 Bacteria 2926
196 Ga0207650_10060786 3300025925 Bacteria 2819
197 Ga0207650_10387101 3300025925 Bacteria 1155
198 Ga0207659_10003444 3300025926 Bacteria 9486
199 Ga0207659_10028793 3300025926 Bacteria 3778
200 Ga0207659_10062026 3300025926 Bacteria 2697
201 Ga0207659_10081325 3300025926 Bacteria 2395
202 Ga0207659_10194849 3300025926 Bacteria 1614
203 Ga0207659_10258477 3300025926 Bacteria 1416
204 Ga0207659_10813293 3300025926 Bacteria 803
205 Ga0207687_10208395 3300025927 Bacteria 1532
206 Ga0207664_10211643 3300025929 Bacteria 1677
207 Ga0207690_10921939 3300025932 Bacteria 725
208 Ga0207686_10047061 3300025934 Bacteria 2664
209 Ga0207686_10096712 3300025934 Bacteria 1963
210 Ga0207686_10417681 3300025934 Bacteria 1025
211 Ga0207686_10581276 3300025934 Unclassified 879
212 Ga0207686_11035253 3300025934 Bacteria 667
213 Ga0207709_10340248 3300025935 Unclassified 1129
214 Ga0207709_10442445 3300025935 Bacteria 1003
215 Ga0207670_10031122 3300025936 Bacteria 3415
216 Ga0207670_10197981 3300025936 Bacteria 1524
217 Ga0207669_10015502 3300025937 Bacteria 3845
218 Ga0207669_10027490 3300025937 Bacteria 3116
219 Ga0207669_10030042 3300025937 Bacteria 3015
220 Ga0207669_10179865 3300025937 Bacteria 1515
221 Ga0207669_10290579 3300025937 Bacteria 1238
222 Ga0207704_10059768 3300025938 Bacteria 2355
223 Ga0207704_10336558 3300025938 Bacteria 1170
224 Ga0207704_10455169 3300025938 Bacteria 1022
225 Ga0207691_10025068 3300025940 Bacteria 5603
226 Ga0207691_10165832 3300025940 Bacteria 1936
227 Ga0207691_10251996 3300025940 Bacteria 1524
228 Ga0207691_10508814 3300025940 Bacteria 1022
229 Ga0207691_10680586 3300025940 Bacteria 868
230 Ga0207711_10002799 3300025941 Bacteria 15332
231 Ga0207711_10014552 3300025941 Bacteria 6539
232 Ga0207711_10082372 3300025941 Bacteria 2812
233 Ga0207711_10168987 3300025941 Bacteria 1983
234 Ga0207711_10278931 3300025941 Bacteria 1539
235 Ga0207711_10590183 3300025941 Bacteria 1036
236 Ga0207711_10728144 3300025941 Bacteria 925
237 Ga0207689_10356079 3300025942 Bacteria 1217
238 Ga0207689_10374209 3300025942 Bacteria 1186
239 Ga0207679_10065188 3300025945 Bacteria 2725
240 Ga0207679_10428979 3300025945 Bacteria 1168
241 Ga0207679_10547512 3300025945 Bacteria 1038
242 Ga0207667_10030912 3300025949 Bacteria 5787
243 Ga0207651_10082780 3300025960 Bacteria 2318
244 Ga0207651_10127786 3300025960 Bacteria 1940
245 Ga0207712_10087205 3300025961 Bacteria 2288
246 Ga0207668_10327106 3300025972 Bacteria 1274
247 Ga0207677_10562967 3300026023 Bacteria 995
248 Ga0207703_10003446 3300026035 Bacteria 13254
249 Ga0207703_10142226 3300026035 Bacteria 2083
250 Ga0207703_10467962 3300026035 Bacteria 1180
251 Ga0207703_10720132 3300026035 Bacteria 950
252 Ga0207678_10397539 3300026067 Bacteria 1193
253 Ga0207708_10221819 3300026075 Bacteria 1515
254 Ga0207708_10339943 3300026075 Bacteria 1229
255 Ga0207708_10888109 3300026075 Bacteria 771
256 Ga0207702_10012686 3300026078 Bacteria 7012
257 Ga0207641_10090108 3300026088 Bacteria 2681
258 Ga0207641_10559833 3300026088 Bacteria 1116
259 Ga0207641_10676278 3300026088 Bacteria 1015
260 Ga0207648_10033023 3300026089 Bacteria 4566
261 Ga0207648_11380949 3300026089 Bacteria 662
262 Ga0207676_10035777 3300026095 Bacteria 3772
263 Ga0207676_10183298 3300026095 Bacteria 1835
264 Ga0207676_10185008 3300026095 Bacteria 1827
265 Ga0207674_10343860 3300026116 Bacteria 1442
266 Ga0207675_100070686 3300026118 Bacteria 3262
267 Ga0207675_100133006 3300026118 Bacteria 2359
268 Ga0207675_100677626 3300026118 Bacteria 1039
269 Ga0207683_10011846 3300026121 Bacteria 7440
270 Ga0207683_10072241 3300026121 Bacteria 3051
271 Ga0207683_10206264 3300026121 Bacteria 1788
272 Ga0207683_10213308 3300026121 Bacteria 1757
273 Ga0207698_10301455 3300026142 Bacteria 1492
274 Ga0207428_10103542 3300027907 Unclassified 2197
275 Ga0268266_10645572 3300028379 Bacteria 1018
276 Ga0268266_10716408 3300028379 Bacteria 965
277 Ga0268266_10926006 3300028379 Bacteria 843
278 Ga0268265_10218467 3300028380 Bacteria 1666
279 Ga0268264_10800770 3300028381 Bacteria 941
280 Ga0307411_10981928 3300032005 Bacteria 755
281 Ga0373938_0189453 3300034957 Bacteria 565
282 Ga0373953_0113000 3300035117 Bacteria 1150
283 Ga0373957_0036633 3300035120 Bacteria 1828
284 Ga0373955_0439721 3300035172 Bacteria 794
285 Ga0373935_0109246 3300035692 Bacteria 1834
286 Ga0373937_0075753 3300036401 Bacteria 3107
287 Ga0373937_0129501 3300036401 Bacteria 2356
288 Ga0373937_0358568 3300036401 Bacteria 1382
289 Ga0373937_0521844 3300036401 Bacteria 1129
290 Ga0373925_0618895 3300037068 Bacteria 892
291 Ga0395900_0165002 3300037418 Bacteria 2258
292 Ga0453683_0432823 3300044673 Bacteria 850
293 Ga0451576_0188366 3300045051 Bacteria 2155
294 Ga0495592_0048196 3300046454 Bacteria 3170
295 Ga0495629_0023617 3300046459 Bacteria 4380
296 Ga0495651_0648975 3300046462 Bacteria 662
297 Ga0495580_0003529 3300046472 Bacteria 13288
298 Ga0495580_0281566 3300046472 Bacteria 1134
299 Ga0495580_0656615 3300046472 Bacteria 689
300 Ga0495582_0101778 3300046473 Bacteria 1609
301 Ga0495664_0212338 3300046477 Bacteria 1172
302 Ga0495664_0238388 3300046477 Bacteria 1100
303 Ga0495584_0143904 3300046491 Bacteria 1211
304 Ga0495594_0059738 3300046499 Bacteria 2109
305 Ga0495608_0166983 3300046511 Bacteria 1397
306 Ga0495618_0027368 3300046514 Bacteria 3549
307 Ga0495618_0084337 3300046514 Bacteria 2030
308 Ga0495618_0160725 3300046514 Bacteria 1432
309 Ga0495665_0018406 3300046531 Bacteria 3754
310 Ga0495598_0028379 3300046537 Bacteria 1552
311 Ga0495667_0002852 3300046559 Bacteria 11568
312 Ga0495656_0013839 3300046615 Bacteria 3011
313 Ga0495656_0269383 3300046615 Bacteria 865
314 Ga0495634_0223534 3300046642 Bacteria 1161
315 Ga0495635_0248586 3300046663 Bacteria 1199
316 Ga0495635_0320846 3300046663 Bacteria 1037
317 Ga0495659_0014535 3300046664 Bacteria 2578
318 Ga0495657_0003147 3300046675 Bacteria 13619
319 Ga0495599_0074313 3300046678 Bacteria 2122
320 Ga0495658_0167621 3300046683 Bacteria 1358
321 Ga0495670_0146993 3300046691 Bacteria 1235
322 Ga0495604_0768710 3300047317 Bacteria 608
323 Ga0495674_0013122 3300047319 Bacteria 7792
324 Ga0495674_0029018 3300047319 Bacteria 5040
325 Ga0495674_0061681 3300047319 Bacteria 3267
326 Ga0495675_0035390 3300047444 Bacteria 3190
327 Ga0495684_0048107 3300047471 Bacteria 3261
328 Ga0495684_0236700 3300047471 Bacteria 1333
329 Ga0495602_0230444 3300048088 Bacteria 1392
330 Ga0496112_0009353 3300048915 Bacteria 8822
331 Ga0496113_0311438 3300048916 Bacteria 1261
332 Ga0496114_0255963 3300048917 Bacteria 1541
333 nmdc:mga05p37_473194_c1 3300050507 Bacteria 1445
334 nmdc:mga05p37_492093_c1 3300050507 Bacteria 1410
335 nmdc:mga05p37_6221_c1 3300050507 Bacteria 14052
336 nmdc:mga09592_730754_c1 3300050508 Bacteria 841
337 nmdc:mga09592_753995_c1 3300050508 Unclassified 826
338 nmdc:mga0qj67_184795_c1 3300050509 Bacteria 1693
339 nmdc:mga06r32_37143_c1 3300050510 Bacteria 4607
340 nmdc:mga08y16_163374_c1 3300050511 Unclassified 2313
341 nmdc:mga08y16_18829_c1 3300050511 Bacteria 7273
342 nmdc:mga08y16_207759_c1 3300050511 Bacteria 2028
343 nmdc:mga08y16_323932_c1 3300050511 Bacteria 1586
344 nmdc:mga08y16_527289_c1 3300050511 Bacteria 1197
345 nmdc:mga0n895_21451_c1 3300050512 Bacteria 6041
346 nmdc:mga0n895_233457_c1 3300050512 Unclassified 1867
347 nmdc:mga0n895_76483_c1 3300050512 Bacteria 3329
348 nmdc:mga0n895_78920_c1 3300050512 Bacteria 3277
349 nmdc:mga0rr50_31733_c1 3300050513 Bacteria 3757
350 nmdc:mga0rr50_753807_c1 3300050513 Unclassified 831
351 nmdc:mga0rr50_964623_c1 3300050513 Bacteria 727
352 nmdc:mga08x19_34328_c1 3300050514 Bacteria 3205
353 Ga0495619_0100241 3300053085 Bacteria 1970
354 Ga0500556_0005660 3300053104 Bacteria 3529
355 Ga0500568_0002733 3300053139 Bacteria 10216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0165002 Ga0395900_0165002_929_1441 170
2 3300050508 nmdc:mga09592_730754_c1 nmdc:mga09592_730754_c1_297_815 172
3 3300050511 nmdc:mga08y16_163374_c1 nmdc:mga08y16_163374_c1_70_603 174
4 3300035117 Ga0373953_0113000 Ga0373953_0113000_205_738 176
5 3300036401 Ga0373937_0521844 Ga0373937_0521844_16_549 176
6 3300046462 Ga0495651_0648975 Ga0495651_0648975_49_582 176
7 3300046472 Ga0495580_0656615 Ga0495580_0656615_66_599 176
8 3300046473 Ga0495582_0101778 Ga0495582_0101778_800_1333 176
9 3300046664 Ga0495659_0014535 Ga0495659_0014535_762_1292 176
10 3300009094 Ga0111539_10180057 Ga0111539_101800572 177
11 3300014969 Ga0157376_10377010 Ga0157376_103770101 177
12 3300050509 nmdc:mga0qj67_184795_c1 nmdc:mga0qj67_184795_c1_406_939 177
13 3300005618 Ga0068864_100000698 Ga0068864_10000069821 178
14 3300009011 Ga0105251_10094376 Ga0105251_100943762 178
15 3300009177 Ga0105248_10000505 Ga0105248_1000050517 178
16 3300014325 Ga0163163_10000664 Ga0163163_100006649 178
17 3300034957 Ga0373938_0189453 Ga0373938_0189453_17_553 178
18 3300036401 Ga0373937_0358568 Ga0373937_0358568_508_1044 178
19 3300048915 Ga0496112_0009353 Ga0496112_0009353_1918_2454 178
20 3300048916 Ga0496113_0311438 Ga0496113_0311438_48_584 178
21 3300048917 Ga0496114_0255963 Ga0496114_0255963_914_1450 178
22 3300050513 nmdc:mga0rr50_31733_c1 nmdc:mga0rr50_31733_c1_2898_3434 178
23 3300050513 nmdc:mga0rr50_753807_c1 nmdc:mga0rr50_753807_c1_265_801 178
24 3300009094 Ga0111539_10345182 Ga0111539_103451822 179
25 3300009094 Ga0111539_11106985 Ga0111539_111069851 179
26 3300013308 Ga0157375_10191493 Ga0157375_101914932 179
27 3300044673 Ga0453683_0432823 Ga0453683_0432823_158_697 179
28 3300046537 Ga0495598_0028379 Ga0495598_0028379_421_960 179
29 3300046691 Ga0495670_0146993 Ga0495670_0146993_116_655 179
30 3300050507 nmdc:mga05p37_473194_c1 nmdc:mga05p37_473194_c1_895_1434 179
31 3300050511 nmdc:mga08y16_207759_c1 nmdc:mga08y16_207759_c1_985_1524 179
32 3300050511 nmdc:mga08y16_527289_c1 nmdc:mga08y16_527289_c1_501_1040 179
33 3300050512 nmdc:mga0n895_76483_c1 nmdc:mga0n895_76483_c1_896_1435 179
34 3300050512 nmdc:mga0n895_78920_c1 nmdc:mga0n895_78920_c1_1715_2254 179
35 3300050514 nmdc:mga08x19_34328_c1 nmdc:mga08x19_34328_c1_865_1404 179
36 3300053139 Ga0500568_0002733 Ga0500568_0002733_9362_9916 180
37 3300005840 Ga0068870_10208225 Ga0068870_102082252 181
38 3300006237 Ga0097621_100932654 Ga0097621_1009326541 181
39 3300006844 Ga0075428_100607894 Ga0075428_1006078941 181
40 3300006880 Ga0075429_100230109 Ga0075429_1002301092 181
41 3300009177 Ga0105248_10817995 Ga0105248_108179951 181
42 3300025907 Ga0207645_10384083 Ga0207645_103840832 181
43 3300025934 Ga0207686_10581276 Ga0207686_105812761 181
44 3300026075 Ga0207708_10888109 Ga0207708_108881091 181
45 3300045051 Ga0451576_0188366 Ga0451576_0188366_698_1252 181
46 3300005288 Ga0065714_10079991 Ga0065714_100799913 183
47 3300005288 Ga0065714_10122565 Ga0065714_101225652 183
48 3300005290 Ga0065712_10067958 Ga0065712_1006795812 183
49 3300005293 Ga0065715_10238310 Ga0065715_102383102 183
50 3300005293 Ga0065715_10263986 Ga0065715_102639862 183
51 3300005293 Ga0065715_10567684 Ga0065715_105676841 183
52 3300005330 Ga0070690_100592231 Ga0070690_1005922311 183
53 3300005331 Ga0070670_100090766 Ga0070670_1000907663 183
54 3300005331 Ga0070670_100138764 Ga0070670_1001387642 183
55 3300005347 Ga0070668_101005372 Ga0070668_1010053721 183
56 3300005354 Ga0070675_100007961 Ga0070675_1000079615 183
57 3300005356 Ga0070674_100029429 Ga0070674_1000294293 183
58 3300005364 Ga0070673_100597237 Ga0070673_1005972372 183
59 3300005440 Ga0070705_100745615 Ga0070705_1007456151 183
60 3300005456 Ga0070678_100583339 Ga0070678_1005833392 183
61 3300005535 Ga0070684_100621123 Ga0070684_1006211231 183
62 3300005545 Ga0070695_100490074 Ga0070695_1004900741 183
63 3300005564 Ga0070664_100075427 Ga0070664_1000754273 183
64 3300005564 Ga0070664_100405060 Ga0070664_1004050602 183
65 3300005618 Ga0068864_100196238 Ga0068864_1001962382 183
66 3300005719 Ga0068861_100069818 Ga0068861_1000698183 183
67 3300005719 Ga0068861_100836797 Ga0068861_1008367971 183
68 3300005841 Ga0068863_100124666 Ga0068863_1001246662 183
69 3300005842 Ga0068858_100001507 Ga0068858_10000150720 183
70 3300005844 Ga0068862_100171497 Ga0068862_1001714973 183
71 3300005844 Ga0068862_100206449 Ga0068862_1002064492 183
72 3300006237 Ga0097621_100019697 Ga0097621_1000196973 183
73 3300006237 Ga0097621_100140273 Ga0097621_1001402731 183
74 3300006358 Ga0068871_100003453 Ga0068871_1000034534 183
75 3300006358 Ga0068871_100075364 Ga0068871_1000753642 183
76 3300006358 Ga0068871_100148791 Ga0068871_1001487912 183
77 3300006881 Ga0068865_100042607 Ga0068865_1000426073 183
78 3300009098 Ga0105245_10149619 Ga0105245_101496193 183
79 3300009148 Ga0105243_10507888 Ga0105243_105078882 183
80 3300009176 Ga0105242_10024853 Ga0105242_100248533 183
81 3300009176 Ga0105242_10739353 Ga0105242_107393532 183
82 3300009176 Ga0105242_10826980 Ga0105242_108269801 183
83 3300009177 Ga0105248_10137303 Ga0105248_101373032 183
84 3300009177 Ga0105248_10151780 Ga0105248_101517805 183
85 3300009177 Ga0105248_10697909 Ga0105248_106979092 183
86 3300009553 Ga0105249_10142945 Ga0105249_101429452 183
87 3300010375 Ga0105239_10326222 Ga0105239_103262223 183
88 3300013297 Ga0157378_10296281 Ga0157378_102962812 183
89 3300013306 Ga0163162_10609216 Ga0163162_106092162 183
90 3300013308 Ga0157375_10584666 Ga0157375_105846663 183
91 3300014325 Ga0163163_10064983 Ga0163163_100649832 183
92 3300014969 Ga0157376_10031769 Ga0157376_100317694 183
93 3300014969 Ga0157376_10036097 Ga0157376_100360975 183
94 3300017792 Ga0163161_10290793 Ga0163161_102907932 183
95 3300017792 Ga0163161_10629754 Ga0163161_106297542 183
96 3300025925 Ga0207650_10056099 Ga0207650_100560992 183
97 3300025926 Ga0207659_10003444 Ga0207659_100034447 183
98 3300025927 Ga0207687_10208395 Ga0207687_102083952 183
99 3300025934 Ga0207686_10047061 Ga0207686_100470612 183
100 3300025934 Ga0207686_11035253 Ga0207686_110352531 183
101 3300025935 Ga0207709_10442445 Ga0207709_104424452 183
102 3300025937 Ga0207669_10290579 Ga0207669_102905792 183
103 3300025938 Ga0207704_10059768 Ga0207704_100597683 183
104 3300025938 Ga0207704_10336558 Ga0207704_103365582 183
105 3300025941 Ga0207711_10002799 Ga0207711_100027997 183
106 3300025941 Ga0207711_10014552 Ga0207711_100145522 183
107 3300025941 Ga0207711_10168987 Ga0207711_101689872 183
108 3300025941 Ga0207711_10728144 Ga0207711_107281441 183
109 3300025942 Ga0207689_10356079 Ga0207689_103560792 183
110 3300025945 Ga0207679_10065188 Ga0207679_100651883 183
111 3300025945 Ga0207679_10428979 Ga0207679_104289792 183
112 3300025960 Ga0207651_10082780 Ga0207651_100827802 183
113 3300025961 Ga0207712_10087205 Ga0207712_100872053 183
114 3300025972 Ga0207668_10327106 Ga0207668_103271062 183
115 3300026023 Ga0207677_10562967 Ga0207677_105629672 183
116 3300026035 Ga0207703_10003446 Ga0207703_1000344611 183
117 3300026088 Ga0207641_10559833 Ga0207641_105598332 183
118 3300026088 Ga0207641_10676278 Ga0207641_106762781 183
119 3300026089 Ga0207648_10033023 Ga0207648_100330234 183
120 3300026089 Ga0207648_11380949 Ga0207648_113809491 183
121 3300026095 Ga0207676_10183298 Ga0207676_101832981 183
122 3300026095 Ga0207676_10185008 Ga0207676_101850083 183
123 3300026118 Ga0207675_100070686 Ga0207675_1000706862 183
124 3300026118 Ga0207675_100133006 Ga0207675_1001330061 183
125 3300028379 Ga0268266_10645572 Ga0268266_106455722 183
126 3300028379 Ga0268266_10926006 Ga0268266_109260062 183
127 3300028381 Ga0268264_10800770 Ga0268264_108007701 183
128 3300046491 Ga0495584_0143904 Ga0495584_0143904_110_661 183
129 3300046499 Ga0495594_0059738 Ga0495594_0059738_537_1088 183
130 3300002459 JGI24751J29686_10094135 JGI24751J29686_100941351 184
131 3300003203 JGI25406J46586_10009870 JGI25406J46586_100098704 184
132 3300005289 Ga0065704_10096293 Ga0065704_100962932 184
133 3300005290 Ga0065712_10000354 Ga0065712_100003549 184
134 3300005290 Ga0065712_10039941 Ga0065712_100399411 184
135 3300005293 Ga0065715_10119031 Ga0065715_101190311 184
136 3300005293 Ga0065715_10475492 Ga0065715_104754921 184
137 3300005295 Ga0065707_10083969 Ga0065707_100839695 184
138 3300005295 Ga0065707_10085126 Ga0065707_100851263 184
139 3300005295 Ga0065707_10154324 Ga0065707_101543242 184
140 3300005295 Ga0065707_10218261 Ga0065707_102182612 184
141 3300005331 Ga0070670_100006367 Ga0070670_1000063675 184
142 3300005331 Ga0070670_100025248 Ga0070670_1000252486 184
143 3300005333 Ga0070677_10185877 Ga0070677_101858771 184
144 3300005335 Ga0070666_10374145 Ga0070666_103741451 184
145 3300005336 Ga0070680_100015392 Ga0070680_1000153922 184
146 3300005340 Ga0070689_100177856 Ga0070689_1001778562 184
147 3300005343 Ga0070687_100087783 Ga0070687_1000877831 184
148 3300005344 Ga0070661_100086695 Ga0070661_1000866951 184
149 3300005347 Ga0070668_100223597 Ga0070668_1002235972 184
150 3300005353 Ga0070669_100240309 Ga0070669_1002403091 184
151 3300005354 Ga0070675_100016041 Ga0070675_1000160415 184
152 3300005354 Ga0070675_100023852 Ga0070675_1000238525 184
153 3300005354 Ga0070675_100088927 Ga0070675_1000889273 184
154 3300005354 Ga0070675_100130700 Ga0070675_1001307002 184
155 3300005355 Ga0070671_100893255 Ga0070671_1008932551 184
156 3300005356 Ga0070674_100142030 Ga0070674_1001420302 184
157 3300005356 Ga0070674_100278658 Ga0070674_1002786582 184
158 3300005364 Ga0070673_100609089 Ga0070673_1006090892 184
159 3300005366 Ga0070659_100231808 Ga0070659_1002318081 184
160 3300005406 Ga0070703_10000492 Ga0070703_1000049215 184
161 3300005435 Ga0070714_100227284 Ga0070714_1002272842 184
162 3300005438 Ga0070701_10057288 Ga0070701_100572882 184
163 3300005438 Ga0070701_10202992 Ga0070701_102029921 184
164 3300005444 Ga0070694_100365247 Ga0070694_1003652471 184
165 3300005445 Ga0070708_100134938 Ga0070708_1001349382 184
166 3300005455 Ga0070663_100512129 Ga0070663_1005121292 184
167 3300005456 Ga0070678_100049300 Ga0070678_1000493004 184
168 3300005456 Ga0070678_100053931 Ga0070678_1000539312 184
169 3300005456 Ga0070678_100104482 Ga0070678_1001044822 184
170 3300005456 Ga0070678_100188575 Ga0070678_1001885752 184
171 3300005458 Ga0070681_10872523 Ga0070681_108725231 184
172 3300005467 Ga0070706_100000180 Ga0070706_10000018060 184
173 3300005468 Ga0070707_100510816 Ga0070707_1005108161 184
174 3300005471 Ga0070698_100621954 Ga0070698_1006219541 184
175 3300005518 Ga0070699_100009674 Ga0070699_1000096745 184
176 3300005518 Ga0070699_100098354 Ga0070699_1000983543 184
177 3300005530 Ga0070679_100074600 Ga0070679_1000746002 184
178 3300005543 Ga0070672_100048058 Ga0070672_1000480582 184
179 3300005543 Ga0070672_100170160 Ga0070672_1001701602 184
180 3300005543 Ga0070672_100503636 Ga0070672_1005036362 184
181 3300005543 Ga0070672_100736408 Ga0070672_1007364081 184
182 3300005544 Ga0070686_100586423 Ga0070686_1005864231 184
183 3300005545 Ga0070695_100217088 Ga0070695_1002170882 184
184 3300005546 Ga0070696_100001465 Ga0070696_1000014654 184
185 3300005546 Ga0070696_100021814 Ga0070696_1000218142 184
186 3300005546 Ga0070696_100218300 Ga0070696_1002183002 184
187 3300005548 Ga0070665_100492462 Ga0070665_1004924622 184
188 3300005548 Ga0070665_100494032 Ga0070665_1004940322 184
189 3300005549 Ga0070704_100490098 Ga0070704_1004900981 184
190 3300005563 Ga0068855_100010999 Ga0068855_1000109993 184
191 3300005564 Ga0070664_100409073 Ga0070664_1004090732 184
192 3300005564 Ga0070664_100585936 Ga0070664_1005859362 184
193 3300005615 Ga0070702_100271412 Ga0070702_1002714122 184
194 3300005616 Ga0068852_100332891 Ga0068852_1003328911 184
195 3300005617 Ga0068859_100221787 Ga0068859_1002217871 184
196 3300005617 Ga0068859_100608305 Ga0068859_1006083051 184
197 3300005840 Ga0068870_10105419 Ga0068870_101054192 184
198 3300005840 Ga0068870_10393653 Ga0068870_103936531 184
199 3300005841 Ga0068863_100021542 Ga0068863_1000215429 184
200 3300005841 Ga0068863_100093208 Ga0068863_1000932083 184
201 3300005841 Ga0068863_101234298 Ga0068863_1012342981 184
202 3300005842 Ga0068858_100155908 Ga0068858_1001559082 184
203 3300005842 Ga0068858_100889212 Ga0068858_1008892121 184
204 3300005844 Ga0068862_100040412 Ga0068862_1000404124 184
205 3300005985 Ga0081539_10000336 Ga0081539_1000033675 184
206 3300006028 Ga0070717_10943152 Ga0070717_109431521 184
207 3300006237 Ga0097621_100194535 Ga0097621_1001945353 184
208 3300006358 Ga0068871_100328786 Ga0068871_1003287862 184
209 3300006358 Ga0068871_100436934 Ga0068871_1004369342 184
210 3300006844 Ga0075428_100037867 Ga0075428_1000378673 184
211 3300006844 Ga0075428_100884952 Ga0075428_1008849522 184
212 3300006847 Ga0075431_100047564 Ga0075431_1000475644 184
213 3300006871 Ga0075434_100059806 Ga0075434_1000598062 184
214 3300006871 Ga0075434_100079541 Ga0075434_1000795413 184
215 3300006871 Ga0075434_100235812 Ga0075434_1002358122 184
216 3300006880 Ga0075429_100240473 Ga0075429_1002404732 184
217 3300006880 Ga0075429_101127445 Ga0075429_1011274451 184
218 3300006931 Ga0097620_100221765 Ga0097620_1002217651 184
219 3300006931 Ga0097620_100608310 Ga0097620_1006083101 184
220 3300009094 Ga0111539_10019197 Ga0111539_100191975 184
221 3300009094 Ga0111539_10109228 Ga0111539_101092282 184
222 3300009147 Ga0114129_10012848 Ga0114129_100128486 184
223 3300009147 Ga0114129_11758987 Ga0114129_117589871 184
224 3300009176 Ga0105242_10011761 Ga0105242_100117614 184
225 3300009176 Ga0105242_10126935 Ga0105242_101269351 184
226 3300009177 Ga0105248_10024455 Ga0105248_100244552 184
227 3300009177 Ga0105248_10105193 Ga0105248_101051933 184
228 3300009177 Ga0105248_10511664 Ga0105248_105116641 184
229 3300009177 Ga0105248_10883824 Ga0105248_108838241 184
230 3300009177 Ga0105248_11079958 Ga0105248_110799581 184
231 3300009551 Ga0105238_11296540 Ga0105238_112965401 184
232 3300011119 Ga0105246_10894560 Ga0105246_108945602 184
233 3300013104 Ga0157370_10017941 Ga0157370_100179416 184
234 3300013105 Ga0157369_10098356 Ga0157369_100983563 184
235 3300013306 Ga0163162_10335574 Ga0163162_103355743 184
236 3300013307 Ga0157372_10240934 Ga0157372_102409342 184
237 3300013308 Ga0157375_10735192 Ga0157375_107351921 184
238 3300014325 Ga0163163_10001466 Ga0163163_1000146614 184
239 3300014325 Ga0163163_10169582 Ga0163163_101695822 184
240 3300014745 Ga0157377_10144147 Ga0157377_101441472 184
241 3300014969 Ga0157376_10016507 Ga0157376_100165077 184
242 3300014969 Ga0157376_11960789 Ga0157376_119607891 184
243 3300017792 Ga0163161_10918660 Ga0163161_109186602 184
244 3300025315 Ga0207697_10062438 Ga0207697_100624381 184
245 3300025885 Ga0207653_10000330 Ga0207653_1000033017 184
246 3300025893 Ga0207682_10046614 Ga0207682_100466142 184
247 3300025893 Ga0207682_10210291 Ga0207682_102102911 184
248 3300025908 Ga0207643_10132636 Ga0207643_101326362 184
249 3300025908 Ga0207643_10132710 Ga0207643_101327102 184
250 3300025910 Ga0207684_10002309 Ga0207684_1000230915 184
251 3300025917 Ga0207660_10013642 Ga0207660_100136421 184
252 3300025918 Ga0207662_10661678 Ga0207662_106616781 184
253 3300025921 Ga0207652_10194786 Ga0207652_101947861 184
254 3300025923 Ga0207681_10010540 Ga0207681_100105405 184
255 3300025923 Ga0207681_10013159 Ga0207681_100131594 184
256 3300025923 Ga0207681_10361225 Ga0207681_103612252 184
257 3300025923 Ga0207681_10663648 Ga0207681_106636482 184
258 3300025924 Ga0207694_11349276 Ga0207694_113492761 184
259 3300025925 Ga0207650_10060786 Ga0207650_100607864 184
260 3300025925 Ga0207650_10387101 Ga0207650_103871011 184
261 3300025926 Ga0207659_10028793 Ga0207659_100287932 184
262 3300025926 Ga0207659_10062026 Ga0207659_100620262 184
263 3300025926 Ga0207659_10081325 Ga0207659_100813255 184
264 3300025926 Ga0207659_10194849 Ga0207659_101948492 184
265 3300025926 Ga0207659_10258477 Ga0207659_102584772 184
266 3300025926 Ga0207659_10813293 Ga0207659_108132932 184
267 3300025929 Ga0207664_10211643 Ga0207664_102116432 184
268 3300025932 Ga0207690_10921939 Ga0207690_109219391 184
269 3300025934 Ga0207686_10096712 Ga0207686_100967121 184
270 3300025934 Ga0207686_10417681 Ga0207686_104176812 184
271 3300025935 Ga0207709_10340248 Ga0207709_103402482 184
272 3300025936 Ga0207670_10031122 Ga0207670_100311223 184
273 3300025936 Ga0207670_10197981 Ga0207670_101979812 184
274 3300025937 Ga0207669_10015502 Ga0207669_100155023 184
275 3300025937 Ga0207669_10027490 Ga0207669_100274903 184
276 3300025937 Ga0207669_10030042 Ga0207669_100300422 184
277 3300025937 Ga0207669_10179865 Ga0207669_101798652 184
278 3300025938 Ga0207704_10455169 Ga0207704_104551692 184
279 3300025940 Ga0207691_10025068 Ga0207691_100250681 184
280 3300025940 Ga0207691_10165832 Ga0207691_101658322 184
281 3300025940 Ga0207691_10251996 Ga0207691_102519962 184
282 3300025940 Ga0207691_10508814 Ga0207691_105088143 184
283 3300025940 Ga0207691_10680586 Ga0207691_106805861 184
284 3300025941 Ga0207711_10082372 Ga0207711_100823723 184
285 3300025941 Ga0207711_10278931 Ga0207711_102789311 184
286 3300025941 Ga0207711_10590183 Ga0207711_105901832 184
287 3300025942 Ga0207689_10374209 Ga0207689_103742091 184
288 3300025945 Ga0207679_10547512 Ga0207679_105475122 184
289 3300025949 Ga0207667_10030912 Ga0207667_100309124 184
290 3300025960 Ga0207651_10127786 Ga0207651_101277863 184
291 3300026035 Ga0207703_10142226 Ga0207703_101422262 184
292 3300026035 Ga0207703_10467962 Ga0207703_104679621 184
293 3300026035 Ga0207703_10720132 Ga0207703_107201321 184
294 3300026067 Ga0207678_10397539 Ga0207678_103975391 184
295 3300026075 Ga0207708_10221819 Ga0207708_102218192 184
296 3300026075 Ga0207708_10339943 Ga0207708_103399433 184
297 3300026078 Ga0207702_10012686 Ga0207702_100126866 184
298 3300026088 Ga0207641_10090108 Ga0207641_100901081 184
299 3300026095 Ga0207676_10035777 Ga0207676_100357776 184
300 3300026116 Ga0207674_10343860 Ga0207674_103438602 184
301 3300026118 Ga0207675_100677626 Ga0207675_1006776262 184
302 3300026121 Ga0207683_10011846 Ga0207683_100118463 184
303 3300026121 Ga0207683_10072241 Ga0207683_100722412 184
304 3300026121 Ga0207683_10206264 Ga0207683_102062642 184
305 3300026121 Ga0207683_10213308 Ga0207683_102133082 184
306 3300026142 Ga0207698_10301455 Ga0207698_103014551 184
307 3300027907 Ga0207428_10103542 Ga0207428_101035421 184
308 3300028379 Ga0268266_10716408 Ga0268266_107164082 184
309 3300028380 Ga0268265_10218467 Ga0268265_102184672 184
310 3300032005 Ga0307411_10981928 Ga0307411_109819281 184
311 3300035120 Ga0373957_0036633 Ga0373957_0036633_1091_1648 184
312 3300035172 Ga0373955_0439721 Ga0373955_0439721_65_622 184
313 3300035692 Ga0373935_0109246 Ga0373935_0109246_932_1486 184
314 3300036401 Ga0373937_0075753 Ga0373937_0075753_2034_2588 184
315 3300036401 Ga0373937_0129501 Ga0373937_0129501_1020_1577 184
316 3300037068 Ga0373925_0618895 Ga0373925_0618895_328_882 184
317 3300046454 Ga0495592_0048196 Ga0495592_0048196_1226_1780 184
318 3300046459 Ga0495629_0023617 Ga0495629_0023617_3368_3922 184
319 3300046472 Ga0495580_0003529 Ga0495580_0003529_1288_1842 184
320 3300046472 Ga0495580_0281566 Ga0495580_0281566_471_1025 184
321 3300046477 Ga0495664_0212338 Ga0495664_0212338_128_682 184
322 3300046477 Ga0495664_0238388 Ga0495664_0238388_256_810 184
323 3300046511 Ga0495608_0166983 Ga0495608_0166983_124_678 184
324 3300046514 Ga0495618_0027368 Ga0495618_0027368_738_1292 184
325 3300046514 Ga0495618_0084337 Ga0495618_0084337_286_843 184
326 3300046514 Ga0495618_0160725 Ga0495618_0160725_484_1038 184
327 3300046531 Ga0495665_0018406 Ga0495665_0018406_284_838 184
328 3300046559 Ga0495667_0002852 Ga0495667_0002852_3524_4081 184
329 3300046615 Ga0495656_0013839 Ga0495656_0013839_434_988 184
330 3300046615 Ga0495656_0269383 Ga0495656_0269383_141_758 184
331 3300046642 Ga0495634_0223534 Ga0495634_0223534_232_786 184
332 3300046663 Ga0495635_0248586 Ga0495635_0248586_187_741 184
333 3300046663 Ga0495635_0320846 Ga0495635_0320846_51_608 184
334 3300046675 Ga0495657_0003147 Ga0495657_0003147_9567_10124 184
335 3300046678 Ga0495599_0074313 Ga0495599_0074313_1309_1863 184
336 3300046683 Ga0495658_0167621 Ga0495658_0167621_140_697 184
337 3300047317 Ga0495604_0768710 Ga0495604_0768710_20_574 184
338 3300047319 Ga0495674_0013122 Ga0495674_0013122_1200_1754 184
339 3300047319 Ga0495674_0029018 Ga0495674_0029018_566_1120 184
340 3300047319 Ga0495674_0061681 Ga0495674_0061681_1819_2373 184
341 3300047444 Ga0495675_0035390 Ga0495675_0035390_2461_3015 184
342 3300047471 Ga0495684_0048107 Ga0495684_0048107_233_787 184
343 3300047471 Ga0495684_0236700 Ga0495684_0236700_168_722 184
344 3300048088 Ga0495602_0230444 Ga0495602_0230444_363_917 184
345 3300050507 nmdc:mga05p37_492093_c1 nmdc:mga05p37_492093_c1_420_974 184
346 3300050507 nmdc:mga05p37_6221_c1 nmdc:mga05p37_6221_c1_8658_9293 184
347 3300050508 nmdc:mga09592_753995_c1 nmdc:mga09592_753995_c1_63_617 184
348 3300050510 nmdc:mga06r32_37143_c1 nmdc:mga06r32_37143_c1_1262_1843 184
349 3300050511 nmdc:mga08y16_18829_c1 nmdc:mga08y16_18829_c1_2301_2864 184
350 3300050511 nmdc:mga08y16_323932_c1 nmdc:mga08y16_323932_c1_940_1494 184
351 3300050512 nmdc:mga0n895_21451_c1 nmdc:mga0n895_21451_c1_4978_5613 184
352 3300050512 nmdc:mga0n895_233457_c1 nmdc:mga0n895_233457_c1_980_1534 184
353 3300050513 nmdc:mga0rr50_964623_c1 nmdc:mga0rr50_964623_c1_36_671 184
354 3300053085 Ga0495619_0100241 Ga0495619_0100241_1251_1808 184
355 3300053104 Ga0500556_0005660 Ga0500556_0005660_1518_2072 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

70

206

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7666 44 179
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7506 44 178
6exp-assembly1.cif.gz_B crystal structure of the sirv3 acrid1 (gp02) anti-crispr protein 0.7402 47 97
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.7083 42 178
8gar-assembly1.cif.gz_A nitrosomonas europaea cytochrome p460 arg44ala 0.7067 44 181
ID Description Score Start End Superfamily
af_Q54RJ9_21_169_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.8252 51 67 2.70.130.10
af_Q4DNW3_439_1030_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7538 49 66 2.40.50.140
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.7086 44 181 3.50.70.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.685 131 148 3.30.470.20
af_A0A1D6JUA0_124_347_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6787 47 68 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A2U0XWL8-F1-model_v4 deleted 0.9617 94 141
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.8686 28 184
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.8634 28 184
AF-A0A2V2R107-F1-model_v4 deleted 0.8616 23 184
AF-A0A089P057-F1-model_v4 Putative cytochrome P460 0.8553 52 138

Feature Viewer

pLDDT pTM Quality
73.79 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map