F419957

General Info

Members Datasets Scaffolds Average Seq Length
354 242 708 146

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2863404153|2863406936
Length 166
Sequence SPVGFGRMDTGSYGPGEAAPAADGTKSDIDVANSEADVAKNEAPLGSRAPEFIRARRMLHLSWQVAIFVVGLAVVVTGVIMLPLPGPGWVVIFAGMAIWATEFVWAQLVLRWTKRKVTEATQRALDPKVRRRNIILTSIGLVIVAGLVGFYVWKFGFEMPWKIKNQ

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
14 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
19 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
20 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
21 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
22 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
23 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
24 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
25 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
26 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
29 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
30 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
31 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
32 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
33 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
34 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
35 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
36 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
37 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
38 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
39 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
40 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
41 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
42 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
43 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
46 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
47 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
48 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
62 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
69 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
85 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
150 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
154 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
159 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
160 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
161 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
162 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
163 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
164 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
165 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
166 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
167 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
170 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
171 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
172 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
173 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
176 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
177 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
178 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
181 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
182 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
183 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
184 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
185 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
186 2643221548 Streptomyces sp. Root55 Isolate Unclassified
187 2643221578 Streptomyces sp. Root63 Isolate Unclassified
188 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
189 2643221647 Streptomyces sp. Root369 Isolate Unclassified
190 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
191 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
192 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
193 2643221714 Streptomyces sp. Root264 Isolate Unclassified
194 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
195 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
196 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
197 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
198 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
199 2808606448 Streptomyces sp. 193411 Isolate Unclassified
200 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
201 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
202 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
203 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
204 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
205 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
206 2862574272 Streptomyces sp. AcE210 Isolate Nodule
207 2867428634 Streptomyces sp. RP5T Isolate Unclassified
208 2867475112 Streptomyces sp. TM32 Isolate Unclassified
209 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
210 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
211 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
212 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
213 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
214 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
215 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
216 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
217 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
218 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
219 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
220 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
221 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
222 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
223 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
224 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
225 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
226 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
227 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
228 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
229 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
230 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
231 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
232 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
233 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
234 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
235 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
236 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
237 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
238 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
239 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
240 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
241 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
242 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.2
Metatranscriptomes 0
Isolates 17.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 0.85
Rhizoplane 0.85
Rhizosphere 68.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10163396 3300003320 Bacteria 4384
2 rootL2_10028498 3300003322 Bacteria 4672
3 rootH1_10039217 3300003323 Bacteria 5570
4 rootH1_10055870 3300003323 Bacteria 4898
5 JGI25160J50197_1037039 3300003354 Bacteria 1174
6 Ga0070698_100669247 3300005471 Bacteria 979
7 Ga0068853_100024882 3300005539 Bacteria 5023
8 Ga0075363_100038295 3300006048 Bacteria 2521
9 Ga0075363_100405507 3300006048 Bacteria 801
10 Ga0075367_10628719 3300006178 Bacteria 682
11 Ga0075370_10074353 3300006353 Bacteria 1947
12 Ga0105245_11507761 3300009098 Bacteria 723
13 Ga0105243_11766923 3300009148 Bacteria 649
14 Ga0183367_1010 3300015688 Bacteria 416164
15 Ga0207426_1004137 3300025302 Bacteria 7275
16 Ga0207426_1004690 3300025302 Bacteria 6556
17 Ga0207709_11018330 3300025935 Bacteria 677
18 Ga0207639_10009832 3300026041 Bacteria 6609
19 Ga0307517_10036651 3300028786 Bacteria 5506
20 Ga0307515_10011425 3300028794 Bacteria 16851
21 Ga0307515_10116053 3300028794 Bacteria 3077
22 Ga0307515_10507347 3300028794 Bacteria 816
23 Ga0268256_1010011 3300030500 Bacteria 3099
24 Ga0307511_10002263 3300030521 Bacteria 20131
25 Ga0307511_10108688 3300030521 Bacteria 1778
26 Ga0307511_10254624 3300030521 Bacteria 839
27 Ga0307512_10012329 3300030522 Bacteria 8072
28 Ga0307512_10120846 3300030522 Bacteria 1684
29 Ga0307513_10101748 3300031456 Bacteria 2894
30 Ga0307513_10741910 3300031456 Bacteria 687
31 Ga0307509_10139130 3300031507 Bacteria 2367
32 Ga0307509_10380266 3300031507 Bacteria 1125
33 Ga0307508_10006533 3300031616 Bacteria 10964
34 Ga0307508_10033199 3300031616 Bacteria 4658
35 Ga0307508_10280958 3300031616 Bacteria 1258
36 Ga0307508_10491029 3300031616 Bacteria 822
37 Ga0307514_10111821 3300031649 Bacteria 1932
38 Ga0307514_10150392 3300031649 Bacteria 1563
39 Ga0307516_10065004 3300031730 Bacteria 3525
40 Ga0307516_10284035 3300031730 Bacteria 1336
41 Ga0307516_10560812 3300031730 Bacteria 796
42 Ga0307507_10137934 3300033179 Bacteria 1881
43 Ga0307507_10393021 3300033179 Bacteria 792
44 Ga0307510_10222476 3300033180 Bacteria 1397
45 Ga0307510_10278985 3300033180 Bacteria 1142
46 Ga0439436_0039386 3300041404 Bacteria 1357
47 Ga0439439_0029376 3300041406 Bacteria 1395
48 Ga0451795_0824933 3300041456 Bacteria 642
49 Ga0451802_1322227 3300041460 Bacteria 551
50 Ga0451837_0566550 3300041494 Bacteria 1377
51 Ga0451851_0483155 3300041507 Bacteria 637
52 Ga0451853_1031984 3300041512 Bacteria 2538
53 Ga0451853_3051037 3300041512 Bacteria 1590
54 Ga0451853_3368641 3300041512 Bacteria 750
55 Ga0451853_3771252 3300041512 Bacteria 879
56 Ga0439448_0045368 3300042005 Bacteria 1430
57 Ga0439455_0003991 3300042012 Bacteria 2879
58 Ga0439457_062458 3300042014 Bacteria 844
59 Ga0439457_074821 3300042014 Bacteria 775
60 Ga0450894_002625 3300042131 Bacteria 2392
61 Ga0450895_015487 3300042132 Bacteria 680
62 Ga0450896_000400 3300042133 Bacteria 4373
63 Ga0450899_000340 3300042135 Bacteria 5140
64 Ga0450899_013256 3300042135 Bacteria 930
65 Ga0450903_000252 3300042138 Bacteria 11823
66 Ga0450906_005247 3300042145 Bacteria 2677
67 Ga0439458_0000355 3300042157 Bacteria 11444
68 Ga0439460_0374382 3300042461 Bacteria 504
69 Ga0466969_0195215 3300044656 Bacteria 924
70 Ga0466972_0412105 3300044658 Bacteria 633
71 Ga0466965_0234229 3300044683 Bacteria 981
72 Ga0466966_0293922 3300044684 Bacteria 976
73 Ga0466961_0281535 3300044693 Bacteria 1017
74 Ga0466963_0002808 3300044694 Bacteria 9816
75 Ga0466963_0509583 3300044694 Bacteria 849
76 Ga0466964_0198265 3300044706 Bacteria 962
77 Ga0466971_0014630 3300044719 Bacteria 3453
78 Ga0466968_0321456 3300044735 Bacteria 747
79 Ga0466970_0001194 3300044765 Bacteria 12608
80 Ga0466970_0224634 3300044765 Bacteria 1048
81 Ga0466957_0002550 3300044842 Bacteria 9799
82 Ga0466960_0122908 3300044901 Bacteria 1361
83 Ga0466959_0001124 3300045049 Bacteria 16123
84 Ga0466958_0046805 3300045836 Bacteria 2610
85 Ga0466967_0383781 3300045976 Bacteria 1364
86 Ga0495617_005200 3300046452 Bacteria 4643
87 Ga0495592_0047313 3300046454 Bacteria 3203
88 Ga0495603_0006755 3300046455 Bacteria 6884
89 Ga0495603_0481774 3300046455 Bacteria 710
90 Ga0495590_0062301 3300046457 Bacteria 1306
91 Ga0495629_0000657 3300046459 Bacteria 27953
92 Ga0495629_0116455 3300046459 Bacteria 1862
93 Ga0495629_0435743 3300046459 Bacteria 888
94 Ga0495629_0509871 3300046459 Bacteria 810
95 Ga0495629_0638308 3300046459 Bacteria 710
96 Ga0495629_0674803 3300046459 Bacteria 687
97 Ga0495638_0222385 3300046460 Bacteria 1054
98 Ga0495638_0308971 3300046460 Bacteria 849
99 Ga0495638_0309430 3300046460 Bacteria 848
100 Ga0495638_0462303 3300046460 Bacteria 646
101 Ga0495651_0003316 3300046462 Bacteria 12360
102 Ga0495651_0162242 3300046462 Bacteria 1600
103 Ga0495651_0511597 3300046462 Bacteria 767
104 Ga0495580_0116179 3300046472 Bacteria 1858
105 Ga0495605_0074120 3300046474 Bacteria 1602
106 Ga0495639_0073067 3300046475 Bacteria 1587
107 Ga0495662_0005205 3300046476 Bacteria 6519
108 Ga0495662_0048633 3300046476 Bacteria 2047
109 Ga0495662_0098299 3300046476 Bacteria 1431
110 Ga0495662_0312621 3300046476 Bacteria 773
111 Ga0495662_0383250 3300046476 Bacteria 690
112 Ga0495664_0000837 3300046477 Bacteria 15783
113 Ga0495664_0784057 3300046477 Bacteria 561
114 Ga0495594_0039762 3300046499 Bacteria 2572
115 Ga0495594_0077738 3300046499 Bacteria 1851
116 Ga0495594_0087992 3300046499 Bacteria 1739
117 Ga0495596_0089227 3300046500 Bacteria 1196
118 Ga0495607_0165456 3300046501 Bacteria 1120
119 Ga0495583_0028760 3300046506 Bacteria 2728
120 Ga0495606_0027758 3300046507 Bacteria 4006
121 Ga0495606_0329378 3300046507 Bacteria 817
122 Ga0495610_0108572 3300046512 Bacteria 1232
123 Ga0495616_0009177 3300046513 Bacteria 5803
124 Ga0495618_0108205 3300046514 Bacteria 1780
125 Ga0495618_0214634 3300046514 Bacteria 1215
126 Ga0495620_0001729 3300046515 Bacteria 12888
127 Ga0495620_0013411 3300046515 Bacteria 4195
128 Ga0495628_0180619 3300046516 Bacteria 1596
129 Ga0495628_0460560 3300046516 Bacteria 922
130 Ga0495630_0189066 3300046517 Bacteria 1571
131 Ga0495631_0039754 3300046518 Bacteria 2085
132 Ga0495637_0134760 3300046520 Bacteria 941
133 Ga0495643_0005060 3300046522 Bacteria 9020
134 Ga0495643_0020745 3300046522 Bacteria 3781
135 Ga0495666_0100554 3300046526 Bacteria 1362
136 Ga0495642_0249095 3300046528 Bacteria 777
137 Ga0495652_0171708 3300046529 Bacteria 1673
138 Ga0495652_0654330 3300046529 Bacteria 711
139 Ga0495640_0004986 3300046533 Bacteria 10545
140 Ga0495586_0588402 3300046535 Bacteria 643
141 Ga0495587_0004266 3300046536 Bacteria 9443
142 Ga0495597_0073435 3300046542 Bacteria 1470
143 Ga0495597_0076812 3300046542 Bacteria 1432
144 Ga0495645_0127273 3300046543 Bacteria 1789
145 Ga0495645_0132546 3300046543 Bacteria 1745
146 Ga0495633_0035452 3300046558 Bacteria 2395
147 Ga0495668_0066982 3300046616 Bacteria 1975
148 Ga0495668_0442275 3300046616 Bacteria 715
149 Ga0495634_0071382 3300046642 Bacteria 2286
150 Ga0495634_0513544 3300046642 Bacteria 701
151 Ga0495611_0020813 3300046648 Bacteria 2827
152 Ga0495611_0245976 3300046648 Bacteria 829
153 Ga0495611_0279992 3300046648 Bacteria 770
154 Ga0495625_0270494 3300046660 Bacteria 1096
155 Ga0495625_0293485 3300046660 Bacteria 1042
156 Ga0495625_0387548 3300046660 Bacteria 875
157 Ga0495635_0008046 3300046663 Bacteria 7367
158 Ga0495635_0100268 3300046663 Bacteria 1979
159 Ga0495635_0465738 3300046663 Bacteria 834
160 Ga0495661_0079664 3300046665 Bacteria 1892
161 Ga0495588_0004972 3300046674 Bacteria 5901
162 Ga0495657_0008061 3300046675 Bacteria 8076
163 Ga0495657_0011469 3300046675 Bacteria 6625
164 Ga0495657_0034229 3300046675 Bacteria 3529
165 Ga0495657_0415323 3300046675 Bacteria 790
166 Ga0495599_0261021 3300046678 Bacteria 1052
167 Ga0495623_0129390 3300046679 Bacteria 1513
168 Ga0495646_0000447 3300046680 Bacteria 21801
169 Ga0495658_0172496 3300046683 Bacteria 1339
170 Ga0495613_0056669 3300046689 Bacteria 2877
171 Ga0495613_0104650 3300046689 Bacteria 2043
172 Ga0495613_0208103 3300046689 Bacteria 1376
173 Ga0495613_0559608 3300046689 Bacteria 764
174 Ga0495613_0590840 3300046689 Bacteria 739
175 Ga0495613_0823718 3300046689 Bacteria 604
176 Ga0495624_0113288 3300046690 Bacteria 1667
177 Ga0495624_0337732 3300046690 Bacteria 906
178 Ga0495670_0034670 3300046691 Bacteria 2515
179 Ga0495671_0050912 3300046692 Bacteria 2061
180 Ga0495649_0071312 3300046694 Bacteria 1862
181 Ga0495589_0142347 3300046794 Bacteria 1148
182 Ga0495589_0213669 3300046794 Bacteria 907
183 Ga0495589_0325818 3300046794 Bacteria 709
184 Ga0495660_0231607 3300046810 Bacteria 865
185 Ga0495581_0066153 3300047315 Bacteria 2090
186 Ga0495581_0246143 3300047315 Bacteria 1045
187 Ga0495604_0001020 3300047317 Bacteria 23351
188 Ga0495604_0060081 3300047317 Bacteria 2912
189 Ga0495604_0134713 3300047317 Bacteria 1771
190 Ga0495636_0045511 3300047318 Bacteria 1829
191 Ga0495636_0231372 3300047318 Bacteria 850
192 Ga0495636_0260813 3300047318 Bacteria 803
193 Ga0495674_0197240 3300047319 Bacteria 1671
194 Ga0495676_0010695 3300047321 Bacteria 8311
195 Ga0495676_0078926 3300047321 Bacteria 2504
196 Ga0495676_0084409 3300047321 Bacteria 2396
197 Ga0495676_0325692 3300047321 Bacteria 1031
198 Ga0495676_0384265 3300047321 Bacteria 933
199 Ga0495676_0569046 3300047321 Bacteria 739
200 Ga0495680_0018299 3300047322 Bacteria 5952
201 Ga0495680_0103482 3300047322 Bacteria 2119
202 Ga0495683_0255518 3300047323 Bacteria 767
203 Ga0495683_0349710 3300047323 Bacteria 624
204 Ga0495687_005741 3300047443 Bacteria 7801
205 Ga0495687_007398 3300047443 Bacteria 6471
206 Ga0495687_040068 3300047443 Bacteria 2067
207 Ga0495687_054972 3300047443 Bacteria 1667
208 Ga0495687_066353 3300047443 Bacteria 1465
209 Ga0495675_0062130 3300047444 Bacteria 2365
210 Ga0495685_003440 3300047447 Bacteria 5056
211 Ga0495685_006122 3300047447 Bacteria 3936
212 Ga0495685_072154 3300047447 Bacteria 1155
213 Ga0495685_132489 3300047447 Bacteria 814
214 Ga0495685_150991 3300047447 Bacteria 754
215 Ga0495681_0002846 3300047470 Bacteria 12220
216 Ga0495681_0170504 3300047470 Bacteria 900
217 Ga0495686_0118634 3300047472 Bacteria 1579
218 Ga0495686_0226735 3300047472 Bacteria 1060
219 Ga0495593_0062540 3300047673 Bacteria 1945
220 Ga0495593_0218473 3300047673 Bacteria 956
221 Ga0495593_0269176 3300047673 Bacteria 852
222 Ga0495602_0027832 3300048088 Bacteria 5423
223 Ga0495614_0050352 3300048089 Bacteria 1784
224 Ga0495614_0072426 3300048089 Bacteria 1486
225 Ga0495614_0088102 3300048089 Bacteria 1348
226 Ga0495614_0134965 3300048089 Bacteria 1094
227 Ga0495614_0145342 3300048089 Bacteria 1055
228 Ga0495614_0383602 3300048089 Bacteria 658
229 Ga0495615_0254674 3300048090 Bacteria 557
230 Ga0495626_0043563 3300048091 Bacteria 2104
231 Ga0495626_0237213 3300048091 Bacteria 735
232 Ga0496102_0916407 3300048905 Bacteria 798
233 Ga0495678_021542 3300049459 Bacteria 2836
234 Ga0501032_0164817 3300049569 Bacteria 1454
235 Ga0501033_0267734 3300049570 Bacteria 1208
236 Ga0501034_0014978 3300049571 Bacteria 7976
237 Ga0501036_0211992 3300049572 Bacteria 1627
238 Ga0501036_0764886 3300049572 Bacteria 796
239 Ga0501037_0016175 3300049573 Bacteria 5490
240 Ga0501037_0377810 3300049573 Bacteria 974
241 Ga0501038_0057645 3300049574 Bacteria 3334
242 Ga0501038_0653419 3300049574 Bacteria 791
243 Ga0501039_0981924 3300049575 Bacteria 656
244 Ga0501042_0033888 3300049578 Bacteria 3621
245 Ga0501043_0022853 3300049579 Bacteria 4903
246 Ga0501046_0030526 3300049580 Bacteria 4373
247 Ga0501046_0584569 3300049580 Bacteria 793
248 Ga0501047_0692769 3300049581 Bacteria 836
249 Ga0501047_0710283 3300049581 Bacteria 822
250 Ga0501044_0033653 3300049823 Bacteria 5383
251 Ga0501044_0615128 3300049823 Bacteria 978
252 nmdc:mga03n38_142389_c1 3300050490 Bacteria 1199
253 nmdc:mga03n38_33344_c1 3300050490 Bacteria 2190
254 nmdc:mga07m45_20567_c1 3300050496 Bacteria 3586
255 nmdc:mga0sz30_183160_c1 3300050516 Bacteria 929
256 Ga0500610_0348152 3300053079 Bacteria 628
257 Ga0495655_0059151 3300053083 Bacteria 1040
258 Ga0495619_0078385 3300053085 Bacteria 2221
259 Ga0500578_0051316 3300053086 Bacteria 2642
260 Ga0500646_0120736 3300053090 Bacteria 842
261 Ga0500583_0106384 3300053092 Bacteria 1378
262 Ga0500566_0020676 3300053094 Bacteria 3870
263 Ga0500640_164492 3300053095 Bacteria 827
264 Ga0500650_0051530 3300053098 Bacteria 1912
265 Ga0500650_0251956 3300053098 Bacteria 792
266 Ga0500654_069885 3300053099 Bacteria 1720
267 Ga0500553_178752 3300053101 Bacteria 765
268 Ga0500556_0088414 3300053104 Bacteria 1180
269 Ga0500560_007449 3300053107 Bacteria 2576
270 Ga0500560_149233 3300053107 Bacteria 777
271 Ga0500569_053456 3300053109 Bacteria 1225
272 Ga0500621_141152 3300053126 Bacteria 914
273 Ga0500628_024980 3300053129 Bacteria 1245
274 Ga0500652_020535 3300053131 Bacteria 2472
275 Ga0500658_0059722 3300053134 Bacteria 1582
276 Ga0500561_0034822 3300053137 Bacteria 1295
277 Ga0500573_0129399 3300053140 Bacteria 1399
278 Ga0500573_0257672 3300053140 Bacteria 895
279 Ga0500574_060035 3300053141 Bacteria 1103
280 Ga0500577_0187711 3300053142 Bacteria 889
281 Ga0500579_034813 3300053143 Bacteria 3210
282 Ga0500588_0029314 3300053146 Bacteria 1569
283 Ga0500600_0028492 3300053149 Bacteria 3302
284 Ga0500600_0146192 3300053149 Bacteria 1183
285 Ga0500600_0319942 3300053149 Bacteria 654
286 Ga0500616_0015783 3300053153 Bacteria 4311
287 Ga0500627_0211250 3300053158 Bacteria 868
288 Ga0500633_0176826 3300053160 Bacteria 800
289 Ga0500634_0041203 3300053161 Bacteria 2507
290 Ga0500587_006153 3300053739 Bacteria 1600
291 Ga0466962_0174060 3300061719 Bacteria 1048
292 2863406936 2863404153 Bacteria 9672205
293 2585300427 2582581312 Bacteria 7308206
294 2585303589 2582581313 Bacteria 10042643
295 2585317052 2582581314 Bacteria 11452267
296 2616695664 2616644814 Bacteria 11555299
297 2616900791 2616644941 Bacteria 8510691
298 2643760178 2643221548 Bacteria 8053412
299 2643904519 2643221578 Bacteria 9213798
300 2643946519 2643221587 Bacteria 7586415
301 2644268060 2643221647 Bacteria 10741251
302 2644406213 2643221673 Bacteria 9196637
303 2644434323 2643221677 Bacteria 7584031
304 2644460126 2643221682 Bacteria 6743283
305 2644629661 2643221714 Bacteria 9015452
306 2784586783 2784132148 Bacteria 8627943
307 2785345698 2784746763 Bacteria 9783172
308 2785367192 2784746768 Bacteria 10036182
309 2786668240 2786546132 Bacteria 10419719
310 2804843765 2802429296 Bacteria 7227771
311 2809230350 2808606448 Bacteria 8656184
312 2811847003 2808606982 Bacteria 7791042
313 2812360272 2811994879 Bacteria 9313447
314 2812482384 2811994917 Bacteria 7761064
315 2819696404 2818991463 Bacteria 7948711
316 2852637755 2852635781 Bacteria 8251373
317 2862390952 2862382967 Bacteria 10317375
318 2862583690 2862574272 Bacteria 10567477
319 2867430927 2867428634 Bacteria 9590268
320 2867480390 2867475112 Bacteria 6909112
321 2873157652 2873151551 Bacteria 8625867
322 2875392723 2875391855 Bacteria 7600475
323 2877683355 2877676314 Bacteria 9512378
324 2912722368 2912715099 Bacteria 9460473
325 2918502553 2918501144 Bacteria 8668083
326 2935394741 2935390628 Bacteria 7043367
327 2946051991 2946045630 Bacteria 8527308
328 2946065618 2946064051 Bacteria 8957905
329 2946073967 2946072368 Bacteria 8999607
330 2947231796 2947224130 Bacteria 9938529
331 2954388602 2954380949 Bacteria 10050426
332 2954674523 2954673503 Bacteria 9685905
333 2954689609 2954682443 Bacteria 9862841
334 2954699392 2954691527 Bacteria 10720516
335 2954702827 2954701450 Bacteria 10834262
336 2954718334 2954711539 Bacteria 10867210
337 2954728303 2954721474 Bacteria 10456478
338 2954733507 2954731030 Bacteria 10243860
339 2954747198 2954740390 Bacteria 10229294
340 2954752389 2954749733 Bacteria 10366972
341 2954766311 2954759201 Bacteria 9358192
342 2966604358 2966598605 Bacteria 7676064
343 2990059539 2990059506 Bacteria 9321252
344 2997454796 2997451912 Bacteria 8492419
345 2997605641 2997600082 Bacteria 9896405
346 3006430646 3006425503 Bacteria 6491253
347 3006488692 3006486233 Bacteria 8157040
348 8008561351 8008558824 Bacteria 10610750
349 8023628555 8023623736 Bacteria 8593882
350 8025414783 8025413630 Bacteria 7014048
351 8025534122 8025530807 Bacteria 8495698
352 8048130439 8048127548 Bacteria 11053136
353 8048413598 8048406513 Bacteria 8936924
354 8056670127 8056667051 Bacteria 6953971
355 rootH2_10163396
356 rootL2_10028498
357 rootH1_10039217
358 rootH1_10055870
359 JGI25160J50197_1037039
360 Ga0070698_100669247
361 Ga0068853_100024882
362 Ga0075363_100038295
363 Ga0075363_100405507
364 Ga0075367_10628719
365 Ga0075370_10074353
366 Ga0105245_11507761
367 Ga0105243_11766923
368 Ga0183367_1010
369 Ga0207426_1004137
370 Ga0207426_1004690
371 Ga0207709_11018330
372 Ga0207639_10009832
373 Ga0307517_10036651
374 Ga0307515_10011425
375 Ga0307515_10116053
376 Ga0307515_10507347
377 Ga0268256_1010011
378 Ga0307511_10002263
379 Ga0307511_10108688
380 Ga0307511_10254624
381 Ga0307512_10012329
382 Ga0307512_10120846
383 Ga0307513_10101748
384 Ga0307513_10741910
385 Ga0307509_10139130
386 Ga0307509_10380266
387 Ga0307508_10006533
388 Ga0307508_10033199
389 Ga0307508_10280958
390 Ga0307508_10491029
391 Ga0307514_10111821
392 Ga0307514_10150392
393 Ga0307516_10065004
394 Ga0307516_10284035
395 Ga0307516_10560812
396 Ga0307507_10137934
397 Ga0307507_10393021
398 Ga0307510_10222476
399 Ga0307510_10278985
400 Ga0439436_0039386
401 Ga0439439_0029376
402 Ga0451795_0824933
403 Ga0451802_1322227
404 Ga0451837_0566550
405 Ga0451851_0483155
406 Ga0451853_1031984
407 Ga0451853_3051037
408 Ga0451853_3368641
409 Ga0451853_3771252
410 Ga0439448_0045368
411 Ga0439455_0003991
412 Ga0439457_062458
413 Ga0439457_074821
414 Ga0450894_002625
415 Ga0450895_015487
416 Ga0450896_000400
417 Ga0450899_000340
418 Ga0450899_013256
419 Ga0450903_000252
420 Ga0450906_005247
421 Ga0439458_0000355
422 Ga0439460_0374382
423 Ga0466969_0195215
424 Ga0466972_0412105
425 Ga0466965_0234229
426 Ga0466966_0293922
427 Ga0466961_0281535
428 Ga0466963_0002808
429 Ga0466963_0509583
430 Ga0466964_0198265
431 Ga0466971_0014630
432 Ga0466968_0321456
433 Ga0466970_0001194
434 Ga0466970_0224634
435 Ga0466957_0002550
436 Ga0466960_0122908
437 Ga0466959_0001124
438 Ga0466958_0046805
439 Ga0466967_0383781
440 Ga0495617_005200
441 Ga0495592_0047313
442 Ga0495603_0006755
443 Ga0495603_0481774
444 Ga0495590_0062301
445 Ga0495629_0000657
446 Ga0495629_0116455
447 Ga0495629_0435743
448 Ga0495629_0509871
449 Ga0495629_0638308
450 Ga0495629_0674803
451 Ga0495638_0222385
452 Ga0495638_0308971
453 Ga0495638_0309430
454 Ga0495638_0462303
455 Ga0495651_0003316
456 Ga0495651_0162242
457 Ga0495651_0511597
458 Ga0495580_0116179
459 Ga0495605_0074120
460 Ga0495639_0073067
461 Ga0495662_0005205
462 Ga0495662_0048633
463 Ga0495662_0098299
464 Ga0495662_0312621
465 Ga0495662_0383250
466 Ga0495664_0000837
467 Ga0495664_0784057
468 Ga0495594_0039762
469 Ga0495594_0077738
470 Ga0495594_0087992
471 Ga0495596_0089227
472 Ga0495607_0165456
473 Ga0495583_0028760
474 Ga0495606_0027758
475 Ga0495606_0329378
476 Ga0495610_0108572
477 Ga0495616_0009177
478 Ga0495618_0108205
479 Ga0495618_0214634
480 Ga0495620_0001729
481 Ga0495620_0013411
482 Ga0495628_0180619
483 Ga0495628_0460560
484 Ga0495630_0189066
485 Ga0495631_0039754
486 Ga0495637_0134760
487 Ga0495643_0005060
488 Ga0495643_0020745
489 Ga0495666_0100554
490 Ga0495642_0249095
491 Ga0495652_0171708
492 Ga0495652_0654330
493 Ga0495640_0004986
494 Ga0495586_0588402
495 Ga0495587_0004266
496 Ga0495597_0073435
497 Ga0495597_0076812
498 Ga0495645_0127273
499 Ga0495645_0132546
500 Ga0495633_0035452
501 Ga0495668_0066982
502 Ga0495668_0442275
503 Ga0495634_0071382
504 Ga0495634_0513544
505 Ga0495611_0020813
506 Ga0495611_0245976
507 Ga0495611_0279992
508 Ga0495625_0270494
509 Ga0495625_0293485
510 Ga0495625_0387548
511 Ga0495635_0008046
512 Ga0495635_0100268
513 Ga0495635_0465738
514 Ga0495661_0079664
515 Ga0495588_0004972
516 Ga0495657_0008061
517 Ga0495657_0011469
518 Ga0495657_0034229
519 Ga0495657_0415323
520 Ga0495599_0261021
521 Ga0495623_0129390
522 Ga0495646_0000447
523 Ga0495658_0172496
524 Ga0495613_0056669
525 Ga0495613_0104650
526 Ga0495613_0208103
527 Ga0495613_0559608
528 Ga0495613_0590840
529 Ga0495613_0823718
530 Ga0495624_0113288
531 Ga0495624_0337732
532 Ga0495670_0034670
533 Ga0495671_0050912
534 Ga0495649_0071312
535 Ga0495589_0142347
536 Ga0495589_0213669
537 Ga0495589_0325818
538 Ga0495660_0231607
539 Ga0495581_0066153
540 Ga0495581_0246143
541 Ga0495604_0001020
542 Ga0495604_0060081
543 Ga0495604_0134713
544 Ga0495636_0045511
545 Ga0495636_0231372
546 Ga0495636_0260813
547 Ga0495674_0197240
548 Ga0495676_0010695
549 Ga0495676_0078926
550 Ga0495676_0084409
551 Ga0495676_0325692
552 Ga0495676_0384265
553 Ga0495676_0569046
554 Ga0495680_0018299
555 Ga0495680_0103482
556 Ga0495683_0255518
557 Ga0495683_0349710
558 Ga0495687_005741
559 Ga0495687_007398
560 Ga0495687_040068
561 Ga0495687_054972
562 Ga0495687_066353
563 Ga0495675_0062130
564 Ga0495685_003440
565 Ga0495685_006122
566 Ga0495685_072154
567 Ga0495685_132489
568 Ga0495685_150991
569 Ga0495681_0002846
570 Ga0495681_0170504
571 Ga0495686_0118634
572 Ga0495686_0226735
573 Ga0495593_0062540
574 Ga0495593_0218473
575 Ga0495593_0269176
576 Ga0495602_0027832
577 Ga0495614_0050352
578 Ga0495614_0072426
579 Ga0495614_0088102
580 Ga0495614_0134965
581 Ga0495614_0145342
582 Ga0495614_0383602
583 Ga0495615_0254674
584 Ga0495626_0043563
585 Ga0495626_0237213
586 Ga0496102_0916407
587 Ga0495678_021542
588 Ga0501032_0164817
589 Ga0501033_0267734
590 Ga0501034_0014978
591 Ga0501036_0211992
592 Ga0501036_0764886
593 Ga0501037_0016175
594 Ga0501037_0377810
595 Ga0501038_0057645
596 Ga0501038_0653419
597 Ga0501039_0981924
598 Ga0501042_0033888
599 Ga0501043_0022853
600 Ga0501046_0030526
601 Ga0501046_0584569
602 Ga0501047_0692769
603 Ga0501047_0710283
604 Ga0501044_0033653
605 Ga0501044_0615128
606 nmdc:mga03n38_142389_c1
607 nmdc:mga03n38_33344_c1
608 nmdc:mga07m45_20567_c1
609 nmdc:mga0sz30_183160_c1
610 Ga0500610_0348152
611 Ga0495655_0059151
612 Ga0495619_0078385
613 Ga0500578_0051316
614 Ga0500646_0120736
615 Ga0500583_0106384
616 Ga0500566_0020676
617 Ga0500640_164492
618 Ga0500650_0051530
619 Ga0500650_0251956
620 Ga0500654_069885
621 Ga0500553_178752
622 Ga0500556_0088414
623 Ga0500560_007449
624 Ga0500560_149233
625 Ga0500569_053456
626 Ga0500621_141152
627 Ga0500628_024980
628 Ga0500652_020535
629 Ga0500658_0059722
630 Ga0500561_0034822
631 Ga0500573_0129399
632 Ga0500573_0257672
633 Ga0500574_060035
634 Ga0500577_0187711
635 Ga0500579_034813
636 Ga0500588_0029314
637 Ga0500600_0028492
638 Ga0500600_0146192
639 Ga0500600_0319942
640 Ga0500616_0015783
641 Ga0500627_0211250
642 Ga0500633_0176826
643 Ga0500634_0041203
644 Ga0500587_006153
645 Ga0466962_0174060
646 2863406936
647 2585300427
648 2585303589
649 2585317052
650 2616695664
651 2616900791
652 2643760178
653 2643904519
654 2643946519
655 2644268060
656 2644406213
657 2644434323
658 2644460126
659 2644629661
660 2784586783
661 2785345698
662 2785367192
663 2786668240
664 2804843765
665 2809230350
666 2811847003
667 2812360272
668 2812482384
669 2819696404
670 2852637755
671 2862390952
672 2862583690
673 2867430927
674 2867480390
675 2873157652
676 2875392723
677 2877683355
678 2912722368
679 2918502553
680 2935394741
681 2946051991
682 2946065618
683 2946073967
684 2947231796
685 2954388602
686 2954674523
687 2954689609
688 2954699392
689 2954702827
690 2954718334
691 2954728303
692 2954733507
693 2954747198
694 2954752389
695 2954766311
696 2966604358
697 2990059539
698 2997454796
699 2997605641
700 3006430646
701 3006488692
702 8008561351
703 8023628555
704 8025414783
705 8025534122
706 8048130439
707 8048413598
708 8056670127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09656

PGPGW

Putative transmembrane protein (PGPGW)

64

116

0.97

Map