F419944

General Info

Members Datasets Scaffolds Average Seq Length
354 163 708 226

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0007782|Ga0466962_0007782_613_1326
Length 237
Sequence MLRAVLFDVDFTLARPGPELGPEGYVRAGERHGLRLEPARYEAARDAALVDLRRHPELEHDDEIWFRFTERIVRGMGGNADSAYPCAVEITRAWERHENFELYDDVPDVLAMLRAAGLGIGLVSNSARDVREFARHHGLDVDAGVSSFHHGRTKPHASIFRAVLDLLGVEPADAVMVGDTIADDIEGALALGMQAILVDRDGSRPEFEPRIGTLNELPPLLGLRGATSSRRAPGTGG

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.02
Rhizosphere 88.7
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0007782 3300061719 Bacteria 5137
2 Ga0070680_100047746 3300005336 Bacteria 3486
3 Ga0070680_100233850 3300005336 Bacteria 1552
4 Ga0070682_100051228 3300005337 Bacteria 2580
5 Ga0070660_100013664 3300005339 Bacteria 5835
6 Ga0070691_10238840 3300005341 Bacteria 970
7 Ga0070671_100159205 3300005355 Bacteria 1908
8 Ga0070709_10050878 3300005434 Bacteria 2597
9 Ga0070709_10371830 3300005434 Bacteria 1061
10 Ga0070714_100035546 3300005435 Bacteria 4177
11 Ga0070714_100043994 3300005435 Bacteria 3779
12 Ga0070714_100079267 3300005435 Bacteria 2855
13 Ga0070714_100079377 3300005435 Bacteria 2853
14 Ga0070714_100105558 3300005435 Bacteria 2488
15 Ga0070714_100235693 3300005435 Bacteria 1687
16 Ga0070713_100001098 3300005436 Bacteria 17278
17 Ga0070713_100038848 3300005436 Bacteria 3860
18 Ga0070713_100053962 3300005436 Bacteria 3332
19 Ga0070713_100480697 3300005436 Bacteria 1170
20 Ga0070710_10001474 3300005437 Bacteria 11072
21 Ga0070710_10229139 3300005437 Bacteria 1185
22 Ga0070711_100197393 3300005439 Bacteria 1550
23 Ga0070707_100000749 3300005468 Bacteria 32054
24 Ga0070707_100105617 3300005468 Bacteria 2731
25 Ga0070707_100239540 3300005468 Bacteria 1766
26 Ga0070698_100028207 3300005471 Bacteria 5833
27 Ga0070679_100187939 3300005530 Bacteria 2035
28 Ga0070695_100038433 3300005545 Bacteria 3020
29 Ga0070665_100849049 3300005548 Bacteria 926
30 Ga0068855_100055804 3300005563 Bacteria 4637
31 Ga0068854_100348950 3300005578 Bacteria 1211
32 Ga0068856_100028714 3300005614 Bacteria 5434
33 Ga0070717_10002024 3300006028 Bacteria 14193
34 Ga0070717_10023413 3300006028 Bacteria 4893
35 Ga0070717_10400067 3300006028 Bacteria 1233
36 Ga0070717_10483250 3300006028 Bacteria 1118
37 Ga0070715_10025257 3300006163 Bacteria 2350
38 Ga0070716_100000887 3300006173 Bacteria 12921
39 Ga0070716_100143671 3300006173 Bacteria 1525
40 Ga0070712_100012348 3300006175 Bacteria 5428
41 Ga0070712_100020685 3300006175 Bacteria 4308
42 Ga0068865_100875261 3300006881 Bacteria 780
43 Ga0105240_10349426 3300009093 Bacteria 1678
44 Ga0111539_10288005 3300009094 Bacteria 1911
45 Ga0105245_10281839 3300009098 Bacteria 1624
46 Ga0105247_10142240 3300009101 Bacteria 1573
47 Ga0105248_10191422 3300009177 Bacteria 2305
48 Ga0105248_10222735 3300009177 Bacteria 2124
49 Ga0105239_10136378 3300010375 Bacteria 2732
50 Ga0157369_10233111 3300013105 Bacteria 1924
51 Ga0157369_11120947 3300013105 Bacteria 804
52 Ga0157374_10034594 3300013296 Bacteria 4616
53 Ga0163162_10170869 3300013306 Bacteria 2299
54 Ga0157372_10014906 3300013307 Bacteria 8322
55 Ga0157372_11168737 3300013307 Bacteria 890
56 Ga0163163_10775648 3300014325 Bacteria 1022
57 Ga0182008_10116932 3300014497 Bacteria 1323
58 Ga0157377_10234432 3300014745 Bacteria 1182
59 Ga0182005_1038805 3300015265 Bacteria 1295
60 Ga0207685_10039343 3300025905 Bacteria 1755
61 Ga0207699_10030915 3300025906 Bacteria 3002
62 Ga0207699_10034613 3300025906 Bacteria 2867
63 Ga0207699_10109142 3300025906 Bacteria 1770
64 Ga0207684_10177066 3300025910 Bacteria 1839
65 Ga0207707_10076816 3300025912 Bacteria 2914
66 Ga0207707_10225850 3300025912 Bacteria 1629
67 Ga0207693_10001514 3300025915 Bacteria 20507
68 Ga0207693_10019641 3300025915 Bacteria 5373
69 Ga0207693_10083310 3300025915 Bacteria 2505
70 Ga0207663_10016113 3300025916 Bacteria 4136
71 Ga0207663_10106024 3300025916 Bacteria 1898
72 Ga0207649_10024250 3300025920 Bacteria 3524
73 Ga0207652_10146954 3300025921 Bacteria 2110
74 Ga0207646_10002360 3300025922 Bacteria 22302
75 Ga0207646_10294778 3300025922 Bacteria 1465
76 Ga0207694_10232157 3300025924 Bacteria 1507
77 Ga0207687_10067825 3300025927 Bacteria 2539
78 Ga0207700_10015618 3300025928 Bacteria 5015
79 Ga0207700_10059752 3300025928 Bacteria 2884
80 Ga0207700_10069427 3300025928 Bacteria 2704
81 Ga0207664_10023981 3300025929 Bacteria 4580
82 Ga0207664_10033279 3300025929 Bacteria 3958
83 Ga0207664_10041715 3300025929 Bacteria 3576
84 Ga0207664_10053597 3300025929 Bacteria 3194
85 Ga0207664_10088618 3300025929 Bacteria 2532
86 Ga0207664_10151533 3300025929 Bacteria 1970
87 Ga0207644_10431193 3300025931 Bacteria 1081
88 Ga0207665_10003486 3300025939 Bacteria 10506
89 Ga0207665_10053557 3300025939 Bacteria 2720
90 Ga0207665_10385772 3300025939 Bacteria 1064
91 Ga0207711_10646619 3300025941 Bacteria 986
92 Ga0207661_10289624 3300025944 Bacteria 1465
93 Ga0207667_10194909 3300025949 Bacteria 2079
94 Ga0207640_10297720 3300025981 Bacteria 1275
95 Ga0207678_10412038 3300026067 Bacteria 1171
96 Ga0265337_1104534 3300028556 Bacteria 770
97 Ga0265334_10007640 3300028573 Bacteria 4631
98 Ga0265322_10028864 3300028654 Bacteria 1585
99 Ga0265338_10008570 3300028800 Bacteria 12374
100 Ga0265338_10013049 3300028800 Bacteria 9420
101 Ga0265338_10019203 3300028800 Bacteria 7272
102 Ga0265338_10223164 3300028800 Bacteria 1406
103 Ga0265327_10011835 3300031251 Bacteria 5960
104 Ga0265316_10421466 3300031344 Bacteria 960
105 Ga0265313_10007078 3300031595 Bacteria 7748
106 Ga0316583_10044800 3300032133 Bacteria 1563
107 Ga0373936_0039434 3300035113 Bacteria 1890
108 Ga0373936_0124403 3300035113 Bacteria 1104
109 Ga0373953_0169382 3300035117 Bacteria 940
110 Ga0373946_0004900 3300035171 Bacteria 4820
111 Ga0373955_0027859 3300035172 Bacteria 2925
112 Ga0373955_0052558 3300035172 Bacteria 2223
113 Ga0373935_0014166 3300035692 Bacteria 4814
114 Ga0373947_0256533 3300035725 Bacteria 1157
115 Ga0373937_0001461 3300036401 Bacteria 19779
116 Ga0373937_0071898 3300036401 Bacteria 3190
117 Ga0373937_0361687 3300036401 Bacteria 1375
118 Ga0373925_0002688 3300037068 Bacteria 14108
119 Ga0373925_0600957 3300037068 Bacteria 906
120 Ga0395899_0118008 3300037312 Bacteria 1903
121 Ga0395900_0204141 3300037418 Bacteria 1998
122 Ga0395898_0240860 3300037466 Bacteria 1725
123 Ga0395898_0345914 3300037466 Bacteria 1418
124 Ga0395901_0375819 3300038443 Bacteria 1463
125 Ga0436363_0758150 3300039450 Bacteria 750
126 Ga0466969_0000890 3300044656 Bacteria 16138
127 Ga0466965_0055991 3300044683 Bacteria 1963
128 Ga0466966_0030451 3300044684 Bacteria 3505
129 Ga0466961_0010552 3300044693 Bacteria 5893
130 Ga0466961_0011827 3300044693 Bacteria 5579
131 Ga0466961_0307848 3300044693 Bacteria 967
132 Ga0466961_0328416 3300044693 Unclassified 932
133 Ga0466963_0000400 3300044694 Bacteria 19783
134 Ga0466963_0001579 3300044694 Bacteria 12367
135 Ga0466963_0001838 3300044694 Bacteria 11561
136 Ga0466963_0006320 3300044694 Bacteria 7006
137 Ga0466963_0009047 3300044694 Bacteria 5984
138 Ga0466963_0009192 3300044694 Bacteria 5945
139 Ga0466963_0036619 3300044694 Bacteria 3200
140 Ga0466963_0063079 3300044694 Bacteria 2480
141 Ga0466963_0072143 3300044694 Bacteria 2325
142 Ga0466963_0111672 3300044694 Bacteria 1876
143 Ga0466963_0224373 3300044694 Unclassified 1316
144 Ga0466963_0375126 3300044694 Bacteria 1002
145 Ga0466964_0004542 3300044706 Bacteria 5128
146 Ga0466964_0006382 3300044706 Bacteria 4395
147 Ga0466964_0020640 3300044706 Bacteria 2539
148 Ga0466964_0029757 3300044706 Bacteria 2158
149 Ga0466964_0063962 3300044706 Bacteria 1538
150 Ga0466964_0068288 3300044706 Bacteria 1496
151 Ga0466971_0000403 3300044719 Bacteria 16785
152 Ga0466971_0084486 3300044719 Bacteria 1449
153 Ga0466971_0189903 3300044719 Bacteria 968
154 Ga0466968_0084040 3300044735 Bacteria 1403
155 Ga0466968_0110148 3300044735 Bacteria 1237
156 Ga0466957_0002539 3300044842 Bacteria 9820
157 Ga0466957_0003504 3300044842 Bacteria 8625
158 Ga0466957_0005656 3300044842 Bacteria 7031
159 Ga0466957_0005906 3300044842 Bacteria 6904
160 Ga0466957_0039499 3300044842 Bacteria 2847
161 Ga0466957_0062246 3300044842 Bacteria 2291
162 Ga0466957_0074299 3300044842 Bacteria 2108
163 Ga0466957_0234798 3300044842 Bacteria 1215
164 Ga0466960_0036671 3300044901 Bacteria 2297
165 Ga0466959_0005205 3300045049 Bacteria 8873
166 Ga0466959_0016473 3300045049 Bacteria 5401
167 Ga0466959_0075182 3300045049 Bacteria 2441
168 Ga0466958_0004089 3300045836 Bacteria 7659
169 Ga0466958_0012688 3300045836 Bacteria 4777
170 Ga0466958_0019839 3300045836 Bacteria 3915
171 Ga0466958_0022539 3300045836 Bacteria 3690
172 Ga0466958_0026013 3300045836 Bacteria 3456
173 Ga0466958_0032435 3300045836 Bacteria 3107
174 Ga0466958_0039262 3300045836 Bacteria 2844
175 Ga0466958_0108017 3300045836 Bacteria 1736
176 Ga0466958_0166298 3300045836 Bacteria 1395
177 Ga0466967_0002083 3300045976 Bacteria 12245
178 Ga0466967_0006922 3300045976 Bacteria 8105
179 Ga0466967_0009791 3300045976 Bacteria 7147
180 Ga0466967_0021549 3300045976 Bacteria 5239
181 Ga0466967_0027018 3300045976 Bacteria 4766
182 Ga0466967_0028937 3300045976 Bacteria 4631
183 Ga0466967_0031928 3300045976 Bacteria 4440
184 Ga0466967_0089908 3300045976 Bacteria 2788
185 Ga0466967_0102436 3300045976 Bacteria 2619
186 Ga0466967_0149487 3300045976 Bacteria 2182
187 Ga0466967_0202813 3300045976 Bacteria 1879
188 Ga0466967_0238841 3300045976 Bacteria 1732
189 Ga0466967_0302360 3300045976 Bacteria 1539
190 Ga0466967_0378920 3300045976 Bacteria 1373
191 Ga0466967_0402176 3300045976 Bacteria 1332
192 Ga0466967_0974411 3300045976 Bacteria 844
193 Ga0495592_0000048 3300046454 Bacteria 114599
194 Ga0495592_0054231 3300046454 Bacteria 2971
195 Ga0495603_0043954 3300046455 Bacteria 2666
196 Ga0495629_0014781 3300046459 Bacteria 5616
197 Ga0495629_0197678 3300046459 Bacteria 1390
198 Ga0495629_0387552 3300046459 Bacteria 950
199 Ga0495641_0048215 3300046461 Bacteria 1954
200 Ga0495641_0084036 3300046461 Bacteria 1425
201 Ga0495641_0173997 3300046461 Bacteria 963
202 Ga0495651_0000049 3300046462 Bacteria 88249
203 Ga0495651_0023850 3300046462 Bacteria 4758
204 Ga0495651_0264534 3300046462 Unclassified 1169
205 Ga0495653_0000489 3300046463 Bacteria 30700
206 Ga0495653_0084576 3300046463 Bacteria 2336
207 Ga0495653_0164830 3300046463 Bacteria 1535
208 Ga0495582_0004885 3300046473 Bacteria 7510
209 Ga0495582_0022067 3300046473 Bacteria 3482
210 Ga0495605_0039628 3300046474 Bacteria 2359
211 Ga0495639_0005316 3300046475 Bacteria 5545
212 Ga0495662_0006321 3300046476 Bacteria 5923
213 Ga0495662_0282686 3300046476 Bacteria 817
214 Ga0495664_0042482 3300046477 Bacteria 2692
215 Ga0495664_0446740 3300046477 Bacteria 774
216 Ga0495584_0035923 3300046491 Bacteria 2504
217 Ga0495594_0226837 3300046499 Bacteria 1065
218 Ga0495596_0075824 3300046500 Bacteria 1306
219 Ga0495608_0022146 3300046511 Bacteria 4355
220 Ga0495608_0162225 3300046511 Bacteria 1421
221 Ga0495618_0032058 3300046514 Bacteria 3291
222 Ga0495618_0173061 3300046514 Bacteria 1373
223 Ga0495628_0000026 3300046516 Bacteria 127398
224 Ga0495628_0057466 3300046516 Bacteria 3060
225 Ga0495630_0003344 3300046517 Bacteria 11166
226 Ga0495630_0063342 3300046517 Bacteria 2777
227 Ga0495630_0237347 3300046517 Bacteria 1393
228 Ga0495644_0021523 3300046523 Bacteria 2460
229 Ga0495666_0000479 3300046526 Bacteria 17815
230 Ga0495642_0067563 3300046528 Bacteria 1491
231 Ga0495652_0000172 3300046529 Bacteria 74042
232 Ga0495652_0122015 3300046529 Bacteria 2076
233 Ga0495652_0608222 3300046529 Bacteria 745
234 Ga0495652_0625770 3300046529 Bacteria 731
235 Ga0495665_0004536 3300046531 Bacteria 7495
236 Ga0495587_0000362 3300046536 Bacteria 32677
237 Ga0495587_0118789 3300046536 Bacteria 1515
238 Ga0495645_0000016 3300046543 Bacteria 158415
239 Ga0495667_0004608 3300046559 Bacteria 9324
240 Ga0495667_0017392 3300046559 Bacteria 4855
241 Ga0495656_0003724 3300046615 Bacteria 5175
242 Ga0495634_0141409 3300046642 Bacteria 1527
243 Ga0495634_0165832 3300046642 Bacteria 1390
244 Ga0495634_0190730 3300046642 Bacteria 1278
245 Ga0495634_0236436 3300046642 Bacteria 1122
246 Ga0495635_0014544 3300046663 Bacteria 5505
247 Ga0495635_0147218 3300046663 Bacteria 1603
248 Ga0495635_0235331 3300046663 Bacteria 1236
249 Ga0495659_0102659 3300046664 Bacteria 1109
250 Ga0495588_0090623 3300046674 Bacteria 1602
251 Ga0495657_0002580 3300046675 Bacteria 15174
252 Ga0495657_0015919 3300046675 Bacteria 5489
253 Ga0495657_0065083 3300046675 Bacteria 2398
254 Ga0495657_0181821 3300046675 Bacteria 1290
255 Ga0495599_0000016 3300046678 Bacteria 169605
256 Ga0495599_0004510 3300046678 Bacteria 8256
257 Ga0495623_0000046 3300046679 Bacteria 74571
258 Ga0495623_0246901 3300046679 Bacteria 1006
259 Ga0495646_0101366 3300046680 Bacteria 1650
260 Ga0495646_0139325 3300046680 Bacteria 1358
261 Ga0495646_0184155 3300046680 Bacteria 1144
262 Ga0495658_0002284 3300046683 Bacteria 9665
263 Ga0495658_0051763 3300046683 Bacteria 2327
264 Ga0495658_0494174 3300046683 Bacteria 782
265 Ga0495613_0227473 3300046689 Bacteria 1307
266 Ga0495613_0273822 3300046689 Bacteria 1173
267 Ga0495613_0352769 3300046689 Bacteria 1010
268 Ga0495613_0407196 3300046689 Unclassified 927
269 Ga0495624_0002088 3300046690 Bacteria 15229
270 Ga0495624_0026779 3300046690 Bacteria 3778
271 Ga0495624_0245364 3300046690 Bacteria 1083
272 Ga0495670_0109924 3300046691 Bacteria 1425
273 Ga0495589_0008255 3300046794 Bacteria 5440
274 Ga0495600_0007328 3300046809 Bacteria 6741
275 Ga0495600_0027607 3300046809 Bacteria 3669
276 Ga0495604_0000004 3300047317 Bacteria 456385
277 Ga0495674_0059794 3300047319 Bacteria 3327
278 Ga0495674_0081631 3300047319 Bacteria 2773
279 Ga0495674_0296388 3300047319 Bacteria 1321
280 Ga0495674_0506480 3300047319 Bacteria 965
281 Ga0495676_0002477 3300047321 Bacteria 16420
282 Ga0495676_0208924 3300047321 Bacteria 1352
283 Ga0495680_0005384 3300047322 Bacteria 12065
284 Ga0495680_0009560 3300047322 Bacteria 8711
285 Ga0495680_0023296 3300047322 Bacteria 5150
286 Ga0495675_0000079 3300047444 Bacteria 68947
287 Ga0495684_0000645 3300047471 Bacteria 28045
288 Ga0495684_0017796 3300047471 Bacteria 5474
289 Ga0495593_0001046 3300047673 Bacteria 16226
290 Ga0495602_0000351 3300048088 Bacteria 42756
291 Ga0495602_0028726 3300048088 Bacteria 5315
292 Ga0495614_0006707 3300048089 Bacteria 5153
293 Ga0496101_0058570 3300048904 Bacteria 2790
294 Ga0496102_0115782 3300048905 Bacteria 2501
295 Ga0496102_0136941 3300048905 Bacteria 2295
296 Ga0496102_0560592 3300048905 Bacteria 1065
297 Ga0496103_0369202 3300048906 Bacteria 922
298 Ga0496104_0006660 3300048907 Bacteria 10166
299 Ga0496104_0141718 3300048907 Bacteria 2309
300 Ga0496104_0238760 3300048907 Bacteria 1729
301 Ga0496104_0547090 3300048907 Unclassified 1068
302 Ga0496105_0004316 3300048908 Bacteria 10707
303 Ga0496105_0077090 3300048908 Bacteria 2752
304 Ga0496105_0122578 3300048908 Bacteria 2143
305 Ga0496106_0007968 3300048909 Bacteria 7826
306 Ga0496107_0002716 3300048910 Bacteria 11605
307 Ga0496107_0065462 3300048910 Bacteria 2635
308 Ga0496108_0055295 3300048911 Bacteria 3332
309 Ga0496108_0401225 3300048911 Bacteria 1197
310 Ga0496109_0004583 3300048912 Bacteria 11537
311 Ga0496109_0013593 3300048912 Bacteria 7069
312 Ga0496109_0253724 3300048912 Bacteria 1656
313 Ga0496109_0318153 3300048912 Bacteria 1468
314 Ga0496110_0044469 3300048913 Bacteria 3878
315 Ga0496110_0068003 3300048913 Bacteria 3153
316 Ga0496111_0011638 3300048914 Bacteria 5936
317 Ga0496111_0026782 3300048914 Bacteria 4073
318 Ga0496112_0064490 3300048915 Bacteria 3615
319 Ga0496112_0075929 3300048915 Bacteria 3323
320 Ga0496112_0352234 3300048915 Bacteria 1415
321 Ga0496113_0052158 3300048916 Bacteria 3054
322 Ga0496113_0165870 3300048916 Bacteria 1747
323 Ga0496113_0508826 3300048916 Bacteria 967
324 Ga0496114_0026295 3300048917 Bacteria 4763
325 Ga0496114_0033121 3300048917 Bacteria 4256
326 Ga0496114_0093225 3300048917 Bacteria 2560
327 Ga0496114_0212402 3300048917 Bacteria 1697
328 Ga0496115_0014628 3300048918 Bacteria 5942
329 Ga0496115_0021438 3300048918 Bacteria 4992
330 Ga0496115_0413325 3300048918 Bacteria 1094
331 Ga0496115_0795564 3300048918 Bacteria 736
332 Ga0501067_0173171 3300049583 Bacteria 1202
333 nmdc:mga08y16_76477_c1 3300050511 Bacteria 3489
334 nmdc:mga0n895_66126_c1 3300050512 Bacteria 3580
335 Ga0495601_0000896 3300053077 Bacteria 16243
336 Ga0495601_0022478 3300053077 Bacteria 3871
337 Ga0495601_0022650 3300053077 Bacteria 3859
338 Ga0495601_0049349 3300053077 Bacteria 2653
339 Ga0495601_0237584 3300053077 Bacteria 1190
340 Ga0495595_0003269 3300053084 Bacteria 6436
341 Ga0495595_0014460 3300053084 Bacteria 3349
342 Ga0495595_0018601 3300053084 Bacteria 3004
343 Ga0495595_0030621 3300053084 Bacteria 2415
344 Ga0495619_0000199 3300053085 Bacteria 43846
345 Ga0495619_0017678 3300053085 Bacteria 4517
346 Ga0495619_0023268 3300053085 Bacteria 3971
347 Ga0495619_0050376 3300053085 Bacteria 2749
348 Ga0495619_0253141 3300053085 Bacteria 1220
349 Ga0495619_0293459 3300053085 Bacteria 1126
350 Ga0495619_0352924 3300053085 Bacteria 1017
351 Ga0466962_0018121 3300061719 Bacteria 3386
352 Ga0466962_0047176 3300061719 Bacteria 2058
353 Ga0466962_0154878 3300061719 Bacteria 1113
354 Ga0466962_0272726 3300061719 Bacteria 834
355 Ga0466962_0007782
356 Ga0070680_100047746
357 Ga0070680_100233850
358 Ga0070682_100051228
359 Ga0070660_100013664
360 Ga0070691_10238840
361 Ga0070671_100159205
362 Ga0070709_10050878
363 Ga0070709_10371830
364 Ga0070714_100035546
365 Ga0070714_100043994
366 Ga0070714_100079267
367 Ga0070714_100079377
368 Ga0070714_100105558
369 Ga0070714_100235693
370 Ga0070713_100001098
371 Ga0070713_100038848
372 Ga0070713_100053962
373 Ga0070713_100480697
374 Ga0070710_10001474
375 Ga0070710_10229139
376 Ga0070711_100197393
377 Ga0070707_100000749
378 Ga0070707_100105617
379 Ga0070707_100239540
380 Ga0070698_100028207
381 Ga0070679_100187939
382 Ga0070695_100038433
383 Ga0070665_100849049
384 Ga0068855_100055804
385 Ga0068854_100348950
386 Ga0068856_100028714
387 Ga0070717_10002024
388 Ga0070717_10023413
389 Ga0070717_10400067
390 Ga0070717_10483250
391 Ga0070715_10025257
392 Ga0070716_100000887
393 Ga0070716_100143671
394 Ga0070712_100012348
395 Ga0070712_100020685
396 Ga0068865_100875261
397 Ga0105240_10349426
398 Ga0111539_10288005
399 Ga0105245_10281839
400 Ga0105247_10142240
401 Ga0105248_10191422
402 Ga0105248_10222735
403 Ga0105239_10136378
404 Ga0157369_10233111
405 Ga0157369_11120947
406 Ga0157374_10034594
407 Ga0163162_10170869
408 Ga0157372_10014906
409 Ga0157372_11168737
410 Ga0163163_10775648
411 Ga0182008_10116932
412 Ga0157377_10234432
413 Ga0182005_1038805
414 Ga0207685_10039343
415 Ga0207699_10030915
416 Ga0207699_10034613
417 Ga0207699_10109142
418 Ga0207684_10177066
419 Ga0207707_10076816
420 Ga0207707_10225850
421 Ga0207693_10001514
422 Ga0207693_10019641
423 Ga0207693_10083310
424 Ga0207663_10016113
425 Ga0207663_10106024
426 Ga0207649_10024250
427 Ga0207652_10146954
428 Ga0207646_10002360
429 Ga0207646_10294778
430 Ga0207694_10232157
431 Ga0207687_10067825
432 Ga0207700_10015618
433 Ga0207700_10059752
434 Ga0207700_10069427
435 Ga0207664_10023981
436 Ga0207664_10033279
437 Ga0207664_10041715
438 Ga0207664_10053597
439 Ga0207664_10088618
440 Ga0207664_10151533
441 Ga0207644_10431193
442 Ga0207665_10003486
443 Ga0207665_10053557
444 Ga0207665_10385772
445 Ga0207711_10646619
446 Ga0207661_10289624
447 Ga0207667_10194909
448 Ga0207640_10297720
449 Ga0207678_10412038
450 Ga0265337_1104534
451 Ga0265334_10007640
452 Ga0265322_10028864
453 Ga0265338_10008570
454 Ga0265338_10013049
455 Ga0265338_10019203
456 Ga0265338_10223164
457 Ga0265327_10011835
458 Ga0265316_10421466
459 Ga0265313_10007078
460 Ga0316583_10044800
461 Ga0373936_0039434
462 Ga0373936_0124403
463 Ga0373953_0169382
464 Ga0373946_0004900
465 Ga0373955_0027859
466 Ga0373955_0052558
467 Ga0373935_0014166
468 Ga0373947_0256533
469 Ga0373937_0001461
470 Ga0373937_0071898
471 Ga0373937_0361687
472 Ga0373925_0002688
473 Ga0373925_0600957
474 Ga0395899_0118008
475 Ga0395900_0204141
476 Ga0395898_0240860
477 Ga0395898_0345914
478 Ga0395901_0375819
479 Ga0436363_0758150
480 Ga0466969_0000890
481 Ga0466965_0055991
482 Ga0466966_0030451
483 Ga0466961_0010552
484 Ga0466961_0011827
485 Ga0466961_0307848
486 Ga0466961_0328416
487 Ga0466963_0000400
488 Ga0466963_0001579
489 Ga0466963_0001838
490 Ga0466963_0006320
491 Ga0466963_0009047
492 Ga0466963_0009192
493 Ga0466963_0036619
494 Ga0466963_0063079
495 Ga0466963_0072143
496 Ga0466963_0111672
497 Ga0466963_0224373
498 Ga0466963_0375126
499 Ga0466964_0004542
500 Ga0466964_0006382
501 Ga0466964_0020640
502 Ga0466964_0029757
503 Ga0466964_0063962
504 Ga0466964_0068288
505 Ga0466971_0000403
506 Ga0466971_0084486
507 Ga0466971_0189903
508 Ga0466968_0084040
509 Ga0466968_0110148
510 Ga0466957_0002539
511 Ga0466957_0003504
512 Ga0466957_0005656
513 Ga0466957_0005906
514 Ga0466957_0039499
515 Ga0466957_0062246
516 Ga0466957_0074299
517 Ga0466957_0234798
518 Ga0466960_0036671
519 Ga0466959_0005205
520 Ga0466959_0016473
521 Ga0466959_0075182
522 Ga0466958_0004089
523 Ga0466958_0012688
524 Ga0466958_0019839
525 Ga0466958_0022539
526 Ga0466958_0026013
527 Ga0466958_0032435
528 Ga0466958_0039262
529 Ga0466958_0108017
530 Ga0466958_0166298
531 Ga0466967_0002083
532 Ga0466967_0006922
533 Ga0466967_0009791
534 Ga0466967_0021549
535 Ga0466967_0027018
536 Ga0466967_0028937
537 Ga0466967_0031928
538 Ga0466967_0089908
539 Ga0466967_0102436
540 Ga0466967_0149487
541 Ga0466967_0202813
542 Ga0466967_0238841
543 Ga0466967_0302360
544 Ga0466967_0378920
545 Ga0466967_0402176
546 Ga0466967_0974411
547 Ga0495592_0000048
548 Ga0495592_0054231
549 Ga0495603_0043954
550 Ga0495629_0014781
551 Ga0495629_0197678
552 Ga0495629_0387552
553 Ga0495641_0048215
554 Ga0495641_0084036
555 Ga0495641_0173997
556 Ga0495651_0000049
557 Ga0495651_0023850
558 Ga0495651_0264534
559 Ga0495653_0000489
560 Ga0495653_0084576
561 Ga0495653_0164830
562 Ga0495582_0004885
563 Ga0495582_0022067
564 Ga0495605_0039628
565 Ga0495639_0005316
566 Ga0495662_0006321
567 Ga0495662_0282686
568 Ga0495664_0042482
569 Ga0495664_0446740
570 Ga0495584_0035923
571 Ga0495594_0226837
572 Ga0495596_0075824
573 Ga0495608_0022146
574 Ga0495608_0162225
575 Ga0495618_0032058
576 Ga0495618_0173061
577 Ga0495628_0000026
578 Ga0495628_0057466
579 Ga0495630_0003344
580 Ga0495630_0063342
581 Ga0495630_0237347
582 Ga0495644_0021523
583 Ga0495666_0000479
584 Ga0495642_0067563
585 Ga0495652_0000172
586 Ga0495652_0122015
587 Ga0495652_0608222
588 Ga0495652_0625770
589 Ga0495665_0004536
590 Ga0495587_0000362
591 Ga0495587_0118789
592 Ga0495645_0000016
593 Ga0495667_0004608
594 Ga0495667_0017392
595 Ga0495656_0003724
596 Ga0495634_0141409
597 Ga0495634_0165832
598 Ga0495634_0190730
599 Ga0495634_0236436
600 Ga0495635_0014544
601 Ga0495635_0147218
602 Ga0495635_0235331
603 Ga0495659_0102659
604 Ga0495588_0090623
605 Ga0495657_0002580
606 Ga0495657_0015919
607 Ga0495657_0065083
608 Ga0495657_0181821
609 Ga0495599_0000016
610 Ga0495599_0004510
611 Ga0495623_0000046
612 Ga0495623_0246901
613 Ga0495646_0101366
614 Ga0495646_0139325
615 Ga0495646_0184155
616 Ga0495658_0002284
617 Ga0495658_0051763
618 Ga0495658_0494174
619 Ga0495613_0227473
620 Ga0495613_0273822
621 Ga0495613_0352769
622 Ga0495613_0407196
623 Ga0495624_0002088
624 Ga0495624_0026779
625 Ga0495624_0245364
626 Ga0495670_0109924
627 Ga0495589_0008255
628 Ga0495600_0007328
629 Ga0495600_0027607
630 Ga0495604_0000004
631 Ga0495674_0059794
632 Ga0495674_0081631
633 Ga0495674_0296388
634 Ga0495674_0506480
635 Ga0495676_0002477
636 Ga0495676_0208924
637 Ga0495680_0005384
638 Ga0495680_0009560
639 Ga0495680_0023296
640 Ga0495675_0000079
641 Ga0495684_0000645
642 Ga0495684_0017796
643 Ga0495593_0001046
644 Ga0495602_0000351
645 Ga0495602_0028726
646 Ga0495614_0006707
647 Ga0496101_0058570
648 Ga0496102_0115782
649 Ga0496102_0136941
650 Ga0496102_0560592
651 Ga0496103_0369202
652 Ga0496104_0006660
653 Ga0496104_0141718
654 Ga0496104_0238760
655 Ga0496104_0547090
656 Ga0496105_0004316
657 Ga0496105_0077090
658 Ga0496105_0122578
659 Ga0496106_0007968
660 Ga0496107_0002716
661 Ga0496107_0065462
662 Ga0496108_0055295
663 Ga0496108_0401225
664 Ga0496109_0004583
665 Ga0496109_0013593
666 Ga0496109_0253724
667 Ga0496109_0318153
668 Ga0496110_0044469
669 Ga0496110_0068003
670 Ga0496111_0011638
671 Ga0496111_0026782
672 Ga0496112_0064490
673 Ga0496112_0075929
674 Ga0496112_0352234
675 Ga0496113_0052158
676 Ga0496113_0165870
677 Ga0496113_0508826
678 Ga0496114_0026295
679 Ga0496114_0033121
680 Ga0496114_0093225
681 Ga0496114_0212402
682 Ga0496115_0014628
683 Ga0496115_0021438
684 Ga0496115_0413325
685 Ga0496115_0795564
686 Ga0501067_0173171
687 nmdc:mga08y16_76477_c1
688 nmdc:mga0n895_66126_c1
689 Ga0495601_0000896
690 Ga0495601_0022478
691 Ga0495601_0022650
692 Ga0495601_0049349
693 Ga0495601_0237584
694 Ga0495595_0003269
695 Ga0495595_0014460
696 Ga0495595_0018601
697 Ga0495595_0030621
698 Ga0495619_0000199
699 Ga0495619_0017678
700 Ga0495619_0023268
701 Ga0495619_0050376
702 Ga0495619_0253141
703 Ga0495619_0293459
704 Ga0495619_0352924
705 Ga0466962_0018121
706 Ga0466962_0047176
707 Ga0466962_0154878
708 Ga0466962_0272726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

151

213

0.94

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

56

198

0.89

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

2

192

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.7846 97 224
3k1z-assembly1.cif.gz_A crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3) 0.7834 4 224
3mmz-assembly1.cif.gz_D-2 crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680 0.7726 102 200
4hgr-assembly1.cif.gz_D crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.7687 102 184
3mmz-assembly1.cif.gz_A crystal structure of putative had family hydrolase from streptomyces avermitilis ma-4680 0.7682 102 200
ID Description Score Start End Superfamily
af_B4F880_219_297_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8689 162 200 3.40.50.1000
af_Q2FXX9_19_157_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8652 104 201 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8561 100 222 3.40.50.1000
af_Q9BI82_131_243_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8356 110 216 3.40.50.1000
af_Q54P82_223_296_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8354 155 200 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Y6CTR9-F1-model_v4 HAD-IA family hydrolase 0.9313 110 228 GO:0016791
GO:0044283
AF-A0A538FEX6-F1-model_v4 HAD-IIIA family hydrolase 0.9293 94 228 GO:0016787
AF-A0A1F2XUH5-F1-model_v4 Haloacid dehalogenase 0.9277 3 228 GO:0016791
GO:0044283
AF-A0A538DYJ2-F1-model_v4 HAD family hydrolase 0.9265 2 228 GO:0016791
GO:0044283
AF-A0A538DAY9-F1-model_v4 HAD family hydrolase 0.924 71 228 GO:0016791
GO:0044283

Map