F419941

General Info

Members Datasets Scaffolds Average Seq Length
354 230 335 271

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_005651|Ga0500645_005651_104_1018
Length 304
Sequence MTTGQPGASGNSGAPSGAGPAPAGSFGTRLDAVFGGSGHLCVGIDPHPYLLGEWGLPADAAGARTFGLRVVDAVAASERTGIVKPQVAFFEAYGSAGFAALEAVLEAARAAGLLVIGDAKRGDIGSTNDGYASAWLTPGSPLEVDALTVTAFTGVGALAPLFDRAEAHGKGLFVLSATSNPESRALQTARSEAGESVSRMVADAVAARNTDRTRLGDFGLVLGATKRLDEYGFTADSLRSLSTTPVLAPGFGFQGAEFSSIPHVFGPLAPDVVVSVSRSILQHGPSGLAAAIDADASQLAEVIA

Samples

Sample ID Description Type Environment
1 2643221546 Microbacterium sp. Root53 Isolate Unclassified
2 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
3 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
4 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
8 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
9 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
10 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
11 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
12 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
13 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
14 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
15 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
16 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
17 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
230 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 0
Rhizoplane 11.3
Rhizosphere 69.77
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10010786 3300002075 Bacteria 2025
2 JGI24744J21845_10002947 3300002077 Bacteria 3483
3 JGI24751J29686_10010810 3300002459 Bacteria 1881
4 rootH2_10009987 3300003320 Bacteria 1615
5 Ga0055540_1000085 3300003792 Bacteria 105366
6 Ga0055540_1002510 3300003792 Bacteria 9597
7 Ga0070676_10045159 3300005328 Bacteria 2565
8 Ga0070690_100007352 3300005330 Bacteria 6306
9 Ga0070670_100087178 3300005331 Bacteria 2683
10 Ga0070666_10173964 3300005335 Bacteria 1509
11 Ga0070682_100045376 3300005337 Bacteria 2724
12 Ga0070682_100240528 3300005337 Bacteria 1299
13 Ga0068868_100027771 3300005338 Bacteria 4319
14 Ga0068868_100152439 3300005338 Bacteria 1904
15 Ga0070660_100207981 3300005339 Bacteria 1588
16 Ga0070689_100020537 3300005340 Bacteria 4902
17 Ga0070691_10004402 3300005341 Bacteria 6399
18 Ga0070668_100005630 3300005347 Bacteria 9290
19 Ga0070668_100008044 3300005347 Bacteria 7833
20 Ga0070675_100074923 3300005354 Bacteria 2812
21 Ga0070671_100095958 3300005355 Bacteria 2486
22 Ga0070674_100074143 3300005356 Bacteria 2414
23 Ga0070674_100261233 3300005356 Bacteria 1364
24 Ga0070673_100111011 3300005364 Bacteria 2274
25 Ga0070688_100009160 3300005365 Bacteria 5400
26 Ga0070688_100054753 3300005365 Bacteria 2500
27 Ga0070659_100024423 3300005366 Bacteria 4634
28 Ga0070667_100003101 3300005367 Bacteria 14298
29 Ga0070667_100036224 3300005367 Bacteria 4136
30 Ga0070667_100252303 3300005367 Bacteria 1577
31 Ga0070703_10018509 3300005406 Bacteria 2015
32 Ga0070709_10090730 3300005434 Bacteria 2015
33 Ga0070713_100483450 3300005436 Bacteria 1167
34 Ga0070710_10005001 3300005437 Bacteria 6275
35 Ga0070710_10039385 3300005437 Bacteria 2600
36 Ga0070701_10000289 3300005438 Bacteria 16428
37 Ga0070701_10028389 3300005438 Bacteria 2750
38 Ga0070711_100007011 3300005439 Bacteria 6838
39 Ga0070711_100038954 3300005439 Bacteria 3198
40 Ga0070711_100220417 3300005439 Bacteria 1474
41 Ga0070705_100184082 3300005440 Bacteria 1418
42 Ga0070700_100008117 3300005441 Bacteria 5707
43 Ga0070694_100011872 3300005444 Bacteria 5403
44 Ga0070694_100195555 3300005444 Bacteria 1505
45 Ga0070663_100051951 3300005455 Bacteria 2922
46 Ga0070678_100002192 3300005456 Bacteria 10621
47 Ga0070678_100054768 3300005456 Bacteria 2908
48 Ga0070678_100100715 3300005456 Bacteria 2238
49 Ga0070662_100024655 3300005457 Bacteria 4147
50 Ga0068867_100014699 3300005459 Bacteria 5547
51 Ga0070685_10057428 3300005466 Bacteria 2265
52 Ga0070679_100296106 3300005530 Bacteria 1569
53 Ga0068853_100043747 3300005539 Bacteria 3831
54 Ga0070672_100089070 3300005543 Bacteria 2486
55 Ga0070672_100320226 3300005543 Bacteria 1318
56 Ga0070686_100222789 3300005544 Bacteria 1364
57 Ga0070695_100030975 3300005545 Bacteria 3333
58 Ga0070696_100002944 3300005546 Bacteria 11314
59 Ga0070693_100018808 3300005547 Bacteria 3613
60 Ga0070693_100123386 3300005547 Bacteria 1609
61 Ga0070665_100181309 3300005548 Bacteria 2107
62 Ga0070704_100011461 3300005549 Bacteria 5435
63 Ga0068855_100201471 3300005563 Bacteria 2240
64 Ga0068855_100216859 3300005563 Bacteria 2148
65 Ga0068854_100007208 3300005578 Bacteria 7099
66 Ga0068854_100060951 3300005578 Bacteria 2731
67 Ga0070702_100003499 3300005615 Bacteria 7032
68 Ga0068852_100061892 3300005616 Bacteria 3253
69 Ga0068859_100580211 3300005617 Bacteria 1215
70 Ga0068866_10003288 3300005718 Bacteria 6640
71 Ga0068866_10069347 3300005718 Bacteria 1857
72 Ga0068861_100038366 3300005719 Bacteria 3566
73 Ga0068863_100075758 3300005841 Bacteria 3183
74 Ga0068863_100471321 3300005841 Bacteria 1234
75 Ga0068858_100008460 3300005842 Bacteria 9891
76 Ga0068858_100069185 3300005842 Bacteria 3272
77 Ga0068858_100251469 3300005842 Bacteria 1679
78 Ga0068860_100014636 3300005843 Bacteria 7677
79 Ga0068862_100022260 3300005844 Bacteria 5300
80 Ga0068862_100133783 3300005844 Bacteria 2195
81 Ga0068862_100156412 3300005844 Bacteria 2032
82 Ga0075365_10016073 3300006038 Bacteria 4541
83 Ga0075365_10043678 3300006038 Bacteria 2934
84 Ga0075365_10104633 3300006038 Bacteria 1941
85 Ga0075363_100000754 3300006048 Bacteria 11076
86 Ga0075364_10009595 3300006051 Bacteria 5812
87 Ga0075364_10013184 3300006051 Bacteria 5074
88 Ga0075364_10016075 3300006051 Bacteria 4650
89 Ga0070715_10015979 3300006163 Bacteria 2810
90 Ga0070715_10083333 3300006163 Bacteria 1456
91 Ga0070716_100053436 3300006173 Bacteria 2303
92 Ga0070716_100403970 3300006173 Bacteria 983
93 Ga0070712_100001454 3300006175 Bacteria 14430
94 Ga0070712_100014685 3300006175 Bacteria 5027
95 Ga0075362_10100010 3300006177 Bacteria 1355
96 Ga0075367_10001275 3300006178 Bacteria 10648
97 Ga0075369_10000172 3300006186 Bacteria 18515
98 Ga0075369_10009081 3300006186 Bacteria 3850
99 Ga0075369_10053516 3300006186 Bacteria 1752
100 Ga0075369_10093183 3300006186 Bacteria 1346
101 Ga0097621_100054440 3300006237 Bacteria 3263
102 Ga0097621_100135226 3300006237 Bacteria 2102
103 Ga0075370_10050664 3300006353 Bacteria 2355
104 Ga0068871_100267391 3300006358 Bacteria 1493
105 Ga0075428_100036841 3300006844 Bacteria 5386
106 Ga0075430_100127827 3300006846 Bacteria 2118
107 Ga0075431_100006241 3300006847 Bacteria 11839
108 Ga0075434_100473939 3300006871 Bacteria 1273
109 Ga0068865_100007499 3300006881 Bacteria 6713
110 Ga0097620_100580194 3300006931 Bacteria 1215
111 Ga0105250_10101882 3300009092 Bacteria 1172
112 Ga0111539_10790227 3300009094 Bacteria 1104
113 Ga0105245_10039925 3300009098 Bacteria 4179
114 Ga0105247_10001080 3300009101 Bacteria 20331
115 Ga0105247_10086390 3300009101 Bacteria 1985
116 Ga0105247_10417153 3300009101 Bacteria 960
117 Ga0114129_10010121 3300009147 Bacteria 13444
118 Ga0105243_10007234 3300009148 Bacteria 8531
119 Ga0105243_10181180 3300009148 Bacteria 1832
120 Ga0105241_10013375 3300009174 Bacteria 6014
121 Ga0105242_10002833 3300009176 Bacteria 13592
122 Ga0105242_10093956 3300009176 Bacteria 2529
123 Ga0105242_10212721 3300009176 Bacteria 1724
124 Ga0105248_10006143 3300009177 Bacteria 13171
125 Ga0105248_10054216 3300009177 Bacteria 4496
126 Ga0105248_10406273 3300009177 Bacteria 1533
127 Ga0105237_10050956 3300009545 Bacteria 4160
128 Ga0105237_10055914 3300009545 Bacteria 3952
129 Ga0105237_10096547 3300009545 Bacteria 2946
130 Ga0105249_10003482 3300009553 Bacteria 13634
131 Ga0099796_10056917 3300010159 Bacteria 1374
132 Ga0105239_10037819 3300010375 Bacteria 5288
133 Ga0105239_10131076 3300010375 Bacteria 2789
134 Ga0105239_10196739 3300010375 Bacteria 2258
135 Ga0157369_10004087 3300013105 Bacteria 17278
136 Ga0157378_10005601 3300013297 Bacteria 11000
137 Ga0157378_10074453 3300013297 Bacteria 3056
138 Ga0163162_10144824 3300013306 Bacteria 2491
139 Ga0163162_10186725 3300013306 Bacteria 2200
140 Ga0157372_10047808 3300013307 Bacteria 4755
141 Ga0157375_10029177 3300013308 Bacteria 5184
142 Ga0157375_10540267 3300013308 Bacteria 1328
143 Ga0163163_10026051 3300014325 Bacteria 5584
144 Ga0163163_10635176 3300014325 Bacteria 1131
145 Ga0157380_10002499 3300014326 Bacteria 12391
146 Ga0157377_10272685 3300014745 Bacteria 1105
147 Ga0157379_10179580 3300014968 Bacteria 1912
148 Ga0157376_10226470 3300014969 Bacteria 1734
149 Ga0163161_10004733 3300017792 Bacteria 9464
150 Ga0163161_10053528 3300017792 Bacteria 2927
151 Ga0209051_1000200 3300025303 Bacteria 106484
152 Ga0209051_1005255 3300025303 Bacteria 7634
153 Ga0209051_1045488 3300025303 Bacteria 1518
154 Ga0207692_10037606 3300025898 Bacteria 2368
155 Ga0207642_10001595 3300025899 Bacteria 6995
156 Ga0207710_10010057 3300025900 Bacteria 3979
157 Ga0207688_10002319 3300025901 Bacteria 10230
158 Ga0207688_10009870 3300025901 Bacteria 5195
159 Ga0207685_10126504 3300025905 Bacteria 1129
160 Ga0207699_10231092 3300025906 Bacteria 1267
161 Ga0207645_10045619 3300025907 Bacteria 2800
162 Ga0207645_10125459 3300025907 Bacteria 1668
163 Ga0207643_10018640 3300025908 Bacteria 3800
164 Ga0207654_10038840 3300025911 Bacteria 2673
165 Ga0207671_10060388 3300025914 Bacteria 2812
166 Ga0207671_10193585 3300025914 Bacteria 1586
167 Ga0207671_10520923 3300025914 Bacteria 948
168 Ga0207693_10000595 3300025915 Bacteria 32369
169 Ga0207693_10003715 3300025915 Bacteria 13012
170 Ga0207663_10007693 3300025916 Bacteria 5605
171 Ga0207660_10572906 3300025917 Bacteria 919
172 Ga0207652_10286627 3300025921 Bacteria 1486
173 Ga0207681_10022240 3300025923 Bacteria 4042
174 Ga0207650_10051915 3300025925 Bacteria 3036
175 Ga0207687_10001438 3300025927 Bacteria 16295
176 Ga0207644_10007788 3300025931 Bacteria 6995
177 Ga0207644_10098887 3300025931 Bacteria 2188
178 Ga0207690_10075511 3300025932 Bacteria 2337
179 Ga0207690_10087216 3300025932 Bacteria 2195
180 Ga0207706_10016116 3300025933 Bacteria 6751
181 Ga0207706_10146710 3300025933 Bacteria 2075
182 Ga0207686_10030811 3300025934 Bacteria 3180
183 Ga0207686_10160420 3300025934 Bacteria 1575
184 Ga0207709_10012153 3300025935 Bacteria 4745
185 Ga0207669_10004071 3300025937 Bacteria 6403
186 Ga0207704_10001082 3300025938 Bacteria 12095
187 Ga0207665_10004624 3300025939 Bacteria 9138
188 Ga0207665_10005140 3300025939 Bacteria 8737
189 Ga0207665_10139140 3300025939 Bacteria 1729
190 Ga0207691_10063190 3300025940 Bacteria 3358
191 Ga0207691_10207360 3300025940 Bacteria 1704
192 Ga0207711_10273775 3300025941 Bacteria 1554
193 Ga0207711_10317308 3300025941 Bacteria 1439
194 Ga0207711_10439897 3300025941 Bacteria 1213
195 Ga0207689_10030688 3300025942 Bacteria 4479
196 Ga0207667_10064700 3300025949 Bacteria 3817
197 Ga0207667_10106711 3300025949 Bacteria 2889
198 Ga0207651_10136961 3300025960 Bacteria 1885
199 Ga0207712_10272915 3300025961 Bacteria 1377
200 Ga0207668_10018781 3300025972 Bacteria 4358
201 Ga0207640_10126268 3300025981 Bacteria 1842
202 Ga0207658_10004172 3300025986 Bacteria 10072
203 Ga0207658_10020291 3300025986 Bacteria 4601
204 Ga0207658_10088892 3300025986 Bacteria 2390
205 Ga0207658_10423342 3300025986 Bacteria 1174
206 Ga0207677_10016208 3300026023 Bacteria 4406
207 Ga0207677_10068928 3300026023 Bacteria 2485
208 Ga0207703_10010641 3300026035 Bacteria 7186
209 Ga0207639_10068001 3300026041 Bacteria 2774
210 Ga0207678_10045165 3300026067 Bacteria 3809
211 Ga0207678_10068691 3300026067 Bacteria 3040
212 Ga0207708_10017067 3300026075 Bacteria 5463
213 Ga0207708_10036820 3300026075 Bacteria 3726
214 Ga0207641_10017955 3300026088 Bacteria 5794
215 Ga0207648_10001778 3300026089 Bacteria 23621
216 Ga0207648_10004766 3300026089 Bacteria 13855
217 Ga0207676_10184178 3300026095 Bacteria 1831
218 Ga0207675_100014142 3300026118 Bacteria 7442
219 Ga0207675_100062981 3300026118 Bacteria 3465
220 Ga0207675_100260760 3300026118 Bacteria 1679
221 Ga0207683_10000716 3300026121 Bacteria 30126
222 Ga0207683_10040772 3300026121 Bacteria 4053
223 Ga0207428_10122079 3300027907 Bacteria 1997
224 Ga0268266_10054671 3300028379 Bacteria 3431
225 Ga0268266_10065163 3300028379 Bacteria 3149
226 Ga0268266_10070444 3300028379 Bacteria 3030
227 Ga0268265_10030520 3300028380 Bacteria 3883
228 Ga0268264_10006544 3300028381 Bacteria 9811
229 Ga0268264_10229984 3300028381 Bacteria 1712
230 Ga0265327_10000064 3300031251 Bacteria 231983
231 Ga0265327_10003779 3300031251 Bacteria 14046
232 Ga0307413_10023442 3300031824 Bacteria 3345
233 Ga0307410_10079613 3300031852 Bacteria 2296
234 Ga0307410_10234394 3300031852 Bacteria 1419
235 Ga0307406_10000108 3300031901 Bacteria 48095
236 Ga0307406_10001311 3300031901 Bacteria 13964
237 Ga0307409_100003304 3300031995 Bacteria 8718
238 Ga0307416_100042717 3300032002 Bacteria 3542
239 Ga0307414_10014198 3300032004 Bacteria 4765
240 Ga0307415_100087470 3300032126 Bacteria 2245
241 Ga0373941_0042253 3300035115 Bacteria 1415
242 Ga0436365_0159915 3300039437 Bacteria 3972
243 Ga0439465_0018477 3300041413 Bacteria 2179
244 Ga0439465_0019357 3300041413 Bacteria 2128
245 Ga0466965_0020461 3300044683 Bacteria 3181
246 Ga0466966_0229080 3300044684 Bacteria 1121
247 Ga0466964_0131066 3300044706 Bacteria 1142
248 Ga0466968_0031876 3300044735 Bacteria 2189
249 Ga0466970_0042944 3300044765 Bacteria 2405
250 Ga0466959_0032131 3300045049 Bacteria 3885
251 Ga0466967_0081877 3300045976 Bacteria 2916
252 Ga0466967_0228134 3300045976 Bacteria 1772
253 Ga0466967_0822270 3300045976 Bacteria 923
254 Ga0495638_0005552 3300046460 Bacteria 9340
255 Ga0495638_0005727 3300046460 Bacteria 9156
256 Ga0495625_0189435 3300046660 Bacteria 1363
257 Ga0495686_0002817 3300047472 Bacteria 15762
258 Ga0495626_0016792 3300048091 Bacteria 3710
259 Ga0496100_0000112 3300048903 Bacteria 46798
260 Ga0496100_0000113 3300048903 Bacteria 46589
261 Ga0496100_0117578 3300048903 Bacteria 1856
262 Ga0496100_0124846 3300048903 Bacteria 1805
263 Ga0496101_0000363 3300048904 Bacteria 30086
264 Ga0496101_0007065 3300048904 Bacteria 7258
265 Ga0496101_0013621 3300048904 Bacteria 5454
266 Ga0496101_0050509 3300048904 Bacteria 2994
267 Ga0496101_0052873 3300048904 Bacteria 2929
268 Ga0496101_0127932 3300048904 Bacteria 1926
269 Ga0496102_0001772 3300048905 Bacteria 18740
270 Ga0496102_0148688 3300048905 Bacteria 2200
271 Ga0496102_0262700 3300048905 Bacteria 1628
272 Ga0496103_0000655 3300048906 Bacteria 26183
273 Ga0496103_0002042 3300048906 Bacteria 12949
274 Ga0496103_0110504 3300048906 Bacteria 1746
275 Ga0496104_0009236 3300048907 Bacteria 8767
276 Ga0496104_0413922 3300048907 Bacteria 1260
277 Ga0496105_0028824 3300048908 Bacteria 4542
278 Ga0496106_0001238 3300048909 Bacteria 19114
279 Ga0496106_0004314 3300048909 Bacteria 10563
280 Ga0496106_0009454 3300048909 Bacteria 7207
281 Ga0496106_0091212 3300048909 Bacteria 2352
282 Ga0496107_0000416 3300048910 Bacteria 23152
283 Ga0496107_0001998 3300048910 Bacteria 13000
284 Ga0496107_0003597 3300048910 Bacteria 10394
285 Ga0496108_0004118 3300048911 Bacteria 11683
286 Ga0496108_0079797 3300048911 Bacteria 2771
287 Ga0496109_0000108 3300048912 Bacteria 86134
288 Ga0496109_0039287 3300048912 Bacteria 4283
289 Ga0496110_0000809 3300048913 Bacteria 21908
290 Ga0496111_0016455 3300048914 Bacteria 5095
291 Ga0496113_0320199 3300048916 Bacteria 1243
292 Ga0496114_0000479 3300048917 Bacteria 29293
293 Ga0496114_0001440 3300048917 Bacteria 18045
294 Ga0496114_0017129 3300048917 Bacteria 5843
295 Ga0496114_0057644 3300048917 Bacteria 3243
296 Ga0496115_0005106 3300048918 Bacteria 9543
297 Ga0496115_0005933 3300048918 Bacteria 8913
298 Ga0496115_0082503 3300048918 Bacteria 2619
299 Ga0496116_0001885 3300048919 Bacteria 22650
300 Ga0496117_0000128 3300048920 Bacteria 166039
301 Ga0496118_0005778 3300048921 Bacteria 13894
302 Ga0496119_0082147 3300048922 Bacteria 1853
303 Ga0496121_0000014 3300048924 Bacteria 609379
304 Ga0496122_0000132 3300048925 Bacteria 172228
305 Ga0496122_0011612 3300048925 Bacteria 8891
306 Ga0496123_0005562 3300048926 Bacteria 12619
307 Ga0496123_0015891 3300048926 Bacteria 6143
308 Ga0496124_0000106 3300048927 Bacteria 172511
309 Ga0496125_0000014 3300048928 Bacteria 610124
310 Ga0496125_0000061 3300048928 Bacteria 262739
311 Ga0496126_0000017 3300048929 Bacteria 610676
312 Ga0496126_0264700 3300048929 Bacteria 1429
313 Ga0496126_0394245 3300048929 Bacteria 1124
314 Ga0501034_0376033 3300049571 Bacteria 1346
315 Ga0501080_0236051 3300049742 Bacteria 1670
316 nmdc:mga03n38_11379_c1 3300050490 Bacteria 3313
317 nmdc:mga00v17_150271_c1 3300050491 Bacteria 1496
318 nmdc:mga00v17_238636_c1 3300050491 Bacteria 1178
319 nmdc:mga00v17_26478_c1 3300050491 Bacteria 3380
320 nmdc:mga0yw44_5517_c1 3300050492 Bacteria 5991
321 nmdc:mga0yw44_7521_c1 3300050492 Bacteria 5366
322 nmdc:mga06z11_27798_c1 3300050494 Bacteria 2707
323 nmdc:mga07m45_139247_c1 3300050496 Bacteria 1405
324 nmdc:mga05p37_137317_c1 3300050507 Bacteria 2997
325 nmdc:mga0qj67_77283_c1 3300050509 Bacteria 2663
326 nmdc:mga0sz30_125453_c1 3300050516 Bacteria 1129
327 nmdc:mga0sz30_3499_c1 3300050516 Bacteria 5656
328 nmdc:mga0sz30_78887_c1 3300050516 Bacteria 1423
329 Ga0500610_0014276 3300053079 Bacteria 3722
330 Ga0500635_0102629 3300053080 Bacteria 1054
331 Ga0500652_000242 3300053131 Bacteria 20566
332 Ga0500559_0034773 3300053136 Bacteria 2174
333 Ga0500616_0000021 3300053153 Bacteria 484527
334 Ga0500627_0008868 3300053158 Bacteria 3594
335 Ga0500645_005651 3300053730 Bacteria 4568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027907 Ga0207428_10122079 Ga0207428_101220792 243
2 3300013105 Ga0157369_10004087 Ga0157369_100040872 244
3 3300014325 Ga0163163_10635176 Ga0163163_106351761 257
4 3300031251 Ga0265327_10003779 Ga0265327_100037793 258
5 3300045976 Ga0466967_0228134 Ga0466967_0228134_814_1590 258
6 3300048903 Ga0496100_0000112 Ga0496100_0000112_35011_35787 258
7 3300048904 Ga0496101_0007065 Ga0496101_0007065_4427_5203 258
8 3300048906 Ga0496103_0000655 Ga0496103_0000655_25129_25905 258
9 3300048909 Ga0496106_0004314 Ga0496106_0004314_1509_2285 258
10 3300048910 Ga0496107_0000416 Ga0496107_0000416_15171_15947 258
11 3300048911 Ga0496108_0004118 Ga0496108_0004118_684_1460 258
12 3300048912 Ga0496109_0000108 Ga0496109_0000108_19920_20696 258
13 3300048913 Ga0496110_0000809 Ga0496110_0000809_14913_15689 258
14 3300048914 Ga0496111_0016455 Ga0496111_0016455_838_1614 258
15 3300048916 Ga0496113_0320199 Ga0496113_0320199_174_950 258
16 3300048917 Ga0496114_0000479 Ga0496114_0000479_2005_2781 258
17 3300048918 Ga0496115_0082503 Ga0496115_0082503_1366_2142 258
18 3300048919 Ga0496116_0001885 Ga0496116_0001885_18445_19221 258
19 3300048921 Ga0496118_0005778 Ga0496118_0005778_3602_4378 258
20 3300048922 Ga0496119_0082147 Ga0496119_0082147_623_1399 258
21 3300048924 Ga0496121_0000014 Ga0496121_0000014_472238_473014 258
22 3300048925 Ga0496122_0000132 Ga0496122_0000132_35099_35875 258
23 3300048926 Ga0496123_0015891 Ga0496123_0015891_3874_4650 258
24 3300048927 Ga0496124_0000106 Ga0496124_0000106_136366_137142 258
25 3300048928 Ga0496125_0000014 Ga0496125_0000014_472238_473014 258
26 3300048929 Ga0496126_0000017 Ga0496126_0000017_137663_138439 258
27 iso_pu_bacteria 2643221635 2644199258 258
28 iso_pu_bacteria 2808606447 2809227368 260
29 iso_pu_bacteria 2852632344 2852633254 260
30 iso_pu_bacteria 8056037122 8056037483 260
31 3300053131 Ga0500652_000242 Ga0500652_000242_9816_10607 261
32 iso_pu_bacteria 2857729791 2857732630 261
33 iso_pu_bacteria 2928121344 2928122971 261
34 3300048920 Ga0496117_0000128 Ga0496117_0000128_105246_106115 262
35 3300048925 Ga0496122_0011612 Ga0496122_0011612_3653_4537 262
36 3300048926 Ga0496123_0005562 Ga0496123_0005562_6820_7704 262
37 3300053153 Ga0500616_0000021 Ga0500616_0000021_347353_348207 262
38 3300053730 Ga0500645_005651 Ga0500645_005651_104_1018 262
39 iso_pu_bacteria 2643221724 2644680164 262
40 iso_pu_bacteria 2728369380 2730229614 262
41 iso_pu_bacteria 2808606306 2808631284 262
42 iso_pu_bacteria 2946080515 2946080976 262
43 iso_pu_bacteria 8057345674 8057348755 262
44 3300005338 Ga0068868_100152439 Ga0068868_1001524392 263
45 iso_pu_bacteria 2643221546 2643752033 264
46 iso_pu_bacteria 2738541264 2738668724 264
47 iso_pu_bacteria 2738541356 2739147916 264
48 3300006186 Ga0075369_10093183 Ga0075369_100931832 265
49 3300031852 Ga0307410_10234394 Ga0307410_102343942 265
50 3300031901 Ga0307406_10000108 Ga0307406_1000010829 265
51 3300031901 Ga0307406_10001311 Ga0307406_1000131116 265
52 3300032004 Ga0307414_10014198 Ga0307414_100141982 265
53 3300044683 Ga0466965_0020461 Ga0466965_0020461_506_1366 265
54 3300048905 Ga0496102_0262700 Ga0496102_0262700_672_1469 265
55 3300048906 Ga0496103_0110504 Ga0496103_0110504_367_1164 265
56 3300048928 Ga0496125_0000061 Ga0496125_0000061_72634_73488 265
57 3300050491 nmdc:mga00v17_150271_c1 nmdc:mga00v17_150271_c1_373_1170 265
58 3300050496 nmdc:mga07m45_139247_c1 nmdc:mga07m45_139247_c1_446_1243 265
59 iso_pu_bacteria 2738543034 2739361887 267
60 3300003792 Ga0055540_1000085 Ga0055540_100008560 268
61 3300005367 Ga0070667_100003101 Ga0070667_10000310111 268
62 3300009545 Ga0105237_10055914 Ga0105237_100559142 268
63 3300010375 Ga0105239_10196739 Ga0105239_101967392 268
64 3300025303 Ga0209051_1000200 Ga0209051_100020039 268
65 3300025914 Ga0207671_10060388 Ga0207671_100603883 268
66 3300025986 Ga0207658_10004172 Ga0207658_100041722 268
67 3300050491 nmdc:mga00v17_238636_c1 nmdc:mga00v17_238636_c1_339_1145 268
68 iso_pu_bacteria 2929212328 2929215370 268
69 3300006051 Ga0075364_10009595 Ga0075364_100095952 269
70 3300031251 Ga0265327_10000064 Ga0265327_1000006432 269
71 3300039437 Ga0436365_0159915 Ga0436365_0159915_3091_3906 269
72 iso_pu_bacteria 2902799365 2902801174 269
73 3300003792 Ga0055540_1002510 Ga0055540_10025107 270
74 3300005347 Ga0070668_100005630 Ga0070668_1000056305 270
75 3300005356 Ga0070674_100261233 Ga0070674_1002612332 270
76 3300005439 Ga0070711_100220417 Ga0070711_1002204172 270
77 3300005456 Ga0070678_100100715 Ga0070678_1001007152 270
78 3300005718 Ga0068866_10069347 Ga0068866_100693472 270
79 3300005842 Ga0068858_100251469 Ga0068858_1002514692 270
80 3300006038 Ga0075365_10104633 Ga0075365_101046332 270
81 3300006186 Ga0075369_10053516 Ga0075369_100535163 270
82 3300009101 Ga0105247_10417153 Ga0105247_104171531 270
83 3300009176 Ga0105242_10212721 Ga0105242_102127212 270
84 3300009177 Ga0105248_10006143 Ga0105248_100061436 270
85 3300009177 Ga0105248_10406273 Ga0105248_104062732 270
86 3300025303 Ga0209051_1005255 Ga0209051_10052556 270
87 3300025934 Ga0207686_10160420 Ga0207686_101604201 270
88 3300025941 Ga0207711_10273775 Ga0207711_102737752 270
89 3300045976 Ga0466967_0081877 Ga0466967_0081877_1693_2517 270
90 3300046460 Ga0495638_0005727 Ga0495638_0005727_6615_7430 270
91 3300046660 Ga0495625_0189435 Ga0495625_0189435_32_847 270
92 3300047472 Ga0495686_0002817 Ga0495686_0002817_11459_12274 270
93 3300048091 Ga0495626_0016792 Ga0495626_0016792_1255_2070 270
94 3300048903 Ga0496100_0000113 Ga0496100_0000113_11534_12349 270
95 3300048903 Ga0496100_0117578 Ga0496100_0117578_923_1738 270
96 3300048904 Ga0496101_0000363 Ga0496101_0000363_3770_4585 270
97 3300048904 Ga0496101_0052873 Ga0496101_0052873_1464_2279 270
98 3300048905 Ga0496102_0148688 Ga0496102_0148688_518_1333 270
99 3300048907 Ga0496104_0413922 Ga0496104_0413922_309_1124 270
100 3300048908 Ga0496105_0028824 Ga0496105_0028824_1632_2447 270
101 3300048909 Ga0496106_0009454 Ga0496106_0009454_2688_3503 270
102 3300048910 Ga0496107_0003597 Ga0496107_0003597_81_896 270
103 3300048917 Ga0496114_0017129 Ga0496114_0017129_4970_5785 270
104 3300048918 Ga0496115_0005106 Ga0496115_0005106_7394_8209 270
105 3300050516 nmdc:mga0sz30_78887_c1 nmdc:mga0sz30_78887_c1_94_909 270
106 3300053079 Ga0500610_0014276 Ga0500610_0014276_1260_2075 270
107 3300006186 Ga0075369_10000172 Ga0075369_100001729 271
108 3300025303 Ga0209051_1045488 Ga0209051_10454882 271
109 3300050492 nmdc:mga0yw44_5517_c1 nmdc:mga0yw44_5517_c1_2225_3046 271
110 3300050516 nmdc:mga0sz30_3499_c1 nmdc:mga0sz30_3499_c1_1509_2327 271
111 3300002075 JGI24738J21930_10010786 JGI24738J21930_100107862 272
112 3300002077 JGI24744J21845_10002947 JGI24744J21845_100029476 272
113 3300002459 JGI24751J29686_10010810 JGI24751J29686_100108102 272
114 3300003320 rootH2_10009987 rootH2_100099872 272
115 3300005328 Ga0070676_10045159 Ga0070676_100451592 272
116 3300005330 Ga0070690_100007352 Ga0070690_1000073529 272
117 3300005331 Ga0070670_100087178 Ga0070670_1000871782 272
118 3300005335 Ga0070666_10173964 Ga0070666_101739642 272
119 3300005337 Ga0070682_100045376 Ga0070682_1000453762 272
120 3300005337 Ga0070682_100240528 Ga0070682_1002405282 272
121 3300005338 Ga0068868_100027771 Ga0068868_1000277714 272
122 3300005339 Ga0070660_100207981 Ga0070660_1002079812 272
123 3300005340 Ga0070689_100020537 Ga0070689_1000205374 272
124 3300005341 Ga0070691_10004402 Ga0070691_100044024 272
125 3300005347 Ga0070668_100008044 Ga0070668_1000080445 272
126 3300005354 Ga0070675_100074923 Ga0070675_1000749232 272
127 3300005355 Ga0070671_100095958 Ga0070671_1000959584 272
128 3300005356 Ga0070674_100074143 Ga0070674_1000741432 272
129 3300005364 Ga0070673_100111011 Ga0070673_1001110112 272
130 3300005365 Ga0070688_100009160 Ga0070688_1000091608 272
131 3300005365 Ga0070688_100054753 Ga0070688_1000547533 272
132 3300005366 Ga0070659_100024423 Ga0070659_1000244235 272
133 3300005367 Ga0070667_100036224 Ga0070667_1000362242 272
134 3300005367 Ga0070667_100252303 Ga0070667_1002523032 272
135 3300005406 Ga0070703_10018509 Ga0070703_100185092 272
136 3300005434 Ga0070709_10090730 Ga0070709_100907304 272
137 3300005436 Ga0070713_100483450 Ga0070713_1004834501 272
138 3300005437 Ga0070710_10005001 Ga0070710_100050017 272
139 3300005437 Ga0070710_10039385 Ga0070710_100393854 272
140 3300005438 Ga0070701_10000289 Ga0070701_100002892 272
141 3300005438 Ga0070701_10028389 Ga0070701_100283894 272
142 3300005439 Ga0070711_100007011 Ga0070711_10000701110 272
143 3300005439 Ga0070711_100038954 Ga0070711_1000389543 272
144 3300005440 Ga0070705_100184082 Ga0070705_1001840821 272
145 3300005441 Ga0070700_100008117 Ga0070700_1000081176 272
146 3300005444 Ga0070694_100011872 Ga0070694_1000118724 272
147 3300005444 Ga0070694_100195555 Ga0070694_1001955552 272
148 3300005455 Ga0070663_100051951 Ga0070663_1000519512 272
149 3300005456 Ga0070678_100002192 Ga0070678_1000021927 272
150 3300005456 Ga0070678_100054768 Ga0070678_1000547682 272
151 3300005457 Ga0070662_100024655 Ga0070662_1000246552 272
152 3300005459 Ga0068867_100014699 Ga0068867_1000146993 272
153 3300005466 Ga0070685_10057428 Ga0070685_100574282 272
154 3300005530 Ga0070679_100296106 Ga0070679_1002961063 272
155 3300005539 Ga0068853_100043747 Ga0068853_1000437477 272
156 3300005543 Ga0070672_100089070 Ga0070672_1000890702 272
157 3300005543 Ga0070672_100320226 Ga0070672_1003202262 272
158 3300005544 Ga0070686_100222789 Ga0070686_1002227893 272
159 3300005545 Ga0070695_100030975 Ga0070695_1000309752 272
160 3300005546 Ga0070696_100002944 Ga0070696_1000029445 272
161 3300005547 Ga0070693_100018808 Ga0070693_1000188087 272
162 3300005547 Ga0070693_100123386 Ga0070693_1001233861 272
163 3300005548 Ga0070665_100181309 Ga0070665_1001813093 272
164 3300005549 Ga0070704_100011461 Ga0070704_1000114615 272
165 3300005563 Ga0068855_100201471 Ga0068855_1002014715 272
166 3300005563 Ga0068855_100216859 Ga0068855_1002168592 272
167 3300005578 Ga0068854_100007208 Ga0068854_10000720810 272
168 3300005578 Ga0068854_100060951 Ga0068854_1000609512 272
169 3300005615 Ga0070702_100003499 Ga0070702_1000034992 272
170 3300005616 Ga0068852_100061892 Ga0068852_1000618922 272
171 3300005617 Ga0068859_100580211 Ga0068859_1005802112 272
172 3300005718 Ga0068866_10003288 Ga0068866_100032887 272
173 3300005719 Ga0068861_100038366 Ga0068861_1000383667 272
174 3300005841 Ga0068863_100075758 Ga0068863_1000757582 272
175 3300005841 Ga0068863_100471321 Ga0068863_1004713212 272
176 3300005842 Ga0068858_100008460 Ga0068858_1000084608 272
177 3300005842 Ga0068858_100069185 Ga0068858_1000691852 272
178 3300005843 Ga0068860_100014636 Ga0068860_1000146362 272
179 3300005844 Ga0068862_100022260 Ga0068862_1000222602 272
180 3300005844 Ga0068862_100133783 Ga0068862_1001337833 272
181 3300005844 Ga0068862_100156412 Ga0068862_1001564122 272
182 3300006038 Ga0075365_10016073 Ga0075365_100160732 272
183 3300006038 Ga0075365_10043678 Ga0075365_100436783 272
184 3300006048 Ga0075363_100000754 Ga0075363_1000007548 272
185 3300006051 Ga0075364_10013184 Ga0075364_100131842 272
186 3300006051 Ga0075364_10016075 Ga0075364_100160752 272
187 3300006163 Ga0070715_10015979 Ga0070715_100159794 272
188 3300006163 Ga0070715_10083333 Ga0070715_100833333 272
189 3300006173 Ga0070716_100053436 Ga0070716_1000534362 272
190 3300006173 Ga0070716_100403970 Ga0070716_1004039701 272
191 3300006175 Ga0070712_100001454 Ga0070712_1000014545 272
192 3300006175 Ga0070712_100014685 Ga0070712_1000146852 272
193 3300006177 Ga0075362_10100010 Ga0075362_101000102 272
194 3300006178 Ga0075367_10001275 Ga0075367_100012759 272
195 3300006186 Ga0075369_10009081 Ga0075369_100090812 272
196 3300006237 Ga0097621_100054440 Ga0097621_1000544402 272
197 3300006237 Ga0097621_100135226 Ga0097621_1001352262 272
198 3300006353 Ga0075370_10050664 Ga0075370_100506644 272
199 3300006358 Ga0068871_100267391 Ga0068871_1002673912 272
200 3300006844 Ga0075428_100036841 Ga0075428_1000368414 272
201 3300006846 Ga0075430_100127827 Ga0075430_1001278272 272
202 3300006847 Ga0075431_100006241 Ga0075431_1000062412 272
203 3300006871 Ga0075434_100473939 Ga0075434_1004739392 272
204 3300006881 Ga0068865_100007499 Ga0068865_1000074995 272
205 3300006931 Ga0097620_100580194 Ga0097620_1005801942 272
206 3300009092 Ga0105250_10101882 Ga0105250_101018822 272
207 3300009094 Ga0111539_10790227 Ga0111539_107902271 272
208 3300009098 Ga0105245_10039925 Ga0105245_100399252 272
209 3300009101 Ga0105247_10001080 Ga0105247_1000108017 272
210 3300009101 Ga0105247_10086390 Ga0105247_100863902 272
211 3300009147 Ga0114129_10010121 Ga0114129_100101212 272
212 3300009148 Ga0105243_10007234 Ga0105243_100072342 272
213 3300009148 Ga0105243_10181180 Ga0105243_101811802 272
214 3300009174 Ga0105241_10013375 Ga0105241_100133753 272
215 3300009176 Ga0105242_10002833 Ga0105242_100028335 272
216 3300009176 Ga0105242_10093956 Ga0105242_100939563 272
217 3300009177 Ga0105248_10054216 Ga0105248_100542162 272
218 3300009545 Ga0105237_10050956 Ga0105237_100509562 272
219 3300009545 Ga0105237_10096547 Ga0105237_100965472 272
220 3300009553 Ga0105249_10003482 Ga0105249_100034822 272
221 3300010159 Ga0099796_10056917 Ga0099796_100569173 272
222 3300010375 Ga0105239_10037819 Ga0105239_100378193 272
223 3300010375 Ga0105239_10131076 Ga0105239_101310762 272
224 3300013297 Ga0157378_10005601 Ga0157378_100056013 272
225 3300013297 Ga0157378_10074453 Ga0157378_100744532 272
226 3300013306 Ga0163162_10144824 Ga0163162_101448242 272
227 3300013306 Ga0163162_10186725 Ga0163162_101867253 272
228 3300013307 Ga0157372_10047808 Ga0157372_100478082 272
229 3300013308 Ga0157375_10029177 Ga0157375_100291772 272
230 3300013308 Ga0157375_10540267 Ga0157375_105402671 272
231 3300014325 Ga0163163_10026051 Ga0163163_100260513 272
232 3300014326 Ga0157380_10002499 Ga0157380_100024997 272
233 3300014745 Ga0157377_10272685 Ga0157377_102726851 272
234 3300014968 Ga0157379_10179580 Ga0157379_101795801 272
235 3300014969 Ga0157376_10226470 Ga0157376_102264702 272
236 3300017792 Ga0163161_10004733 Ga0163161_100047337 272
237 3300017792 Ga0163161_10053528 Ga0163161_100535283 272
238 3300025898 Ga0207692_10037606 Ga0207692_100376062 272
239 3300025899 Ga0207642_10001595 Ga0207642_100015955 272
240 3300025900 Ga0207710_10010057 Ga0207710_100100576 272
241 3300025901 Ga0207688_10002319 Ga0207688_100023197 272
242 3300025901 Ga0207688_10009870 Ga0207688_100098707 272
243 3300025905 Ga0207685_10126504 Ga0207685_101265042 272
244 3300025906 Ga0207699_10231092 Ga0207699_102310922 272
245 3300025907 Ga0207645_10045619 Ga0207645_100456192 272
246 3300025907 Ga0207645_10125459 Ga0207645_101254592 272
247 3300025908 Ga0207643_10018640 Ga0207643_100186402 272
248 3300025911 Ga0207654_10038840 Ga0207654_100388404 272
249 3300025914 Ga0207671_10193585 Ga0207671_101935852 272
250 3300025914 Ga0207671_10520923 Ga0207671_105209232 272
251 3300025915 Ga0207693_10000595 Ga0207693_1000059528 272
252 3300025915 Ga0207693_10003715 Ga0207693_100037153 272
253 3300025916 Ga0207663_10007693 Ga0207663_100076933 272
254 3300025917 Ga0207660_10572906 Ga0207660_105729061 272
255 3300025921 Ga0207652_10286627 Ga0207652_102866273 272
256 3300025923 Ga0207681_10022240 Ga0207681_100222402 272
257 3300025925 Ga0207650_10051915 Ga0207650_100519152 272
258 3300025927 Ga0207687_10001438 Ga0207687_100014385 272
259 3300025931 Ga0207644_10007788 Ga0207644_100077882 272
260 3300025931 Ga0207644_10098887 Ga0207644_100988873 272
261 3300025932 Ga0207690_10075511 Ga0207690_100755112 272
262 3300025932 Ga0207690_10087216 Ga0207690_100872162 272
263 3300025933 Ga0207706_10016116 Ga0207706_100161164 272
264 3300025933 Ga0207706_10146710 Ga0207706_101467102 272
265 3300025934 Ga0207686_10030811 Ga0207686_100308112 272
266 3300025935 Ga0207709_10012153 Ga0207709_100121537 272
267 3300025937 Ga0207669_10004071 Ga0207669_100040715 272
268 3300025938 Ga0207704_10001082 Ga0207704_1000108211 272
269 3300025939 Ga0207665_10004624 Ga0207665_100046246 272
270 3300025939 Ga0207665_10005140 Ga0207665_100051402 272
271 3300025939 Ga0207665_10139140 Ga0207665_101391403 272
272 3300025940 Ga0207691_10063190 Ga0207691_100631902 272
273 3300025940 Ga0207691_10207360 Ga0207691_102073603 272
274 3300025941 Ga0207711_10317308 Ga0207711_103173082 272
275 3300025941 Ga0207711_10439897 Ga0207711_104398972 272
276 3300025942 Ga0207689_10030688 Ga0207689_100306882 272
277 3300025949 Ga0207667_10064700 Ga0207667_100647005 272
278 3300025949 Ga0207667_10106711 Ga0207667_101067113 272
279 3300025960 Ga0207651_10136961 Ga0207651_101369612 272
280 3300025961 Ga0207712_10272915 Ga0207712_102729152 272
281 3300025972 Ga0207668_10018781 Ga0207668_100187811 272
282 3300025981 Ga0207640_10126268 Ga0207640_101262682 272
283 3300025986 Ga0207658_10020291 Ga0207658_100202914 272
284 3300025986 Ga0207658_10088892 Ga0207658_100888922 272
285 3300025986 Ga0207658_10423342 Ga0207658_104233422 272
286 3300026023 Ga0207677_10016208 Ga0207677_100162083 272
287 3300026023 Ga0207677_10068928 Ga0207677_100689282 272
288 3300026035 Ga0207703_10010641 Ga0207703_100106412 272
289 3300026041 Ga0207639_10068001 Ga0207639_100680012 272
290 3300026067 Ga0207678_10045165 Ga0207678_100451652 272
291 3300026067 Ga0207678_10068691 Ga0207678_100686912 272
292 3300026075 Ga0207708_10017067 Ga0207708_100170672 272
293 3300026075 Ga0207708_10036820 Ga0207708_100368203 272
294 3300026088 Ga0207641_10017955 Ga0207641_100179552 272
295 3300026089 Ga0207648_10001778 Ga0207648_100017786 272
296 3300026089 Ga0207648_10004766 Ga0207648_1000476618 272
297 3300026095 Ga0207676_10184178 Ga0207676_101841782 272
298 3300026118 Ga0207675_100014142 Ga0207675_1000141423 272
299 3300026118 Ga0207675_100062981 Ga0207675_1000629812 272
300 3300026118 Ga0207675_100260760 Ga0207675_1002607602 272
301 3300026121 Ga0207683_10000716 Ga0207683_1000071627 272
302 3300026121 Ga0207683_10040772 Ga0207683_100407723 272
303 3300028379 Ga0268266_10054671 Ga0268266_100546712 272
304 3300028379 Ga0268266_10065163 Ga0268266_100651632 272
305 3300028379 Ga0268266_10070444 Ga0268266_100704442 272
306 3300028380 Ga0268265_10030520 Ga0268265_100305202 272
307 3300028381 Ga0268264_10006544 Ga0268264_100065442 272
308 3300028381 Ga0268264_10229984 Ga0268264_102299842 272
309 3300031824 Ga0307413_10023442 Ga0307413_100234422 272
310 3300031852 Ga0307410_10079613 Ga0307410_100796132 272
311 3300031995 Ga0307409_100003304 Ga0307409_1000033043 272
312 3300032002 Ga0307416_100042717 Ga0307416_1000427172 272
313 3300032126 Ga0307415_100087470 Ga0307415_1000874702 272
314 3300035115 Ga0373941_0042253 Ga0373941_0042253_220_1038 272
315 3300041413 Ga0439465_0018477 Ga0439465_0018477_909_1727 272
316 3300041413 Ga0439465_0019357 Ga0439465_0019357_56_877 272
317 3300044684 Ga0466966_0229080 Ga0466966_0229080_250_1071 272
318 3300044706 Ga0466964_0131066 Ga0466964_0131066_72_890 272
319 3300044735 Ga0466968_0031876 Ga0466968_0031876_477_1295 272
320 3300044765 Ga0466970_0042944 Ga0466970_0042944_385_1203 272
321 3300045049 Ga0466959_0032131 Ga0466959_0032131_1553_2371 272
322 3300045976 Ga0466967_0822270 Ga0466967_0822270_23_847 272
323 3300046460 Ga0495638_0005552 Ga0495638_0005552_1708_2532 272
324 3300048903 Ga0496100_0124846 Ga0496100_0124846_334_1152 272
325 3300048904 Ga0496101_0013621 Ga0496101_0013621_1902_2720 272
326 3300048904 Ga0496101_0050509 Ga0496101_0050509_1083_1901 272
327 3300048904 Ga0496101_0127932 Ga0496101_0127932_809_1627 272
328 3300048905 Ga0496102_0001772 Ga0496102_0001772_13186_14004 272
329 3300048906 Ga0496103_0002042 Ga0496103_0002042_6802_7620 272
330 3300048907 Ga0496104_0009236 Ga0496104_0009236_2524_3342 272
331 3300048909 Ga0496106_0001238 Ga0496106_0001238_216_1034 272
332 3300048909 Ga0496106_0091212 Ga0496106_0091212_1283_2101 272
333 3300048910 Ga0496107_0001998 Ga0496107_0001998_6152_6970 272
334 3300048911 Ga0496108_0079797 Ga0496108_0079797_459_1277 272
335 3300048912 Ga0496109_0039287 Ga0496109_0039287_1719_2537 272
336 3300048917 Ga0496114_0001440 Ga0496114_0001440_3013_3831 272
337 3300048917 Ga0496114_0057644 Ga0496114_0057644_646_1464 272
338 3300048918 Ga0496115_0005933 Ga0496115_0005933_2218_3036 272
339 3300048929 Ga0496126_0264700 Ga0496126_0264700_237_1061 272
340 3300048929 Ga0496126_0394245 Ga0496126_0394245_47_874 272
341 3300049571 Ga0501034_0376033 Ga0501034_0376033_205_1023 272
342 3300049742 Ga0501080_0236051 Ga0501080_0236051_799_1617 272
343 3300050490 nmdc:mga03n38_11379_c1 nmdc:mga03n38_11379_c1_320_1138 272
344 3300050491 nmdc:mga00v17_26478_c1 nmdc:mga00v17_26478_c1_296_1114 272
345 3300050492 nmdc:mga0yw44_7521_c1 nmdc:mga0yw44_7521_c1_2591_3409 272
346 3300050494 nmdc:mga06z11_27798_c1 nmdc:mga06z11_27798_c1_642_1460 272
347 3300050507 nmdc:mga05p37_137317_c1 nmdc:mga05p37_137317_c1_1250_2068 272
348 3300050509 nmdc:mga0qj67_77283_c1 nmdc:mga0qj67_77283_c1_1206_2024 272
349 3300050516 nmdc:mga0sz30_125453_c1 nmdc:mga0sz30_125453_c1_294_1118 272
350 3300053080 Ga0500635_0102629 Ga0500635_0102629_211_1035 272
351 3300053136 Ga0500559_0034773 Ga0500559_0034773_1299_2129 272
352 3300053158 Ga0500627_0008868 Ga0500627_0008868_1518_2342 272
353 iso_pu_bacteria 2738541274 2738705083 272
354 iso_pu_bacteria 2738543028 2739332780 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

38

291

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v75-assembly1.cif.gz_A-2 crystal structure of putative orotidine 5'-phosphate decarboxylase from streptomyces avermitilis ma-4680 0.9299 1 268
3v75-assembly1.cif.gz_A-2 crystal structure of putative orotidine 5'-phosphate decarboxylase from streptomyces avermitilis ma-4680 0.9134 1 268
3r89-assembly1.cif.gz_B crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548 0.829 7 268
4luj-assembly1.cif.gz_B crystal structure of orotidine 5'-monophosphate decarboxylase from methanocaldococcus jannaschii complexed with inhibitor bmp 0.8196 17 268
3qw3-assembly1.cif.gz_A structure of leishmania donovani omp decarboxylase 0.808 3 268
ID Description Score Start End Superfamily
af_P9WIU3_3_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9724 3 272 3.20.20.70
af_P9WIU3_3_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9688 3 272 3.20.20.70
af_I1N8M8_265_595_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8279 71 94 3.20.20.80
3r89B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8061 7 268 3.20.20.70
af_Q8TE54_421_645_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7947 57 93 3.30.750.24
ID Description Score Start End GO Terms
AF-X8BDR0-F1-model_v4 deleted 0.9905 1 92
AF-X8B4X8-F1-model_v4 deleted 0.9804 122 271
AF-A0A117JKH8-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9741 1 272 GO:0004590
GO:0006207
GO:0044205
AF-A0A1A3H8R0-F1-model_v4 Orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) 0.9725 13 272 GO:0004590
GO:0006207
GO:0044205
AF-P9WIU2-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase) 0.9724 1 271 GO:0004590
GO:0006207
GO:0044205

Feature Viewer

pLDDT pTM Quality
91.85 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map