F419909

General Info

Members Datasets Scaffolds Average Seq Length
354 216 708 397

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0029329|Ga0501034_0029329_1089_2498
Length 451
Sequence MAAIYGEKNGCWSTKQNMPMVCRRLENGKNRRNNKKLSTAAIPVKLYRIFAGFQISNFKSSMPSSKKAALGFIFITLLVDTIGFGIIIPVMPKLIEQLIHGNLSDASRWGGWLTFAFAIMQFLCAPILGNLSDRYGRRPVLLFSLFGFGLDYLLLTVAPNISWLFIGRIIAGITGASFTTAAAYIADISSHEDRAKNFGMIGAAGPRVPFMAAAILTLLNWLYGYFVLPESLSKEQRRSFSWKRANPVGSLLHLRKYPALSGLIISLMLVYIAVHSVQSTWAFFNMEKFGWDEKMVGISLGIVGLLVGLVQGGLIRIVNPRLGNEKSIYVGLALYATGLLLFAFASQSWMMLVFLVPYCLGGIGGPALQAVISNHVPSNEQGELQGALTSMMSATTIIGPPLMTNLFAYFTGKTAPVYFPGAPFLLGAIMMMISTVLVYRMFKAEKADVRR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
123 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
130 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
164 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
169 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
172 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
182 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
183 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
184 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
185 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
186 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
187 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
188 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
191 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
204 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
207 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
208 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
209 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
210 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
211 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
212 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
213 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
214 2738541283 Pedobacter sp. OK701 Isolate Unclassified
215 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
216 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 1.13
Rhizoplane 0.28
Rhizosphere 86.72
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0029329 3300049571 Bacteria 5591
2 JGI24749J21850_1000080 3300002076 Bacteria 17400
3 JGI24751J29686_10000225 3300002459 Bacteria 23753
4 rootL2_10114483 3300003322 Bacteria 2476
5 Ga0065704_10080262 3300005289 Bacteria 3980
6 Ga0065707_10082242 3300005295 Bacteria 18446
7 Ga0070658_10001326 3300005327 Bacteria 21104
8 Ga0070676_10000653 3300005328 Bacteria 16869
9 Ga0070683_100023071 3300005329 Bacteria 5565
10 Ga0070670_100000005 3300005331 Bacteria 351569
11 Ga0070670_100003125 3300005331 Bacteria 13709
12 Ga0070670_100281516 3300005331 Bacteria 1452
13 Ga0070677_10084067 3300005333 Bacteria 1369
14 Ga0068869_100044575 3300005334 Bacteria 3190
15 Ga0068869_100077429 3300005334 Bacteria 2474
16 Ga0070666_10000055 3300005335 Bacteria 92269
17 Ga0070666_10000400 3300005335 Bacteria 27232
18 Ga0070666_10120990 3300005335 Bacteria 1815
19 Ga0070680_100032337 3300005336 Bacteria 4211
20 Ga0070682_100003091 3300005337 Bacteria 9224
21 Ga0068868_100001911 3300005338 Bacteria 14309
22 Ga0068868_100014657 3300005338 Bacteria 5782
23 Ga0068868_100030988 3300005338 Bacteria 4104
24 Ga0068868_100202335 3300005338 Bacteria 1656
25 Ga0070661_100003390 3300005344 Bacteria 10994
26 Ga0070668_100001499 3300005347 Bacteria 16865
27 Ga0070668_100014544 3300005347 Bacteria 5880
28 Ga0070669_100000057 3300005353 Bacteria 110803
29 Ga0070669_100062078 3300005353 Bacteria 2747
30 Ga0070675_100010156 3300005354 Bacteria 7343
31 Ga0070671_100000163 3300005355 Bacteria 43833
32 Ga0070673_100011949 3300005364 Bacteria 5944
33 Ga0070673_100043331 3300005364 Bacteria 3477
34 Ga0070673_100046982 3300005364 Bacteria 3356
35 Ga0070659_100001487 3300005366 Bacteria 16875
36 Ga0070667_100000003 3300005367 Bacteria 447715
37 Ga0070667_100000016 3300005367 Bacteria 237028
38 Ga0070667_100001565 3300005367 Bacteria 20500
39 Ga0070667_100010585 3300005367 Bacteria 7616
40 Ga0070667_100012543 3300005367 Bacteria 7009
41 Ga0070667_100022453 3300005367 Bacteria 5233
42 Ga0070663_100101641 3300005455 Unclassified 2146
43 Ga0070662_100050397 3300005457 Bacteria 3003
44 Ga0070662_100074429 3300005457 Unclassified 2512
45 Ga0068867_100017122 3300005459 Bacteria 5149
46 Ga0068867_100020396 3300005459 Bacteria 4723
47 Ga0070679_100015187 3300005530 Bacteria 7398
48 Ga0070679_100018998 3300005530 Bacteria 6676
49 Ga0070684_100026369 3300005535 Bacteria 4894
50 Ga0068853_100005147 3300005539 Bacteria 10220
51 Ga0068853_100042311 3300005539 Bacteria 3895
52 Ga0070672_100003073 3300005543 Bacteria 10764
53 Ga0070686_100025725 3300005544 Bacteria 3544
54 Ga0070665_100002493 3300005548 Bacteria 20260
55 Ga0070665_100012900 3300005548 Bacteria 8416
56 Ga0068855_100027643 3300005563 Bacteria 6785
57 Ga0068855_100148732 3300005563 Bacteria 2664
58 Ga0070664_100008935 3300005564 Bacteria 8122
59 Ga0070664_100064684 3300005564 Unclassified 3120
60 Ga0068857_100013280 3300005577 Bacteria 7174
61 Ga0068856_100006300 3300005614 Bacteria 11640
62 Ga0068852_100001232 3300005616 Bacteria 17030
63 Ga0068852_100182029 3300005616 Bacteria 1977
64 Ga0068859_100000003 3300005617 Bacteria 479218
65 Ga0068859_100002060 3300005617 Bacteria 20516
66 Ga0068859_100009219 3300005617 Bacteria 9968
67 Ga0068859_100013998 3300005617 Bacteria 8044
68 Ga0068864_100000011 3300005618 Bacteria 350056
69 Ga0068864_100007520 3300005618 Bacteria 8975
70 Ga0068864_100022019 3300005618 Bacteria 5342
71 Ga0068864_100065552 3300005618 Bacteria 3151
72 Ga0068861_100009174 3300005719 Bacteria 6823
73 Ga0068861_100044269 3300005719 Unclassified 3346
74 Ga0068861_100059438 3300005719 Bacteria 2927
75 Ga0068861_100062062 3300005719 Bacteria 2870
76 Ga0068851_10003848 3300005834 Bacteria 6716
77 Ga0068851_10033505 3300005834 Bacteria 2560
78 Ga0068863_100000662 3300005841 Bacteria 34791
79 Ga0068863_100004080 3300005841 Bacteria 14426
80 Ga0068863_100007122 3300005841 Bacteria 10966
81 Ga0068863_100013169 3300005841 Bacteria 7980
82 Ga0068863_100034211 3300005841 Bacteria 4841
83 Ga0068863_100075225 3300005841 Bacteria 3195
84 Ga0068858_100000527 3300005842 Bacteria 40114
85 Ga0068858_100025267 3300005842 Bacteria 5527
86 Ga0068858_100033169 3300005842 Bacteria 4794
87 Ga0068858_100195127 3300005842 Bacteria 1913
88 Ga0068860_100000045 3300005843 Bacteria 223252
89 Ga0068860_100000196 3300005843 Bacteria 97096
90 Ga0068860_100003395 3300005843 Bacteria 16381
91 Ga0068860_100039084 3300005843 Bacteria 4539
92 Ga0068860_100039290 3300005843 Bacteria 4526
93 Ga0068862_100000011 3300005844 Bacteria 270105
94 Ga0068862_100000938 3300005844 Bacteria 28095
95 Ga0068862_100081341 3300005844 Bacteria 2810
96 Ga0068862_100137000 3300005844 Bacteria 2170
97 Ga0097621_100003560 3300006237 Bacteria 10762
98 Ga0097621_100007529 3300006237 Bacteria 7796
99 Ga0097621_100088947 3300006237 Bacteria 2581
100 Ga0068871_100003583 3300006358 Bacteria 10674
101 Ga0068871_100034433 3300006358 Bacteria 4019
102 Ga0068871_100044291 3300006358 Bacteria 3578
103 Ga0075428_100008784 3300006844 Bacteria 11214
104 Ga0075428_100036055 3300006844 Bacteria 5451
105 Ga0075430_100001450 3300006846 Bacteria 19258
106 Ga0075431_100042185 3300006847 Bacteria 4704
107 Ga0068865_100001316 3300006881 Bacteria 14473
108 Ga0097620_100000003 3300006931 Bacteria 479218
109 Ga0097620_100002060 3300006931 Bacteria 20516
110 Ga0097620_100009219 3300006931 Bacteria 9968
111 Ga0097620_100013998 3300006931 Bacteria 8044
112 Ga0099824_1000390 3300006942 Bacteria 49882
113 Ga0099826_10005021 3300006948 Bacteria 9392
114 Ga0105240_10061605 3300009093 Bacteria 4675
115 Ga0111539_10001545 3300009094 Bacteria 30641
116 Ga0111539_10073470 3300009094 Bacteria 4032
117 Ga0105247_10009615 3300009101 Bacteria 5868
118 Ga0105247_10023622 3300009101 Bacteria 3705
119 Ga0105247_10076778 3300009101 Bacteria 2098
120 Ga0105241_10000333 3300009174 Bacteria 35848
121 Ga0105248_10000406 3300009177 Bacteria 49988
122 Ga0105248_10498603 3300009177 Bacteria 1373
123 Ga0105237_10002282 3300009545 Bacteria 23838
124 Ga0105237_10002430 3300009545 Bacteria 23126
125 Ga0105237_10003933 3300009545 Bacteria 17402
126 Ga0105249_10039319 3300009553 Bacteria 4294
127 Ga0105239_10234380 3300010375 Bacteria 2060
128 Ga0105246_10061914 3300011119 Bacteria 2605
129 Ga0157326_1000044 3300012513 Bacteria 11066
130 Ga0157373_10000003 3300013100 Bacteria 454601
131 Ga0157370_10000401 3300013104 Bacteria 54632
132 Ga0157370_10012828 3300013104 Bacteria 8664
133 Ga0157369_10009838 3300013105 Bacteria 10928
134 Ga0157374_10003494 3300013296 Bacteria 13207
135 Ga0157374_10045452 3300013296 Bacteria 4065
136 Ga0157374_10292172 3300013296 Bacteria 1611
137 Ga0157378_10005187 3300013297 Bacteria 11439
138 Ga0157378_10021603 3300013297 Bacteria 5660
139 Ga0157378_10054595 3300013297 Unclassified 3557
140 Ga0157378_10073709 3300013297 Bacteria 3070
141 Ga0157378_10077821 3300013297 Bacteria 2990
142 Ga0163162_10000612 3300013306 Bacteria 33144
143 Ga0163162_10086562 3300013306 Bacteria 3211
144 Ga0163162_10171145 3300013306 Bacteria 2297
145 Ga0157372_10123866 3300013307 Unclassified 2971
146 Ga0157375_10033101 3300013308 Bacteria 4908
147 Ga0157375_10052511 3300013308 Bacteria 4007
148 Ga0157375_10084504 3300013308 Unclassified 3223
149 Ga0163163_10023097 3300014325 Bacteria 5899
150 Ga0163163_10062976 3300014325 Bacteria 3676
151 Ga0163163_10154602 3300014325 Bacteria 2338
152 Ga0163163_10210741 3300014325 Unclassified 1992
153 Ga0157380_10000031 3300014326 Bacteria 90245
154 Ga0157380_10001103 3300014326 Bacteria 17403
155 Ga0157380_10008074 3300014326 Bacteria 7498
156 Ga0157380_10020860 3300014326 Bacteria 4906
157 Ga0182008_10000294 3300014497 Bacteria 39204
158 Ga0157379_10006192 3300014968 Bacteria 10306
159 Ga0157376_10081557 3300014969 Bacteria 2778
160 Ga0157376_10174194 3300014969 Bacteria 1962
161 Ga0182006_1000349 3300015261 Bacteria 38806
162 Ga0182006_1004440 3300015261 Bacteria 6922
163 Ga0163161_10002137 3300017792 Bacteria 14256
164 Ga0213876_10001850 3300021384 Bacteria 12750
165 Ga0213875_10006814 3300021388 Bacteria 5962
166 Ga0209258_100145 3300025242 Bacteria 163672
167 Ga0209148_1000177 3300025254 Bacteria 127365
168 Ga0207656_10023144 3300025321 Bacteria 2499
169 Ga0207680_10000021 3300025903 Bacteria 87712
170 Ga0207680_10020066 3300025903 Bacteria 3587
171 Ga0207680_10141931 3300025903 Bacteria 1593
172 Ga0207645_10000791 3300025907 Bacteria 26451
173 Ga0207705_10038518 3300025909 Bacteria 3423
174 Ga0207654_10001146 3300025911 Bacteria 14275
175 Ga0207671_10005252 3300025914 Bacteria 12026
176 Ga0207671_10009392 3300025914 Bacteria 8176
177 Ga0207671_10024185 3300025914 Bacteria 4571
178 Ga0207671_10035415 3300025914 Bacteria 3705
179 Ga0207660_10055140 3300025917 Bacteria 2839
180 Ga0207657_10017353 3300025919 Bacteria 6905
181 Ga0207652_10121794 3300025921 Bacteria 2321
182 Ga0207681_10000001 3300025923 Bacteria 1105841
183 Ga0207681_10052636 3300025923 Bacteria 2761
184 Ga0207650_10000018 3300025925 Bacteria 352120
185 Ga0207659_10004624 3300025926 Bacteria 8333
186 Ga0207644_10000270 3300025931 Bacteria 34922
187 Ga0207644_10048414 3300025931 Bacteria 3039
188 Ga0207706_10002371 3300025933 Bacteria 18407
189 Ga0207706_10022882 3300025933 Bacteria 5608
190 Ga0207686_10058912 3300025934 Unclassified 2424
191 Ga0207709_10002080 3300025935 Bacteria 12908
192 Ga0207669_10125942 3300025937 Bacteria 1750
193 Ga0207704_10018648 3300025938 Bacteria 3627
194 Ga0207691_10004429 3300025940 Bacteria 13610
195 Ga0207691_10122002 3300025940 Bacteria 2308
196 Ga0207711_10009854 3300025941 Bacteria 7946
197 Ga0207689_10016355 3300025942 Bacteria 6282
198 Ga0207689_10057808 3300025942 Bacteria 3190
199 Ga0207661_10054407 3300025944 Bacteria 3206
200 Ga0207679_10046809 3300025945 Unclassified 3138
201 Ga0207667_10075611 3300025949 Bacteria 3496
202 Ga0207667_10153305 3300025949 Unclassified 2371
203 Ga0207712_10067179 3300025961 Bacteria 2565
204 Ga0207712_10114425 3300025961 Bacteria 2029
205 Ga0207668_10000030 3300025972 Bacteria 122797
206 Ga0207668_10023046 3300025972 Bacteria 3995
207 Ga0207668_10028432 3300025972 Bacteria 3656
208 Ga0207668_10053607 3300025972 Bacteria 2796
209 Ga0207640_10032068 3300025981 Bacteria 3255
210 Ga0207658_10000002 3300025986 Bacteria 1364188
211 Ga0207658_10000075 3300025986 Bacteria 109004
212 Ga0207658_10000350 3300025986 Bacteria 45928
213 Ga0207658_10033866 3300025986 Bacteria 3646
214 Ga0207658_10056922 3300025986 Bacteria 2903
215 Ga0207677_10043374 3300026023 Bacteria 2990
216 Ga0207677_10079338 3300026023 Bacteria 2347
217 Ga0207703_10001224 3300026035 Bacteria 23987
218 Ga0207703_10008472 3300026035 Bacteria 8127
219 Ga0207703_10068211 3300026035 Bacteria 2930
220 Ga0207639_10072286 3300026041 Bacteria 2700
221 Ga0207641_10000026 3300026088 Bacteria 245091
222 Ga0207641_10000199 3300026088 Bacteria 81050
223 Ga0207641_10001366 3300026088 Bacteria 24146
224 Ga0207641_10002363 3300026088 Bacteria 17415
225 Ga0207641_10003279 3300026088 Bacteria 14399
226 Ga0207641_10040448 3300026088 Bacteria 3904
227 Ga0207648_10047693 3300026089 Unclassified 3753
228 Ga0207676_10000004 3300026095 Bacteria 725417
229 Ga0207676_10002146 3300026095 Bacteria 14259
230 Ga0207676_10011905 3300026095 Bacteria 6224
231 Ga0207676_10088960 3300026095 Bacteria 2529
232 Ga0207674_10034979 3300026116 Bacteria 5246
233 Ga0207674_10036010 3300026116 Bacteria 5162
234 Ga0207674_10072279 3300026116 Bacteria 3465
235 Ga0207675_100001662 3300026118 Bacteria 22254
236 Ga0207675_100037202 3300026118 Bacteria 4540
237 Ga0207675_100037900 3300026118 Bacteria 4498
238 Ga0207675_100087470 3300026118 Bacteria 2926
239 Ga0207698_10008807 3300026142 Bacteria 6397
240 Ga0207698_10189645 3300026142 Bacteria 1830
241 Ga0209489_113099 3300027361 Bacteria 6976
242 Ga0209282_1046413 3300027666 Bacteria 2533
243 Ga0268265_10000002 3300028380 Bacteria 1035381
244 Ga0268265_10000296 3300028380 Bacteria 55965
245 Ga0268264_10000087 3300028381 Bacteria 236696
246 Ga0268264_10000101 3300028381 Bacteria 225109
247 Ga0268264_10006864 3300028381 Bacteria 9557
248 Ga0268264_10027944 3300028381 Bacteria 4612
249 Ga0268264_10087402 3300028381 Unclassified 2680
250 Ga0307517_10000268 3300028786 Bacteria 89531
251 Ga0307515_10001257 3300028794 Bacteria 57814
252 Ga0265338_10007319 3300028800 Bacteria 13769
253 Ga0316177_1047521 3300030731 Bacteria 6903
254 Ga0316176_1107118 3300030732 Bacteria 9898
255 Ga0316183_1119266 3300030742 Bacteria 42152
256 Ga0316181_1099002 3300030744 Bacteria 10884
257 Ga0265327_10000459 3300031251 Bacteria 73045
258 Ga0265327_10017227 3300031251 Bacteria 4544
259 Ga0307408_100000264 3300031548 Bacteria 53211
260 Ga0307516_10001840 3300031730 Bacteria 29117
261 Ga0307516_10031765 3300031730 Bacteria 5322
262 Ga0307405_10169928 3300031731 Bacteria 1554
263 Ga0307412_10004683 3300031911 Bacteria 7632
264 Ga0307416_100000201 3300032002 Bacteria 31274
265 Ga0307510_10000949 3300033180 Bacteria 30604
266 Ga0436364_0331085 3300037853 Bacteria 17144
267 Ga0436364_0968333 3300037853 Bacteria 6277
268 Ga0436365_1724505 3300039437 Bacteria 12709
269 Ga0439449_0002781 3300042007 Bacteria 6799
270 Ga0451577_0004386 3300042876 Bacteria 14913
271 Ga0451577_0217408 3300042876 Bacteria 1727
272 Ga0453684_0003462 3300044712 Bacteria 35477
273 Ga0453684_0017838 3300044712 Bacteria 10954
274 Ga0466967_0051558 3300045976 Bacteria 3607
275 Ga0495638_0051481 3300046460 Unclassified 2568
276 Ga0495664_0095379 3300046477 Unclassified 1791
277 Ga0495606_0001358 3300046507 Bacteria 33214
278 Ga0495637_0015420 3300046520 Bacteria 3583
279 Ga0495643_0038139 3300046522 Bacteria 2633
280 Ga0495597_0036721 3300046542 Bacteria 2204
281 Ga0495633_0063120 3300046558 Bacteria 1734
282 Ga0495668_0000339 3300046616 Bacteria 62659
283 Ga0495611_0000813 3300046648 Bacteria 17326
284 Ga0495661_0000702 3300046665 Bacteria 33210
285 Ga0495661_0012787 3300046665 Bacteria 5663
286 Ga0496109_0109789 3300048912 Unclassified 2564
287 Ga0496118_0130730 3300048921 Bacteria 1613
288 Ga0496121_0014815 3300048924 Bacteria 8232
289 Ga0496122_0000090 3300048925 Bacteria 205886
290 Ga0496122_0001655 3300048925 Bacteria 34602
291 Ga0496123_0008277 3300048926 Bacteria 9580
292 Ga0496123_0046056 3300048926 Bacteria 2962
293 Ga0496124_0155205 3300048927 Bacteria 1791
294 Ga0496125_0028533 3300048928 Bacteria 5038
295 Ga0496125_0032227 3300048928 Bacteria 4658
296 Ga0501296_002630 3300049519 Bacteria 1893
297 Ga0501297_000855 3300049520 Bacteria 2729
298 Ga0501298_000877 3300049521 Bacteria 4262
299 Ga0501034_0000004 3300049571 Bacteria 382255
300 Ga0501034_0078164 3300049571 Bacteria 3314
301 Ga0501043_0016437 3300049579 Bacteria 5802
302 Ga0501047_0000999 3300049581 Bacteria 28567
303 Ga0501198_000745 3300049649 Bacteria 4059
304 Ga0501201_000275 3300049651 Bacteria 4645
305 Ga0501202_001090 3300049652 Bacteria 4223
306 Ga0501207_000874 3300049654 Bacteria 3608
307 Ga0501222_003454 3300049662 Bacteria 2157
308 Ga0501233_020193 3300049668 Bacteria 1419
309 Ga0501235_002139 3300049669 Bacteria 4241
310 Ga0501240_004931 3300049673 Bacteria 1573
311 Ga0501242_001311 3300049674 Bacteria 2465
312 Ga0501243_000143 3300049675 Bacteria 8147
313 Ga0501249_000002 3300049679 Bacteria 262756
314 Ga0501249_001083 3300049679 Bacteria 5778
315 Ga0501253_006833 3300049683 Bacteria 1566
316 Ga0501257_005436 3300049686 Bacteria 2809
317 Ga0501259_001250 3300049688 Bacteria 4245
318 Ga0501259_020703 3300049688 Bacteria 1169
319 Ga0501219_000082 3300049703 Bacteria 16179
320 Ga0501221_000789 3300049704 Bacteria 5132
321 Ga0501225_0005688 3300049705 Bacteria 3653
322 Ga0501234_000702 3300049707 Bacteria 5162
323 Ga0501245_000397 3300049708 Bacteria 5249
324 Ga0501281_01751 3300049777 Bacteria 1657
325 Ga0501282_001583 3300049778 Bacteria 2520
326 Ga0501035_0061612 3300049822 Bacteria 3339
327 Ga0501212_004131 3300049851 Bacteria 1856
328 Ga0501284_00002 3300050005 Bacteria 220402
329 nmdc:mga0k408_21276_c1 3300050493 Bacteria 3641
330 nmdc:mga0qj67_64852_c1 3300050509 Unclassified 2907
331 nmdc:mga06r32_181813_c1 3300050510 Bacteria 2088
332 nmdc:mga06r32_27031_c1 3300050510 Bacteria 5356
333 nmdc:mga08y16_48932_c1 3300050511 Bacteria 4424
334 Ga0500643_001801 3300053087 Bacteria 11735
335 Ga0500647_0058908 3300053091 Bacteria 1846
336 Ga0500651_0027888 3300053093 Bacteria 3551
337 Ga0500607_054032 3300053121 Bacteria 2128
338 Ga0500608_001848 3300053122 Bacteria 7546
339 Ga0500618_013668 3300053125 Bacteria 2091
340 Ga0500652_038978 3300053131 Bacteria 1903
341 Ga0500655_000070 3300053133 Bacteria 27417
342 Ga0500590_002815 3300053148 Bacteria 7857
343 Ga0500622_0004866 3300053156 Bacteria 8220
344 Ga0500639_045844 3300053163 Bacteria 2287
345 Ga0500570_000067 3300053724 Bacteria 27420
346 2585262077 2582581305 Bacteria 4895574
347 2587679522 2585428045 Bacteria 5203023
348 2643730585 2643221541 Bacteria 5498788
349 2644037577 2643221605 Bacteria 4772303
350 2644043754 2643221606 Bacteria 5588032
351 2644393913 2643221671 Bacteria 5496681
352 2738759110 2738541283 Bacteria 7222293
353 2842906353 2842903701 Bacteria 6986368
354 2929243171 2929239360 Bacteria 7745570
355 Ga0501034_0029329
356 JGI24749J21850_1000080
357 JGI24751J29686_10000225
358 rootL2_10114483
359 Ga0065704_10080262
360 Ga0065707_10082242
361 Ga0070658_10001326
362 Ga0070676_10000653
363 Ga0070683_100023071
364 Ga0070670_100000005
365 Ga0070670_100003125
366 Ga0070670_100281516
367 Ga0070677_10084067
368 Ga0068869_100044575
369 Ga0068869_100077429
370 Ga0070666_10000055
371 Ga0070666_10000400
372 Ga0070666_10120990
373 Ga0070680_100032337
374 Ga0070682_100003091
375 Ga0068868_100001911
376 Ga0068868_100014657
377 Ga0068868_100030988
378 Ga0068868_100202335
379 Ga0070661_100003390
380 Ga0070668_100001499
381 Ga0070668_100014544
382 Ga0070669_100000057
383 Ga0070669_100062078
384 Ga0070675_100010156
385 Ga0070671_100000163
386 Ga0070673_100011949
387 Ga0070673_100043331
388 Ga0070673_100046982
389 Ga0070659_100001487
390 Ga0070667_100000003
391 Ga0070667_100000016
392 Ga0070667_100001565
393 Ga0070667_100010585
394 Ga0070667_100012543
395 Ga0070667_100022453
396 Ga0070663_100101641
397 Ga0070662_100050397
398 Ga0070662_100074429
399 Ga0068867_100017122
400 Ga0068867_100020396
401 Ga0070679_100015187
402 Ga0070679_100018998
403 Ga0070684_100026369
404 Ga0068853_100005147
405 Ga0068853_100042311
406 Ga0070672_100003073
407 Ga0070686_100025725
408 Ga0070665_100002493
409 Ga0070665_100012900
410 Ga0068855_100027643
411 Ga0068855_100148732
412 Ga0070664_100008935
413 Ga0070664_100064684
414 Ga0068857_100013280
415 Ga0068856_100006300
416 Ga0068852_100001232
417 Ga0068852_100182029
418 Ga0068859_100000003
419 Ga0068859_100002060
420 Ga0068859_100009219
421 Ga0068859_100013998
422 Ga0068864_100000011
423 Ga0068864_100007520
424 Ga0068864_100022019
425 Ga0068864_100065552
426 Ga0068861_100009174
427 Ga0068861_100044269
428 Ga0068861_100059438
429 Ga0068861_100062062
430 Ga0068851_10003848
431 Ga0068851_10033505
432 Ga0068863_100000662
433 Ga0068863_100004080
434 Ga0068863_100007122
435 Ga0068863_100013169
436 Ga0068863_100034211
437 Ga0068863_100075225
438 Ga0068858_100000527
439 Ga0068858_100025267
440 Ga0068858_100033169
441 Ga0068858_100195127
442 Ga0068860_100000045
443 Ga0068860_100000196
444 Ga0068860_100003395
445 Ga0068860_100039084
446 Ga0068860_100039290
447 Ga0068862_100000011
448 Ga0068862_100000938
449 Ga0068862_100081341
450 Ga0068862_100137000
451 Ga0097621_100003560
452 Ga0097621_100007529
453 Ga0097621_100088947
454 Ga0068871_100003583
455 Ga0068871_100034433
456 Ga0068871_100044291
457 Ga0075428_100008784
458 Ga0075428_100036055
459 Ga0075430_100001450
460 Ga0075431_100042185
461 Ga0068865_100001316
462 Ga0097620_100000003
463 Ga0097620_100002060
464 Ga0097620_100009219
465 Ga0097620_100013998
466 Ga0099824_1000390
467 Ga0099826_10005021
468 Ga0105240_10061605
469 Ga0111539_10001545
470 Ga0111539_10073470
471 Ga0105247_10009615
472 Ga0105247_10023622
473 Ga0105247_10076778
474 Ga0105241_10000333
475 Ga0105248_10000406
476 Ga0105248_10498603
477 Ga0105237_10002282
478 Ga0105237_10002430
479 Ga0105237_10003933
480 Ga0105249_10039319
481 Ga0105239_10234380
482 Ga0105246_10061914
483 Ga0157326_1000044
484 Ga0157373_10000003
485 Ga0157370_10000401
486 Ga0157370_10012828
487 Ga0157369_10009838
488 Ga0157374_10003494
489 Ga0157374_10045452
490 Ga0157374_10292172
491 Ga0157378_10005187
492 Ga0157378_10021603
493 Ga0157378_10054595
494 Ga0157378_10073709
495 Ga0157378_10077821
496 Ga0163162_10000612
497 Ga0163162_10086562
498 Ga0163162_10171145
499 Ga0157372_10123866
500 Ga0157375_10033101
501 Ga0157375_10052511
502 Ga0157375_10084504
503 Ga0163163_10023097
504 Ga0163163_10062976
505 Ga0163163_10154602
506 Ga0163163_10210741
507 Ga0157380_10000031
508 Ga0157380_10001103
509 Ga0157380_10008074
510 Ga0157380_10020860
511 Ga0182008_10000294
512 Ga0157379_10006192
513 Ga0157376_10081557
514 Ga0157376_10174194
515 Ga0182006_1000349
516 Ga0182006_1004440
517 Ga0163161_10002137
518 Ga0213876_10001850
519 Ga0213875_10006814
520 Ga0209258_100145
521 Ga0209148_1000177
522 Ga0207656_10023144
523 Ga0207680_10000021
524 Ga0207680_10020066
525 Ga0207680_10141931
526 Ga0207645_10000791
527 Ga0207705_10038518
528 Ga0207654_10001146
529 Ga0207671_10005252
530 Ga0207671_10009392
531 Ga0207671_10024185
532 Ga0207671_10035415
533 Ga0207660_10055140
534 Ga0207657_10017353
535 Ga0207652_10121794
536 Ga0207681_10000001
537 Ga0207681_10052636
538 Ga0207650_10000018
539 Ga0207659_10004624
540 Ga0207644_10000270
541 Ga0207644_10048414
542 Ga0207706_10002371
543 Ga0207706_10022882
544 Ga0207686_10058912
545 Ga0207709_10002080
546 Ga0207669_10125942
547 Ga0207704_10018648
548 Ga0207691_10004429
549 Ga0207691_10122002
550 Ga0207711_10009854
551 Ga0207689_10016355
552 Ga0207689_10057808
553 Ga0207661_10054407
554 Ga0207679_10046809
555 Ga0207667_10075611
556 Ga0207667_10153305
557 Ga0207712_10067179
558 Ga0207712_10114425
559 Ga0207668_10000030
560 Ga0207668_10023046
561 Ga0207668_10028432
562 Ga0207668_10053607
563 Ga0207640_10032068
564 Ga0207658_10000002
565 Ga0207658_10000075
566 Ga0207658_10000350
567 Ga0207658_10033866
568 Ga0207658_10056922
569 Ga0207677_10043374
570 Ga0207677_10079338
571 Ga0207703_10001224
572 Ga0207703_10008472
573 Ga0207703_10068211
574 Ga0207639_10072286
575 Ga0207641_10000026
576 Ga0207641_10000199
577 Ga0207641_10001366
578 Ga0207641_10002363
579 Ga0207641_10003279
580 Ga0207641_10040448
581 Ga0207648_10047693
582 Ga0207676_10000004
583 Ga0207676_10002146
584 Ga0207676_10011905
585 Ga0207676_10088960
586 Ga0207674_10034979
587 Ga0207674_10036010
588 Ga0207674_10072279
589 Ga0207675_100001662
590 Ga0207675_100037202
591 Ga0207675_100037900
592 Ga0207675_100087470
593 Ga0207698_10008807
594 Ga0207698_10189645
595 Ga0209489_113099
596 Ga0209282_1046413
597 Ga0268265_10000002
598 Ga0268265_10000296
599 Ga0268264_10000087
600 Ga0268264_10000101
601 Ga0268264_10006864
602 Ga0268264_10027944
603 Ga0268264_10087402
604 Ga0307517_10000268
605 Ga0307515_10001257
606 Ga0265338_10007319
607 Ga0316177_1047521
608 Ga0316176_1107118
609 Ga0316183_1119266
610 Ga0316181_1099002
611 Ga0265327_10000459
612 Ga0265327_10017227
613 Ga0307408_100000264
614 Ga0307516_10001840
615 Ga0307516_10031765
616 Ga0307405_10169928
617 Ga0307412_10004683
618 Ga0307416_100000201
619 Ga0307510_10000949
620 Ga0436364_0331085
621 Ga0436364_0968333
622 Ga0436365_1724505
623 Ga0439449_0002781
624 Ga0451577_0004386
625 Ga0451577_0217408
626 Ga0453684_0003462
627 Ga0453684_0017838
628 Ga0466967_0051558
629 Ga0495638_0051481
630 Ga0495664_0095379
631 Ga0495606_0001358
632 Ga0495637_0015420
633 Ga0495643_0038139
634 Ga0495597_0036721
635 Ga0495633_0063120
636 Ga0495668_0000339
637 Ga0495611_0000813
638 Ga0495661_0000702
639 Ga0495661_0012787
640 Ga0496109_0109789
641 Ga0496118_0130730
642 Ga0496121_0014815
643 Ga0496122_0000090
644 Ga0496122_0001655
645 Ga0496123_0008277
646 Ga0496123_0046056
647 Ga0496124_0155205
648 Ga0496125_0028533
649 Ga0496125_0032227
650 Ga0501296_002630
651 Ga0501297_000855
652 Ga0501298_000877
653 Ga0501034_0000004
654 Ga0501034_0078164
655 Ga0501043_0016437
656 Ga0501047_0000999
657 Ga0501198_000745
658 Ga0501201_000275
659 Ga0501202_001090
660 Ga0501207_000874
661 Ga0501222_003454
662 Ga0501233_020193
663 Ga0501235_002139
664 Ga0501240_004931
665 Ga0501242_001311
666 Ga0501243_000143
667 Ga0501249_000002
668 Ga0501249_001083
669 Ga0501253_006833
670 Ga0501257_005436
671 Ga0501259_001250
672 Ga0501259_020703
673 Ga0501219_000082
674 Ga0501221_000789
675 Ga0501225_0005688
676 Ga0501234_000702
677 Ga0501245_000397
678 Ga0501281_01751
679 Ga0501282_001583
680 Ga0501035_0061612
681 Ga0501212_004131
682 Ga0501284_00002
683 nmdc:mga0k408_21276_c1
684 nmdc:mga0qj67_64852_c1
685 nmdc:mga06r32_181813_c1
686 nmdc:mga06r32_27031_c1
687 nmdc:mga08y16_48932_c1
688 Ga0500643_001801
689 Ga0500647_0058908
690 Ga0500651_0027888
691 Ga0500607_054032
692 Ga0500608_001848
693 Ga0500618_013668
694 Ga0500652_038978
695 Ga0500655_000070
696 Ga0500590_002815
697 Ga0500622_0004866
698 Ga0500639_045844
699 Ga0500570_000067
700 2585262077
701 2587679522
702 2643730585
703 2644037577
704 2644043754
705 2644393913
706 2738759110
707 2842906353
708 2929243171

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

73

206

0.9

PF07690

MFS_1

Major Facilitator Superfamily

316

451

0.86

PF00083

Sugar_tr

Sugar (and other) transporter

54

220

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dla-assembly1.cif.gz_A crystal structure of nucleoside transporter nupg (d323a mutant) 0.7522 11 356
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.7481 1 357
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.7393 10 358
8hnd-assembly1.cif.gz_A cryo-em structure of human oatp1b1 in complex with estrone-3-sulfate 0.7341 7 365
5oxm-assembly1.cif.gz_A peptst in complex with dipeptide asp-glu 0.7284 11 357
ID Description Score Start End Superfamily
af_Q2G1N0_6_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9552 7 193 1.20.1250.20
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9511 7 194 1.20.1250.20
af_Q58713_262_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9417 55 186 1.20.1250.20
af_Q2G1N0_6_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9358 7 193 1.20.1250.20
af_Q55CP7_10_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9338 10 192 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A537ASH9-F1-model_v4 TCR/Tet family MFS transporter 0.9826 11 210 GO:0005886
GO:0022857
AF-A0A6N7ZPE4-F1-model_v4 MFS transporter 0.9779 8 193 GO:0005886
GO:0022857
AF-A0A527X937-F1-model_v4 TCR/Tet family MFS transporter 0.9715 4 215 GO:0005886
GO:0022857
AF-A0A0F9ERT6-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9695 10 274 GO:0005886
GO:0022857
AF-A0A2V5QHK1-F1-model_v4 Tetracycline resistance MFS efflux pump 0.969 9 218 GO:0005886
GO:0022857

Map