F419865

General Info

Members Datasets Scaffolds Average Seq Length
354 224 708 161

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0329091|Ga0495582_0329091_147_764
Length 194
Sequence VTNLSFETAARVIHGFESRMPPSSTTRLVVNGTPHDISAAPDTPLLYVLRNDLGLTGPKFGCGLGQCGACMVHIDGLAVRSCTTPLSAAARGPITTIEGLGSPEKPHPVQQAFVDAQAAQCGYCSNGMIMAAAALVARNKRPTRAQIRSTLNGNLCRCGTHMRIIRAVERAAELSVAQSGXXXXDXSTRGDSDD

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
137 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
138 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
141 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
142 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
143 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0.28
Rhizoplane 6.5
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0329091 3300046473 Bacteria 879
2 Ga0065715_10296781 3300005293 Bacteria 1050
3 Ga0065707_10084990 3300005295 Bacteria 6571
4 Ga0070658_10606142 3300005327 Bacteria 949
5 Ga0070683_100006963 3300005329 Bacteria 9509
6 Ga0070683_100021208 3300005329 Bacteria 5794
7 Ga0070683_100041521 3300005329 Bacteria 4232
8 Ga0070683_100094556 3300005329 Bacteria 2809
9 Ga0070670_100024834 3300005331 Bacteria 5155
10 Ga0070677_10023197 3300005333 Bacteria 2295
11 Ga0070680_100002010 3300005336 Bacteria 14987
12 Ga0070680_100325510 3300005336 Bacteria 1305
13 Ga0068868_100000130 3300005338 Bacteria 48331
14 Ga0070660_100745585 3300005339 Bacteria 822
15 Ga0070691_10065350 3300005341 Bacteria 1756
16 Ga0070661_100004389 3300005344 Bacteria 9726
17 Ga0070661_100143374 3300005344 Bacteria 1801
18 Ga0070661_100244125 3300005344 Bacteria 1384
19 Ga0070661_100313253 3300005344 Bacteria 1224
20 Ga0070675_100012737 3300005354 Bacteria 6595
21 Ga0070671_100000330 3300005355 Bacteria 32427
22 Ga0070674_100036961 3300005356 Bacteria 3282
23 Ga0070673_100000435 3300005364 Bacteria 22065
24 Ga0070667_100194849 3300005367 Bacteria 1796
25 Ga0070667_100416134 3300005367 Bacteria 1225
26 Ga0070709_10128414 3300005434 Bacteria 1727
27 Ga0070709_10358465 3300005434 Bacteria 1079
28 Ga0070714_100201827 3300005435 Bacteria 1819
29 Ga0070714_100204316 3300005435 Bacteria 1808
30 Ga0070714_101268354 3300005435 Bacteria 719
31 Ga0070713_100035708 3300005436 Bacteria 4005
32 Ga0070713_100230097 3300005436 Bacteria 1685
33 Ga0070713_100357919 3300005436 Bacteria 1355
34 Ga0070710_10234442 3300005437 Bacteria 1173
35 Ga0070711_100189414 3300005439 Bacteria 1580
36 Ga0070711_100280048 3300005439 Bacteria 1319
37 Ga0070711_100498674 3300005439 Unclassified 1003
38 Ga0070711_100505149 3300005439 Bacteria 997
39 Ga0070705_100855659 3300005440 Bacteria 728
40 Ga0070700_101249949 3300005441 Bacteria 622
41 Ga0070694_100131982 3300005444 Bacteria 1805
42 Ga0070663_100319373 3300005455 Bacteria 1248
43 Ga0070681_10073476 3300005458 Bacteria 3381
44 Ga0070681_10090331 3300005458 Bacteria 3013
45 Ga0068867_100019486 3300005459 Bacteria 4833
46 Ga0070706_100012556 3300005467 Bacteria 7846
47 Ga0070706_100866567 3300005467 Bacteria 835
48 Ga0070698_100137522 3300005471 Bacteria 2396
49 Ga0070699_100020334 3300005518 Bacteria 5725
50 Ga0070699_100059356 3300005518 Bacteria 3313
51 Ga0070679_100001778 3300005530 Bacteria 19421
52 Ga0070679_100044176 3300005530 Bacteria 4439
53 Ga0070679_100256062 3300005530 Bacteria 1706
54 Ga0070684_100032315 3300005535 Bacteria 4459
55 Ga0070684_100055412 3300005535 Bacteria 3456
56 Ga0070684_100123281 3300005535 Bacteria 2332
57 Ga0070684_100323514 3300005535 Bacteria 1417
58 Ga0068853_101254027 3300005539 Bacteria 716
59 Ga0070672_100078052 3300005543 Bacteria 2649
60 Ga0070672_100729294 3300005543 Bacteria 869
61 Ga0070696_100000941 3300005546 Bacteria 18885
62 Ga0070696_100030326 3300005546 Bacteria 3702
63 Ga0070696_100100547 3300005546 Bacteria 2072
64 Ga0070693_100014347 3300005547 Bacteria 4058
65 Ga0070704_100060437 3300005549 Bacteria 2707
66 Ga0070704_101351446 3300005549 Bacteria 653
67 Ga0068855_100017440 3300005563 Bacteria 8635
68 Ga0068855_100081208 3300005563 Bacteria 3758
69 Ga0068855_100208086 3300005563 Bacteria 2200
70 Ga0070664_100004313 3300005564 Bacteria 11433
71 Ga0070664_100067280 3300005564 Bacteria 3062
72 Ga0068854_100129779 3300005578 Bacteria 1923
73 Ga0068854_100417377 3300005578 Bacteria 1114
74 Ga0068856_100006331 3300005614 Bacteria 11611
75 Ga0068856_100022124 3300005614 Bacteria 6183
76 Ga0070702_100046239 3300005615 Bacteria 2466
77 Ga0068852_100000400 3300005616 Bacteria 29058
78 Ga0068852_100039327 3300005616 Bacteria 3982
79 Ga0068859_101158214 3300005617 Bacteria 851
80 Ga0068859_101869708 3300005617 Bacteria 663
81 Ga0068864_100004734 3300005618 Bacteria 11145
82 Ga0068864_101189323 3300005618 Bacteria 761
83 Ga0068866_10061832 3300005718 Bacteria 1946
84 Ga0068861_100027360 3300005719 Bacteria 4152
85 Ga0068863_100317056 3300005841 Bacteria 1514
86 Ga0068863_100598326 3300005841 Bacteria 1091
87 Ga0068858_100097881 3300005842 Bacteria 2735
88 Ga0068858_100206846 3300005842 Bacteria 1857
89 Ga0068858_100503799 3300005842 Bacteria 1170
90 Ga0068860_100026464 3300005843 Bacteria 5592
91 Ga0070717_10110319 3300006028 Bacteria 2346
92 Ga0070717_10203626 3300006028 Bacteria 1734
93 Ga0070715_10002231 3300006163 Bacteria 5889
94 Ga0070716_100006138 3300006173 Bacteria 5864
95 Ga0070716_100068083 3300006173 Bacteria 2081
96 Ga0070712_100269730 3300006175 Bacteria 1367
97 Ga0070712_100388145 3300006175 Bacteria 1151
98 Ga0075367_10389618 3300006178 Bacteria 881
99 Ga0097621_100001929 3300006237 Bacteria 14157
100 Ga0097621_100451458 3300006237 Unclassified 1158
101 Ga0075430_100006597 3300006846 Bacteria 9780
102 Ga0075431_100002439 3300006847 Bacteria 17891
103 Ga0075431_100025065 3300006847 Bacteria 6116
104 Ga0075433_10401978 3300006852 Unclassified 1208
105 Ga0075434_100883636 3300006871 Bacteria 909
106 Ga0075429_100373077 3300006880 Bacteria 1249
107 Ga0068865_100501067 3300006881 Bacteria 1012
108 Ga0075436_100280694 3300006914 Bacteria 1191
109 Ga0097620_101158310 3300006931 Bacteria 851
110 Ga0097620_101869706 3300006931 Bacteria 663
111 Ga0075435_100372714 3300007076 Bacteria 1226
112 Ga0099794_10165049 3300007265 Bacteria 1127
113 Ga0099795_10042736 3300007788 Bacteria 1619
114 Ga0105240_10036033 3300009093 Bacteria 6371
115 Ga0105240_10119499 3300009093 Bacteria 3174
116 Ga0105240_10967061 3300009093 Bacteria 912
117 Ga0105245_10143183 3300009098 Bacteria 2253
118 Ga0114129_10595141 3300009147 Bacteria 1434
119 Ga0114129_11399801 3300009147 Unclassified 863
120 Ga0105241_10060144 3300009174 Bacteria 2922
121 Ga0105241_10827018 3300009174 Viruses 855
122 Ga0105241_11838566 3300009174 Bacteria 592
123 Ga0105248_10759465 3300009177 Bacteria 1094
124 Ga0105248_10867595 3300009177 Bacteria 1019
125 Ga0105249_10051452 3300009553 Bacteria 3757
126 Ga0099796_10094206 3300010159 Bacteria 1117
127 Ga0157373_10009726 3300013100 Bacteria 7095
128 Ga0157370_10001097 3300013104 Bacteria 33947
129 Ga0157370_10001715 3300013104 Bacteria 26992
130 Ga0157370_10055608 3300013104 Bacteria 3769
131 Ga0157370_10159529 3300013104 Bacteria 2099
132 Ga0157369_10008056 3300013105 Bacteria 12083
133 Ga0157369_10070585 3300013105 Bacteria 3752
134 Ga0157369_10705309 3300013105 Bacteria 1039
135 Ga0157369_11154647 3300013105 Bacteria 791
136 Ga0157374_10002510 3300013296 Bacteria 15487
137 Ga0157378_10004019 3300013297 Bacteria 12985
138 Ga0163162_10006714 3300013306 Bacteria 11157
139 Ga0163162_10296096 3300013306 Bacteria 1750
140 Ga0157372_10001295 3300013307 Bacteria 27059
141 Ga0157372_10122743 3300013307 Bacteria 2985
142 Ga0157372_10577158 3300013307 Bacteria 1311
143 Ga0157375_10014190 3300013308 Bacteria 7102
144 Ga0163163_10170075 3300014325 Bacteria 2226
145 Ga0163163_10780762 3300014325 Bacteria 1019
146 Ga0163163_11259130 3300014325 Bacteria 802
147 Ga0157379_10047527 3300014968 Bacteria 3828
148 Ga0157376_10006158 3300014969 Bacteria 8449
149 Ga0157376_11498238 3300014969 Bacteria 707
150 Ga0182006_1002800 3300015261 Bacteria 9307
151 Ga0182005_1160591 3300015265 Bacteria 659
152 Ga0207692_10007117 3300025898 Bacteria 4572
153 Ga0207692_10071039 3300025898 Bacteria 1834
154 Ga0207685_10017614 3300025905 Bacteria 2315
155 Ga0207699_10005379 3300025906 Bacteria 6136
156 Ga0207699_10039244 3300025906 Bacteria 2719
157 Ga0207699_10042056 3300025906 Bacteria 2644
158 Ga0207643_10238077 3300025908 Bacteria 1118
159 Ga0207684_10002003 3300025910 Bacteria 20986
160 Ga0207684_10047400 3300025910 Bacteria 3644
161 Ga0207707_10008991 3300025912 Bacteria 8676
162 Ga0207707_10046226 3300025912 Bacteria 3791
163 Ga0207695_10001783 3300025913 Bacteria 33949
164 Ga0207695_10037573 3300025913 Bacteria 5224
165 Ga0207695_10054858 3300025913 Bacteria 4158
166 Ga0207671_10240171 3300025914 Bacteria 1423
167 Ga0207693_10021337 3300025915 Bacteria 5148
168 Ga0207693_10624425 3300025915 Bacteria 838
169 Ga0207663_10014307 3300025916 Bacteria 4339
170 Ga0207663_10193451 3300025916 Bacteria 1462
171 Ga0207663_10382271 3300025916 Bacteria 1073
172 Ga0207660_10027633 3300025917 Bacteria 3874
173 Ga0207660_10112543 3300025917 Bacteria 2050
174 Ga0207649_10081678 3300025920 Bacteria 2093
175 Ga0207649_10150122 3300025920 Bacteria 1604
176 Ga0207652_10008167 3300025921 Bacteria 8405
177 Ga0207652_10042422 3300025921 Bacteria 3872
178 Ga0207652_10129822 3300025921 Bacteria 2247
179 Ga0207681_10085685 3300025923 Bacteria 2237
180 Ga0207700_10006918 3300025928 Bacteria 6898
181 Ga0207700_10032271 3300025928 Bacteria 3733
182 Ga0207700_10091672 3300025928 Bacteria 2401
183 Ga0207664_10012067 3300025929 Bacteria 6171
184 Ga0207664_10078626 3300025929 Bacteria 2675
185 Ga0207665_10003938 3300025939 Bacteria 9938
186 Ga0207661_10026475 3300025944 Bacteria 4419
187 Ga0207661_10139299 3300025944 Bacteria 2086
188 Ga0207679_10227153 3300025945 Bacteria 1574
189 Ga0207679_10561547 3300025945 Bacteria 1025
190 Ga0207667_10110517 3300025949 Bacteria 2835
191 Ga0207667_10140246 3300025949 Bacteria 2489
192 Ga0207667_10699521 3300025949 Bacteria 1016
193 Ga0207712_10436054 3300025961 Bacteria 1108
194 Ga0207668_10319961 3300025972 Bacteria 1287
195 Ga0207640_10237104 3300025981 Bacteria 1407
196 Ga0207640_10402678 3300025981 Bacteria 1115
197 Ga0207658_10201540 3300025986 Bacteria 1662
198 Ga0207703_10214287 3300026035 Bacteria 1719
199 Ga0207702_10011414 3300026078 Bacteria 7405
200 Ga0207702_10012852 3300026078 Bacteria 6965
201 Ga0207702_10749728 3300026078 Bacteria 964
202 Ga0207675_100319320 3300026118 Bacteria 1516
203 Ga0207698_11562896 3300026142 Bacteria 675
204 Ga0209281_1011156 3300027111 Bacteria 2022
205 Ga0209967_1020543 3300027364 Bacteria 962
206 Ga0209999_1035907 3300027543 Bacteria 925
207 Ga0268266_10426197 3300028379 Bacteria 1258
208 Ga0268264_10090266 3300028381 Bacteria 2640
209 Ga0268264_10249597 3300028381 Bacteria 1648
210 Ga0316178_1038277 3300030735 Bacteria 2817
211 Ga0307408_100049098 3300031548 Bacteria 3029
212 Ga0307408_100475966 3300031548 Bacteria 1088
213 Ga0307405_10613903 3300031731 Bacteria 889
214 Ga0307412_10009998 3300031911 Bacteria 5456
215 Ga0307412_10168930 3300031911 Bacteria 1633
216 Ga0307412_11549195 3300031911 Bacteria 604
217 Ga0307411_10005224 3300032005 Bacteria 6356
218 Ga0373934_0032003 3300035086 Bacteria 2061
219 Ga0373944_0197096 3300035089 Bacteria 728
220 Ga0373954_0037891 3300035118 Bacteria 2241
221 Ga0373954_0206769 3300035118 Bacteria 965
222 Ga0373943_0014737 3300035170 Bacteria 3545
223 Ga0373933_0055990 3300035724 Bacteria 2366
224 Ga0373933_0174269 3300035724 Bacteria 1370
225 Ga0373947_0176893 3300035725 Bacteria 1387
226 Ga0373947_0205743 3300035725 Bacteria 1289
227 Ga0373937_0030122 3300036401 Bacteria 4916
228 Ga0373937_0074207 3300036401 Bacteria 3138
229 Ga0373937_0692979 3300036401 Bacteria 965
230 Ga0316582_0071168 3300036647 Unclassified 2252
231 Ga0373925_0020472 3300037068 Bacteria 4815
232 Ga0373925_0036258 3300037068 Bacteria 3640
233 Ga0439438_000441 3300041405 Bacteria 18789
234 Ga0439438_000790 3300041405 Bacteria 14091
235 Ga0439447_003916 3300041407 Bacteria 5217
236 Ga0439447_045319 3300041407 Bacteria 1061
237 Ga0439447_064885 3300041407 Bacteria 854
238 Ga0439447_122752 3300041407 Bacteria 596
239 Ga0439442_064509 3300042002 Bacteria 777
240 Ga0439432_022468 3300042006 Bacteria 2083
241 Ga0439432_022470 3300042006 Bacteria 2083
242 Ga0439452_016241 3300042010 Bacteria 2025
243 Ga0439456_001313 3300042013 Bacteria 4956
244 Ga0439456_027832 3300042013 Bacteria 1205
245 Ga0439456_031752 3300042013 Bacteria 1132
246 Ga0450900_003319 3300042136 Bacteria 1780
247 Ga0450903_012306 3300042138 Bacteria 1368
248 Ga0466957_1126818 3300044842 Bacteria 566
249 Ga0466967_0420638 3300045976 Bacteria 1302
250 Ga0495592_0045747 3300046454 Bacteria 3264
251 Ga0495653_0023877 3300046463 Bacteria 4935
252 Ga0495605_0046920 3300046474 Bacteria 2121
253 Ga0495639_0361224 3300046475 Bacteria 730
254 Ga0495664_0030925 3300046477 Bacteria 3137
255 Ga0495594_0098450 3300046499 Bacteria 1644
256 Ga0495594_0284418 3300046499 Bacteria 942
257 Ga0495630_0424668 3300046517 Bacteria 1018
258 Ga0495630_0593794 3300046517 Bacteria 849
259 Ga0495630_1258874 3300046517 Bacteria 558
260 Ga0495643_0011520 3300046522 Bacteria 5382
261 Ga0495644_0325835 3300046523 Bacteria 603
262 Ga0495648_0004893 3300046524 Bacteria 11273
263 Ga0495648_0032250 3300046524 Bacteria 3440
264 Ga0495642_0056501 3300046528 Bacteria 1621
265 Ga0495652_0042206 3300046529 Bacteria 3934
266 Ga0495586_0011809 3300046535 Bacteria 4642
267 Ga0495586_0156824 3300046535 Bacteria 1282
268 Ga0495587_0041966 3300046536 Bacteria 2729
269 Ga0495609_0002176 3300046538 Bacteria 12318
270 Ga0495621_0044402 3300046539 Bacteria 1571
271 Ga0495597_0069963 3300046542 Bacteria 1513
272 Ga0495645_0038336 3300046543 Bacteria 3495
273 Ga0495645_0187522 3300046543 Bacteria 1412
274 Ga0495667_0020304 3300046559 Bacteria 4484
275 Ga0495667_0138847 3300046559 Bacteria 1566
276 Ga0495667_0693644 3300046559 Bacteria 631
277 Ga0495668_0120030 3300046616 Bacteria 1438
278 Ga0495634_0061299 3300046642 Bacteria 2501
279 Ga0495635_0010228 3300046663 Bacteria 6560
280 Ga0495661_0006843 3300046665 Bacteria 7981
281 Ga0495588_0315603 3300046674 Bacteria 822
282 Ga0495657_0013453 3300046675 Bacteria 6038
283 Ga0495599_0044222 3300046678 Bacteria 2793
284 Ga0495599_0164263 3300046678 Bacteria 1371
285 Ga0495623_0170903 3300046679 Unclassified 1270
286 Ga0495623_0318097 3300046679 Bacteria 855
287 Ga0495613_0163973 3300046689 Bacteria 1580
288 Ga0495589_0250293 3300046794 Bacteria 828
289 Ga0495600_0062027 3300046809 Bacteria 2442
290 Ga0495581_0236252 3300047315 Bacteria 1069
291 Ga0495604_0127872 3300047317 Bacteria 1829
292 Ga0495674_0133156 3300047319 Bacteria 2094
293 Ga0495674_0250768 3300047319 Bacteria 1457
294 Ga0495672_0311949 3300047320 Bacteria 741
295 Ga0495683_0239314 3300047323 Bacteria 801
296 Ga0495687_009684 3300047443 Bacteria 5358
297 Ga0495675_0002171 3300047444 Bacteria 11695
298 Ga0495684_0153012 3300047471 Bacteria 1724
299 Ga0495593_0090309 3300047673 Bacteria 1578
300 Ga0495602_0216272 3300048088 Bacteria 1450
301 Ga0495602_0313491 3300048088 Bacteria 1144
302 Ga0495615_0052350 3300048090 Unclassified 1054
303 Ga0496100_0031185 3300048903 Bacteria 3312
304 Ga0496101_0170891 3300048904 Bacteria 1671
305 Ga0496102_0152539 3300048905 Bacteria 2172
306 Ga0496102_0258281 3300048905 Bacteria 1642
307 Ga0496104_0002504 3300048907 Bacteria 15805
308 Ga0496104_1064123 3300048907 Bacteria 713
309 Ga0496105_0004475 3300048908 Bacteria 10521
310 Ga0496105_0007358 3300048908 Bacteria 8516
311 Ga0496106_0660562 3300048909 Bacteria 835
312 Ga0496108_0004929 3300048911 Bacteria 10783
313 Ga0496108_0017640 3300048911 Bacteria 5841
314 Ga0496108_0024488 3300048911 Bacteria 4970
315 Ga0496109_0048084 3300048912 Bacteria 3881
316 Ga0496109_0054134 3300048912 Bacteria 3661
317 Ga0496109_0063116 3300048912 Bacteria 3388
318 Ga0496110_0006200 3300048913 Bacteria 9436
319 Ga0496110_0182227 3300048913 Bacteria 1907
320 Ga0496111_0003088 3300048914 Bacteria 10236
321 Ga0496111_0210186 3300048914 Bacteria 1445
322 Ga0496112_0003574 3300048915 Bacteria 12919
323 Ga0496112_0011750 3300048915 Bacteria 8017
324 Ga0496114_0370888 3300048917 Bacteria 1267
325 Ga0496115_0052864 3300048918 Bacteria 3259
326 Ga0496122_0038985 3300048925 Bacteria 3795
327 Ga0496123_0001171 3300048926 Bacteria 38747
328 Ga0496124_0127620 3300048927 Bacteria 2024
329 Ga0496124_0171913 3300048927 Bacteria 1677
330 Ga0501032_0380474 3300049569 Bacteria 908
331 Ga0501037_0033816 3300049573 Bacteria 3775
332 Ga0501038_0697463 3300049574 Bacteria 761
333 Ga0501046_0209866 3300049580 Bacteria 1446
334 Ga0501047_0002953 3300049581 Bacteria 16114
335 Ga0501070_0027591 3300049586 Bacteria 4762
336 Ga0501071_0005608 3300049587 Bacteria 8089
337 Ga0501073_0016438 3300049589 Bacteria 5361
338 Ga0501076_0073911 3300049592 Bacteria 2730
339 Ga0501079_0172213 3300049741 Bacteria 1688
340 Ga0501080_0041216 3300049742 Bacteria 4303
341 Ga0501083_0341856 3300049744 Bacteria 973
342 Ga0501035_0042990 3300049822 Bacteria 4073
343 Ga0501044_0053235 3300049823 Bacteria 4165
344 Ga0501044_0211002 3300049823 Bacteria 1896
345 nmdc:mga04h51_283141_c1 3300050495 Bacteria 672
346 nmdc:mga05p37_1771508_c1 3300050507 Unclassified 598
347 nmdc:mga0qj67_120855_c1 3300050509 Bacteria 2119
348 nmdc:mga0qj67_270143_c1 3300050509 Bacteria 1379
349 nmdc:mga06r32_106400_c1 3300050510 Bacteria 2756
350 nmdc:mga06r32_79303_c1 3300050510 Bacteria 3194
351 Ga0495601_0172711 3300053077 Bacteria 1413
352 Ga0495595_0110533 3300053084 Bacteria 1332
353 Ga0500555_001963 3300053103 Bacteria 6084
354 Ga0500645_002415 3300053730 Bacteria 8367
355 Ga0495582_0329091
356 Ga0065715_10296781
357 Ga0065707_10084990
358 Ga0070658_10606142
359 Ga0070683_100006963
360 Ga0070683_100021208
361 Ga0070683_100041521
362 Ga0070683_100094556
363 Ga0070670_100024834
364 Ga0070677_10023197
365 Ga0070680_100002010
366 Ga0070680_100325510
367 Ga0068868_100000130
368 Ga0070660_100745585
369 Ga0070691_10065350
370 Ga0070661_100004389
371 Ga0070661_100143374
372 Ga0070661_100244125
373 Ga0070661_100313253
374 Ga0070675_100012737
375 Ga0070671_100000330
376 Ga0070674_100036961
377 Ga0070673_100000435
378 Ga0070667_100194849
379 Ga0070667_100416134
380 Ga0070709_10128414
381 Ga0070709_10358465
382 Ga0070714_100201827
383 Ga0070714_100204316
384 Ga0070714_101268354
385 Ga0070713_100035708
386 Ga0070713_100230097
387 Ga0070713_100357919
388 Ga0070710_10234442
389 Ga0070711_100189414
390 Ga0070711_100280048
391 Ga0070711_100498674
392 Ga0070711_100505149
393 Ga0070705_100855659
394 Ga0070700_101249949
395 Ga0070694_100131982
396 Ga0070663_100319373
397 Ga0070681_10073476
398 Ga0070681_10090331
399 Ga0068867_100019486
400 Ga0070706_100012556
401 Ga0070706_100866567
402 Ga0070698_100137522
403 Ga0070699_100020334
404 Ga0070699_100059356
405 Ga0070679_100001778
406 Ga0070679_100044176
407 Ga0070679_100256062
408 Ga0070684_100032315
409 Ga0070684_100055412
410 Ga0070684_100123281
411 Ga0070684_100323514
412 Ga0068853_101254027
413 Ga0070672_100078052
414 Ga0070672_100729294
415 Ga0070696_100000941
416 Ga0070696_100030326
417 Ga0070696_100100547
418 Ga0070693_100014347
419 Ga0070704_100060437
420 Ga0070704_101351446
421 Ga0068855_100017440
422 Ga0068855_100081208
423 Ga0068855_100208086
424 Ga0070664_100004313
425 Ga0070664_100067280
426 Ga0068854_100129779
427 Ga0068854_100417377
428 Ga0068856_100006331
429 Ga0068856_100022124
430 Ga0070702_100046239
431 Ga0068852_100000400
432 Ga0068852_100039327
433 Ga0068859_101158214
434 Ga0068859_101869708
435 Ga0068864_100004734
436 Ga0068864_101189323
437 Ga0068866_10061832
438 Ga0068861_100027360
439 Ga0068863_100317056
440 Ga0068863_100598326
441 Ga0068858_100097881
442 Ga0068858_100206846
443 Ga0068858_100503799
444 Ga0068860_100026464
445 Ga0070717_10110319
446 Ga0070717_10203626
447 Ga0070715_10002231
448 Ga0070716_100006138
449 Ga0070716_100068083
450 Ga0070712_100269730
451 Ga0070712_100388145
452 Ga0075367_10389618
453 Ga0097621_100001929
454 Ga0097621_100451458
455 Ga0075430_100006597
456 Ga0075431_100002439
457 Ga0075431_100025065
458 Ga0075433_10401978
459 Ga0075434_100883636
460 Ga0075429_100373077
461 Ga0068865_100501067
462 Ga0075436_100280694
463 Ga0097620_101158310
464 Ga0097620_101869706
465 Ga0075435_100372714
466 Ga0099794_10165049
467 Ga0099795_10042736
468 Ga0105240_10036033
469 Ga0105240_10119499
470 Ga0105240_10967061
471 Ga0105245_10143183
472 Ga0114129_10595141
473 Ga0114129_11399801
474 Ga0105241_10060144
475 Ga0105241_10827018
476 Ga0105241_11838566
477 Ga0105248_10759465
478 Ga0105248_10867595
479 Ga0105249_10051452
480 Ga0099796_10094206
481 Ga0157373_10009726
482 Ga0157370_10001097
483 Ga0157370_10001715
484 Ga0157370_10055608
485 Ga0157370_10159529
486 Ga0157369_10008056
487 Ga0157369_10070585
488 Ga0157369_10705309
489 Ga0157369_11154647
490 Ga0157374_10002510
491 Ga0157378_10004019
492 Ga0163162_10006714
493 Ga0163162_10296096
494 Ga0157372_10001295
495 Ga0157372_10122743
496 Ga0157372_10577158
497 Ga0157375_10014190
498 Ga0163163_10170075
499 Ga0163163_10780762
500 Ga0163163_11259130
501 Ga0157379_10047527
502 Ga0157376_10006158
503 Ga0157376_11498238
504 Ga0182006_1002800
505 Ga0182005_1160591
506 Ga0207692_10007117
507 Ga0207692_10071039
508 Ga0207685_10017614
509 Ga0207699_10005379
510 Ga0207699_10039244
511 Ga0207699_10042056
512 Ga0207643_10238077
513 Ga0207684_10002003
514 Ga0207684_10047400
515 Ga0207707_10008991
516 Ga0207707_10046226
517 Ga0207695_10001783
518 Ga0207695_10037573
519 Ga0207695_10054858
520 Ga0207671_10240171
521 Ga0207693_10021337
522 Ga0207693_10624425
523 Ga0207663_10014307
524 Ga0207663_10193451
525 Ga0207663_10382271
526 Ga0207660_10027633
527 Ga0207660_10112543
528 Ga0207649_10081678
529 Ga0207649_10150122
530 Ga0207652_10008167
531 Ga0207652_10042422
532 Ga0207652_10129822
533 Ga0207681_10085685
534 Ga0207700_10006918
535 Ga0207700_10032271
536 Ga0207700_10091672
537 Ga0207664_10012067
538 Ga0207664_10078626
539 Ga0207665_10003938
540 Ga0207661_10026475
541 Ga0207661_10139299
542 Ga0207679_10227153
543 Ga0207679_10561547
544 Ga0207667_10110517
545 Ga0207667_10140246
546 Ga0207667_10699521
547 Ga0207712_10436054
548 Ga0207668_10319961
549 Ga0207640_10237104
550 Ga0207640_10402678
551 Ga0207658_10201540
552 Ga0207703_10214287
553 Ga0207702_10011414
554 Ga0207702_10012852
555 Ga0207702_10749728
556 Ga0207675_100319320
557 Ga0207698_11562896
558 Ga0209281_1011156
559 Ga0209967_1020543
560 Ga0209999_1035907
561 Ga0268266_10426197
562 Ga0268264_10090266
563 Ga0268264_10249597
564 Ga0316178_1038277
565 Ga0307408_100049098
566 Ga0307408_100475966
567 Ga0307405_10613903
568 Ga0307412_10009998
569 Ga0307412_10168930
570 Ga0307412_11549195
571 Ga0307411_10005224
572 Ga0373934_0032003
573 Ga0373944_0197096
574 Ga0373954_0037891
575 Ga0373954_0206769
576 Ga0373943_0014737
577 Ga0373933_0055990
578 Ga0373933_0174269
579 Ga0373947_0176893
580 Ga0373947_0205743
581 Ga0373937_0030122
582 Ga0373937_0074207
583 Ga0373937_0692979
584 Ga0316582_0071168
585 Ga0373925_0020472
586 Ga0373925_0036258
587 Ga0439438_000441
588 Ga0439438_000790
589 Ga0439447_003916
590 Ga0439447_045319
591 Ga0439447_064885
592 Ga0439447_122752
593 Ga0439442_064509
594 Ga0439432_022468
595 Ga0439432_022470
596 Ga0439452_016241
597 Ga0439456_001313
598 Ga0439456_027832
599 Ga0439456_031752
600 Ga0450900_003319
601 Ga0450903_012306
602 Ga0466957_1126818
603 Ga0466967_0420638
604 Ga0495592_0045747
605 Ga0495653_0023877
606 Ga0495605_0046920
607 Ga0495639_0361224
608 Ga0495664_0030925
609 Ga0495594_0098450
610 Ga0495594_0284418
611 Ga0495630_0424668
612 Ga0495630_0593794
613 Ga0495630_1258874
614 Ga0495643_0011520
615 Ga0495644_0325835
616 Ga0495648_0004893
617 Ga0495648_0032250
618 Ga0495642_0056501
619 Ga0495652_0042206
620 Ga0495586_0011809
621 Ga0495586_0156824
622 Ga0495587_0041966
623 Ga0495609_0002176
624 Ga0495621_0044402
625 Ga0495597_0069963
626 Ga0495645_0038336
627 Ga0495645_0187522
628 Ga0495667_0020304
629 Ga0495667_0138847
630 Ga0495667_0693644
631 Ga0495668_0120030
632 Ga0495634_0061299
633 Ga0495635_0010228
634 Ga0495661_0006843
635 Ga0495588_0315603
636 Ga0495657_0013453
637 Ga0495599_0044222
638 Ga0495599_0164263
639 Ga0495623_0170903
640 Ga0495623_0318097
641 Ga0495613_0163973
642 Ga0495589_0250293
643 Ga0495600_0062027
644 Ga0495581_0236252
645 Ga0495604_0127872
646 Ga0495674_0133156
647 Ga0495674_0250768
648 Ga0495672_0311949
649 Ga0495683_0239314
650 Ga0495687_009684
651 Ga0495675_0002171
652 Ga0495684_0153012
653 Ga0495593_0090309
654 Ga0495602_0216272
655 Ga0495602_0313491
656 Ga0495615_0052350
657 Ga0496100_0031185
658 Ga0496101_0170891
659 Ga0496102_0152539
660 Ga0496102_0258281
661 Ga0496104_0002504
662 Ga0496104_1064123
663 Ga0496105_0004475
664 Ga0496105_0007358
665 Ga0496106_0660562
666 Ga0496108_0004929
667 Ga0496108_0017640
668 Ga0496108_0024488
669 Ga0496109_0048084
670 Ga0496109_0054134
671 Ga0496109_0063116
672 Ga0496110_0006200
673 Ga0496110_0182227
674 Ga0496111_0003088
675 Ga0496111_0210186
676 Ga0496112_0003574
677 Ga0496112_0011750
678 Ga0496114_0370888
679 Ga0496115_0052864
680 Ga0496122_0038985
681 Ga0496123_0001171
682 Ga0496124_0127620
683 Ga0496124_0171913
684 Ga0501032_0380474
685 Ga0501037_0033816
686 Ga0501038_0697463
687 Ga0501046_0209866
688 Ga0501047_0002953
689 Ga0501070_0027591
690 Ga0501071_0005608
691 Ga0501073_0016438
692 Ga0501076_0073911
693 Ga0501079_0172213
694 Ga0501080_0041216
695 Ga0501083_0341856
696 Ga0501035_0042990
697 Ga0501044_0053235
698 Ga0501044_0211002
699 nmdc:mga04h51_283141_c1
700 nmdc:mga05p37_1771508_c1
701 nmdc:mga0qj67_120855_c1
702 nmdc:mga0qj67_270143_c1
703 nmdc:mga06r32_106400_c1
704 nmdc:mga06r32_79303_c1
705 Ga0495601_0172711
706 Ga0495595_0110533
707 Ga0500555_001963
708 Ga0500645_002415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

96

169

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

28

93

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9518 3 157
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9468 1 154
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9459 3 157
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9449 3 156
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.944 3 154
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9308 1 77 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9267 79 154 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9235 1 77 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9185 1 76 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9182 79 154 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A2G0VS79-F1-model_v4 (2Fe-2S)-binding protein 0.9768 2 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A7Z1V1I9-F1-model_v4 deleted 0.9764 2 154
AF-A0A2V6UG13-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9761 2 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A0C5RP52-F1-model_v4 deleted 0.9754 1 154
AF-A0A1W6ZC29-F1-model_v4 (2Fe-2S)-binding protein 0.975 2 153 GO:0016491
GO:0046872
GO:0051537

Map