F419601

General Info

Members Datasets Scaffolds Average Seq Length
354 298 181 327

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000661|JGI25162J39368_10006618
Length 338
Sequence MTSVRILTETDLRKLVGLDGDTVDCVEQAFAALATQAVEMPPIMRLDIPAHRGEVDVKSAYVPGLDSFAIKVSPGFFNNPSLGLASTNGLMLLLSAHTGLVEALLLDNGYLTDVRTAAAGAVAARHLARPDARVAAIMGAGMQARLQLHALTLVRPIEAARIWARDLTKAEKLALELTAELGFPVTAHADAEDACRGADIIVTTTPSAEPIVDAAWLEPGQHITAMGSDAEHKNEIDPAAIVNASLYVADSLKQTRRLGELHHAISTGLVSEMADFPELGAIVSGKATGRRSYEAITLCDLTGTGVQDTAIARLAYRRAASAGVGQVIETTRASGEPA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
6 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
9 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
10 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
11 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
12 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
13 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
14 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
15 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
16 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
17 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
18 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
19 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
20 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
21 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
22 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
23 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
24 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
25 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
26 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
27 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
28 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
29 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
30 2643221582 Rhizobium sp. Root651 Isolate Unclassified
31 2643221618 Ensifer sp. Root231 Isolate Unclassified
32 2643221655 Ensifer sp. Root1252 Isolate Unclassified
33 2643221693 Rhizobium sp. Root491 Isolate Unclassified
34 2643221712 Ensifer sp. Root258 Isolate Unclassified
35 2718217882 Rhizobium sp. N741 Isolate Nodule
36 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
37 2718218009 Rhizobium sp. N561 Isolate Nodule
38 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
39 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
40 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
41 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
42 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
43 2718218363 Rhizobium sp. N113 Isolate Nodule
44 2718218365 Rhizobium sp. N731 Isolate Nodule
45 2718218366 Rhizobium sp. N621 Isolate Nodule
46 2721755514 Rhizobium sp. N6212 Isolate Nodule
47 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
48 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
49 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
50 2721755810 Rhizobium sp. N871 Isolate Nodule
51 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
52 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
53 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
54 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
55 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
56 2728369365 Rhizobium sp. N1341 Isolate Nodule
57 2728369397 Rhizobium sp. N1314 Isolate Nodule
58 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
59 2751185800 Brucella pituitosa AA2 Isolate Unclassified
60 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
61 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
62 2791355256 Rhizobium sp. M10 Isolate Nodule
63 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
64 2791355262 Rhizobium sp. M1 Isolate Nodule
65 2791355264 Rhizobium sp. S9 Isolate Nodule
66 2791355265 Rhizobium sp. H4 Isolate Nodule
67 2791355266 Rhizobium sp. L43 Isolate Nodule
68 2791355267 Rhizobium sp. L18 Isolate Nodule
69 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
70 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
71 2802429633 Rhizobium anhuiense J3 Isolate Nodule
72 2802429634 Rhizobium anhuiense S10 Isolate Nodule
73 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
74 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
75 2802429637 Rhizobium anhuiense C15 Isolate Nodule
76 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
77 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
78 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
79 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
80 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
81 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
82 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
83 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
84 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
85 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
86 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
87 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
88 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
89 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
90 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
91 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
92 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
93 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
94 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
95 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
96 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
97 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
98 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
99 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
100 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
101 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
102 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
103 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
104 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
105 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
106 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
107 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
108 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
109 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
110 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
111 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
112 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
113 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
114 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
115 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
116 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
117 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
118 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
119 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
120 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
121 2854911287 Brucella lupini LUP21 Isolate Unclassified
122 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
123 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
124 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
125 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
126 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
127 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
128 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
129 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
130 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
131 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
132 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
133 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
134 2933599457 Rhizobium phaseoli M3 Isolate Nodule
135 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
136 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
137 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
138 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
139 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
140 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
141 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
142 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
143 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
144 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
145 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
146 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
147 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
148 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
149 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
150 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
151 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
152 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
153 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
154 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
155 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
156 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
157 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
158 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
159 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
160 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
161 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
162 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
163 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
164 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
165 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
166 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
167 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
168 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
169 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
170 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
171 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
172 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
177 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
181 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
198 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
204 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
205 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
206 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
207 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
265 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
270 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
271 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
272 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
273 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
274 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
275 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
276 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
277 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
278 8005382845 Rhizobium sp. R634 Isolate Nodule
279 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
280 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
281 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
282 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
283 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
284 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
285 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
286 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
287 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
288 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
289 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
290 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
291 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
292 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
293 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
294 8024501048 Rhizobium sp. H4 Isolate Nodule
295 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
296 8056382006 Rhizobium croatiense 13T Isolate Nodule
297 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
298 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.13
Metatranscriptomes 0
Isolates 48.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.75
Nodule 34.75
Rhizoplane 0.56
Rhizosphere 24.29
Stem 0
Stem Tuber 0
Unclassified 18.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000043 3300002704 Bacteria 87185
2 JGI25156J39149_1000056 3300002705 Bacteria 87185
3 JGI25162J39368_1000661 3300002737 Bacteria 24376
4 JGI25154J39366_1000086 3300002738 Bacteria 87185
5 JGI25158J39367_1000174 3300002739 Bacteria 15148
6 JGI25157J39369_1000086 3300002741 Bacteria 81114
7 JGI25152J39213_1000943 3300002773 Bacteria 14268
8 JGI25159J45721_1000461 3300002987 Bacteria 18823
9 JGI25151J46595_10002908 3300003187 Bacteria 9814
10 JGI25165J46597_1000604 3300003214 Bacteria 30711
11 rootL2_10020236 3300003322 Bacteria 23229
12 rootH1_10057386 3300003323 Bacteria 1258
13 JGI25160J50197_1000248 3300003354 Bacteria 41777
14 JGI25160J50197_1004640 3300003354 Bacteria 5897
15 JGI25161J50226_1000183 3300003374 Bacteria 41777
16 JGI25161J50226_1002195 3300003374 Bacteria 5193
17 Ga0055526_1002351 3300003771 Bacteria 12849
18 Ga0055526_1004568 3300003771 Bacteria 8260
19 Ga0055524_1005074 3300003775 Bacteria 5955
20 Ga0055528_1000266 3300003790 Bacteria 44336
21 Ga0055528_1000982 3300003790 Bacteria 18925
22 Ga0055528_1010913 3300003790 Bacteria 3650
23 Ga0055528_1026329 3300003790 Bacteria 1675
24 Ga0055540_1000096 3300003792 Bacteria 96969
25 Ga0055540_1007666 3300003792 Bacteria 4025
26 Ga0055540_1008931 3300003792 Bacteria 3538
27 Ga0058692_1003270 3300003856 Bacteria 5066
28 Ga0055543_1000036 3300004625 Bacteria 126054
29 Ga0055543_1000245 3300004625 Bacteria 41815
30 Ga0055543_1008031 3300004625 Bacteria 2370
31 Ga0065165_1001012 3300005262 Bacteria 34230
32 Ga0065165_1014439 3300005262 Bacteria 3065
33 Ga0070671_100093290 3300005355 Bacteria 2523
34 Ga0075362_10000396 3300006177 Bacteria 12548
35 Ga0075362_10002642 3300006177 Bacteria 6081
36 Ga0075367_10009169 3300006178 Bacteria 5160
37 Ga0075369_10003478 3300006186 Bacteria 5735
38 Ga0075369_10070741 3300006186 Bacteria 1535
39 Ga0075366_10001529 3300006195 Bacteria 11567
40 Ga0114129_10191383 3300009147 Bacteria 2777
41 Ga0123341_1002056 3300009765 Bacteria 16111
42 Ga0123342_1017752 3300009766 Bacteria 5845
43 Ga0105239_10116038 3300010375 Bacteria 2971
44 Ga0157371_10000005 3300013102 Bacteria 416456
45 Ga0157370_10002453 3300013104 Bacteria 22378
46 Ga0214544_1013786 3300021320 Bacteria 9544
47 Ga0209435_100039 3300025206 Bacteria 116879
48 Ga0209436_100253 3300025208 Bacteria 24609
49 Ga0209437_100330 3300025233 Bacteria 59093
50 Ga0209646_1000137 3300025246 Bacteria 116791
51 Ga0209026_1000135 3300025250 Bacteria 117001
52 Ga0209759_1000154 3300025256 Bacteria 119427
53 Ga0209129_1000082 3300025258 Bacteria 183436
54 Ga0209129_1002275 3300025258 Bacteria 9588
55 Ga0209129_1002804 3300025258 Bacteria 8099
56 Ga0209129_1023153 3300025258 Bacteria 1112
57 Ga0209233_1000304 3300025261 Bacteria 59093
58 Ga0209673_1000005 3300025273 Bacteria 692788
59 Ga0209673_1000105 3300025273 Bacteria 186267
60 Ga0209673_1000452 3300025273 Bacteria 69726
61 Ga0209673_1018335 3300025273 Bacteria 2549
62 Ga0209130_1000022 3300025284 Bacteria 361244
63 Ga0209130_1000098 3300025284 Bacteria 142506
64 Ga0209675_1014396 3300025291 Bacteria 2411
65 Ga0209025_1000172 3300025294 Bacteria 160407
66 Ga0209025_1003180 3300025294 Bacteria 15933
67 Ga0209564_1000913 3300025295 Bacteria 38633
68 Ga0209564_1001253 3300025295 Bacteria 28159
69 Ga0209564_1006641 3300025295 Bacteria 6178
70 Ga0209758_1000380 3300025297 Bacteria 77252
71 Ga0209758_1007637 3300025297 Bacteria 7292
72 Ga0209758_1011169 3300025297 Bacteria 5241
73 Ga0209050_1003406 3300025298 Bacteria 11784
74 Ga0209256_1000281 3300025299 Bacteria 89636
75 Ga0209256_1000688 3300025299 Bacteria 45274
76 Ga0209256_1001129 3300025299 Bacteria 30423
77 Ga0209256_1007249 3300025299 Bacteria 5536
78 Ga0207426_1000005 3300025302 Bacteria 1037188
79 Ga0207426_1000069 3300025302 Bacteria 334513
80 Ga0207426_1000350 3300025302 Bacteria 84510
81 Ga0209051_1000027 3300025303 Bacteria 412172
82 Ga0209051_1001030 3300025303 Bacteria 26476
83 Ga0209257_1001771 3300025304 Bacteria 23907
84 Ga0209257_1009039 3300025304 Bacteria 5458
85 Ga0207702_10095101 3300026078 Bacteria 2617
86 Ga0209371_1001420 3300027312 Bacteria 16321
87 Ga0209371_1002392 3300027312 Bacteria 10593
88 Ga0268256_1000478 3300030500 Bacteria 34415
89 Ga0307405_10003864 3300031731 Bacteria 6982
90 Ga0307405_10158512 3300031731 Bacteria 1600
91 Ga0307409_100427370 3300031995 Bacteria 1272
92 Ga0395905_0627101 3300037471 Bacteria 977
93 Ga0439465_0005562 3300041413 Bacteria 4016
94 Ga0439465_0042685 3300041413 Bacteria 1470
95 Ga0439465_0074720 3300041413 Bacteria 1140
96 Ga0451833_0158004 3300041491 Bacteria 3670
97 Ga0451837_0907937 3300041494 Bacteria 1427
98 Ga0451845_0536694 3300041501 Bacteria 4593
99 Ga0451847_0808972 3300041503 Bacteria 1869
100 Ga0451843_1155251 3300041509 Bacteria 995
101 Ga0451853_3257089 3300041512 Bacteria 1709
102 Ga0466969_0049562 3300044656 Bacteria 2072
103 Ga0466966_0025375 3300044684 Bacteria 3872
104 Ga0466963_0000526 3300044694 Bacteria 17929
105 Ga0466970_0000549 3300044765 Bacteria 18375
106 Ga0466957_0003532 3300044842 Bacteria 8605
107 Ga0466959_0051236 3300045049 Bacteria 3029
108 Ga0466958_0022798 3300045836 Bacteria 3670
109 Ga0466967_0007975 3300045976 Bacteria 7706
110 Ga0495617_014738 3300046452 Bacteria 2655
111 Ga0495638_0215439 3300046460 Bacteria 1076
112 Ga0495607_0026357 3300046501 Bacteria 3606
113 Ga0495583_0025787 3300046506 Bacteria 2930
114 Ga0495610_0006123 3300046512 Bacteria 8384
115 Ga0495610_0024033 3300046512 Bacteria 3296
116 Ga0495616_0010680 3300046513 Bacteria 5304
117 Ga0495620_0051716 3300046515 Bacteria 1747
118 Ga0495637_0004068 3300046520 Bacteria 7635
119 Ga0495643_0020523 3300046522 Bacteria 3808
120 Ga0495643_0060245 3300046522 Bacteria 2015
121 Ga0495597_0040892 3300046542 Bacteria 2072
122 Ga0495622_0006938 3300046557 Bacteria 5258
123 Ga0495633_0114132 3300046558 Bacteria 1252
124 Ga0495625_0004199 3300046660 Bacteria 13726
125 Ga0495625_0083609 3300046660 Bacteria 2218
126 Ga0495625_0149712 3300046660 Bacteria 1569
127 Ga0495588_0022081 3300046674 Bacteria 3143
128 Ga0495649_0041228 3300046694 Bacteria 2526
129 Ga0495660_0024572 3300046810 Bacteria 3431
130 Ga0495636_0139184 3300047318 Bacteria 1083
131 Ga0495687_005742 3300047443 Bacteria 7801
132 Ga0495679_010372 3300047446 Bacteria 3660
133 Ga0495673_0040295 3300047469 Bacteria 2112
134 Ga0495681_0002860 3300047470 Bacteria 12195
135 Ga0496112_0009464 3300048915 Bacteria 8782
136 Ga0496116_0039796 3300048919 Bacteria 3245
137 Ga0496117_0000489 3300048920 Bacteria 65533
138 Ga0496118_0011436 3300048921 Bacteria 8664
139 Ga0496118_0208644 3300048921 Bacteria 1149
140 Ga0496121_0033567 3300048924 Bacteria 4640
141 Ga0496121_0067294 3300048924 Bacteria 2904
142 Ga0496121_0074239 3300048924 Bacteria 2721
143 Ga0496121_0104297 3300048924 Bacteria 2179
144 Ga0496122_0004845 3300048925 Bacteria 16391
145 Ga0496122_0005943 3300048925 Bacteria 14286
146 Ga0496122_0006544 3300048925 Bacteria 13325
147 Ga0496123_0002585 3300048926 Bacteria 22022
148 Ga0496123_0008836 3300048926 Bacteria 9181
149 Ga0496124_0009989 3300048927 Bacteria 9692
150 Ga0496124_0015244 3300048927 Bacteria 7377
151 Ga0496124_0189737 3300048927 Bacteria 1574
152 Ga0496125_0000083 3300048928 Bacteria 227168
153 Ga0496125_0080068 3300048928 Bacteria 2501
154 Ga0496126_0068927 3300048929 Bacteria 3156
155 Ga0496126_0165152 3300048929 Bacteria 1890
156 Ga0496126_0317875 3300048929 Bacteria 1280
157 Ga0495682_0014930 3300049460 Bacteria 2943
158 Ga0501032_0253990 3300049569 Bacteria 1141
159 Ga0501033_0022199 3300049570 Bacteria 4789
160 Ga0501043_0149785 3300049579 Bacteria 1826
161 Ga0501047_0173353 3300049581 Bacteria 2026
162 Ga0501047_0334830 3300049581 Bacteria 1352
163 Ga0501069_0060769 3300049585 Bacteria 2110
164 Ga0501073_0042329 3300049589 Bacteria 3215
165 Ga0501074_0230008 3300049590 Bacteria 1320
166 Ga0501035_0129659 3300049822 Bacteria 2199
167 Ga0501044_0075423 3300049823 Bacteria 3424
168 Ga0501044_0325598 3300049823 Bacteria 1460
169 nmdc:mga00v17_22_c1 3300050491 Bacteria 108510
170 nmdc:mga00v17_83727_c1 3300050491 Bacteria 1995
171 nmdc:mga0yw44_2227_c1 3300050492 Bacteria 8173
172 nmdc:mga0k408_162568_c1 3300050493 Bacteria 1330
173 nmdc:mga07m45_75074_c1 3300050496 Bacteria 1926
174 nmdc:mga05p37_243228_c1 3300050507 Bacteria 2162
175 nmdc:mga0sz30_925_c1 3300050516 Bacteria 10574
176 Ga0500569_009805 3300053109 Bacteria 2235
177 Ga0500618_000638 3300053125 Bacteria 21126
178 Ga0500658_0000932 3300053134 Bacteria 11919
179 Ga0500658_0130226 3300053134 Bacteria 1121
180 Ga0500659_0141151 3300053135 Bacteria 1209
181 Ga0500616_0028484 3300053153 Bacteria 3077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0074720 Ga0439465_0074720_234_1109 275
2 3300049581 Ga0501047_0334830 Ga0501047_0334830_21_851 276
3 3300037471 Ga0395905_0627101 Ga0395905_0627101_34_882 282
4 3300049569 Ga0501032_0253990 Ga0501032_0253990_243_1115 290
5 3300041509 Ga0451843_1155251 Ga0451843_1155251_13_888 291
6 3300046558 Ga0495633_0114132 Ga0495633_0114132_338_1213 291
7 3300044656 Ga0466969_0049562 Ga0466969_0049562_297_1310 294
8 3300031731 Ga0307405_10003864 Ga0307405_100038645 301
9 3300049823 Ga0501044_0325598 Ga0501044_0325598_460_1440 301
10 3300025258 Ga0209129_1023153 Ga0209129_10231531 304
11 3300025297 Ga0209758_1007637 Ga0209758_10076375 304
12 3300048919 Ga0496116_0039796 Ga0496116_0039796_1739_2752 304
13 3300048924 Ga0496121_0067294 Ga0496121_0067294_321_1313 304
14 3300053134 Ga0500658_0000932 Ga0500658_0000932_7255_8247 304
15 3300049589 Ga0501073_0042329 Ga0501073_0042329_517_1506 305
16 3300049590 Ga0501074_0230008 Ga0501074_0230008_211_1191 305
17 3300002773 JGI25152J39213_1000943 JGI25152J39213_10009434 308
18 3300003790 Ga0055528_1000266 Ga0055528_100026622 308
19 3300025258 Ga0209129_1000082 Ga0209129_100008264 308
20 3300025273 Ga0209673_1000005 Ga0209673_100000585 308
21 3300025294 Ga0209025_1000172 Ga0209025_1000172123 308
22 3300025295 Ga0209564_1006641 Ga0209564_10066412 308
23 3300025299 Ga0209256_1000688 Ga0209256_100068818 308
24 3300041491 Ga0451833_0158004 Ga0451833_0158004_630_1622 308
25 3300041501 Ga0451845_0536694 Ga0451845_0536694_2145_3137 308
26 3300041512 Ga0451853_3257089 Ga0451853_3257089_671_1663 308
27 3300046660 Ga0495625_0083609 Ga0495625_0083609_417_1409 308
28 3300049585 Ga0501069_0060769 Ga0501069_0060769_59_1048 308
29 3300006177 Ga0075362_10000396 Ga0075362_100003969 311
30 3300006186 Ga0075369_10070741 Ga0075369_100707411 311
31 3300013104 Ga0157370_10002453 Ga0157370_1000245323 311
32 3300025294 Ga0209025_1003180 Ga0209025_100318017 311
33 3300048929 Ga0496126_0317875 Ga0496126_0317875_80_1093 311
34 3300050491 nmdc:mga00v17_22_c1 nmdc:mga00v17_22_c1_47301_48314 311
35 3300050492 nmdc:mga0yw44_2227_c1 nmdc:mga0yw44_2227_c1_4003_5016 311
36 3300050516 nmdc:mga0sz30_925_c1 nmdc:mga0sz30_925_c1_5283_6296 311
37 3300006195 Ga0075366_10001529 Ga0075366_100015294 312
38 3300046520 Ga0495637_0004068 Ga0495637_0004068_5228_6244 312
39 3300046674 Ga0495588_0022081 Ga0495588_0022081_2047_3063 312
40 3300050496 nmdc:mga07m45_75074_c1 nmdc:mga07m45_75074_c1_704_1696 312
41 3300003374 JGI25161J50226_1002195 JGI25161J50226_10021953 313
42 3300003771 Ga0055526_1002351 Ga0055526_100235111 313
43 3300003775 Ga0055524_1005074 Ga0055524_10050745 313
44 3300003790 Ga0055528_1000982 Ga0055528_10009828 313
45 3300003792 Ga0055540_1008931 Ga0055540_10089313 313
46 3300004625 Ga0055543_1008031 Ga0055543_10080312 313
47 3300005262 Ga0065165_1014439 Ga0065165_10144393 313
48 3300006177 Ga0075362_10002642 Ga0075362_100026426 313
49 3300006178 Ga0075367_10009169 Ga0075367_100091695 313
50 3300006186 Ga0075369_10003478 Ga0075369_100034783 313
51 3300009765 Ga0123341_1002056 Ga0123341_10020566 313
52 3300009766 Ga0123342_1017752 Ga0123342_10177522 313
53 3300025273 Ga0209673_1000105 Ga0209673_100010557 313
54 3300025291 Ga0209675_1014396 Ga0209675_10143961 313
55 3300025295 Ga0209564_1000913 Ga0209564_100091333 313
56 3300025299 Ga0209256_1000281 Ga0209256_100028168 313
57 3300025299 Ga0209256_1001129 Ga0209256_100112915 313
58 3300025302 Ga0207426_1000350 Ga0207426_100035015 313
59 3300025303 Ga0209051_1001030 Ga0209051_100103014 313
60 3300041503 Ga0451847_0808972 Ga0451847_0808972_660_1652 313
61 3300046557 Ga0495622_0006938 Ga0495622_0006938_511_1527 313
62 3300002739 JGI25158J39367_1000174 JGI25158J39367_100017410 316
63 3300003354 JGI25160J50197_1004640 JGI25160J50197_10046403 316
64 3300004625 Ga0055543_1000036 Ga0055543_100003610 316
65 3300025208 Ga0209436_100253 Ga0209436_1002539 316
66 3300025284 Ga0209130_1000022 Ga0209130_100002222 316
67 3300025302 Ga0207426_1000005 Ga0207426_1000005224 316
68 iso_pu_bacteria 2834578030 2834578493 321
69 iso_pu_bacteria 2842402390 2842405775 323
70 iso_pu_bacteria 2842409023 2842412358 323
71 iso_pu_bacteria 2842415677 2842419004 323
72 iso_pu_bacteria 2889790730 2889794029 325
73 iso_pu_bacteria 2889914905 2889915720 325
74 iso_pu_bacteria 2509276021 2509390742 326
75 iso_pu_bacteria 2509276033 2509442045 326
76 iso_pu_bacteria 2510065019 2510136350 326
77 iso_pu_bacteria 2510461076 2510892634 326
78 iso_pu_bacteria 2513237093 2513630491 326
79 iso_pu_bacteria 2513237103 2513711253 326
80 iso_pu_bacteria 2513237162 2514018493 326
81 iso_pu_bacteria 2515075009 2515108705 326
82 iso_pu_bacteria 2515154113 2515632569 326
83 iso_pu_bacteria 2515154116 2515656580 326
84 iso_pu_bacteria 2515154134 2515738188 326
85 iso_pu_bacteria 2516653077 2517040638 326
86 iso_pu_bacteria 2517093000 2517098267 326
87 iso_pu_bacteria 2529292951 2530648913 326
88 iso_pu_bacteria 2585427526 2585530005 326
89 iso_pu_bacteria 2585427528 2585543460 326
90 iso_pu_bacteria 2585427593 2585841924 326
91 iso_pu_bacteria 2585427633 2585993714 326
92 iso_pu_bacteria 2585427634 2586004563 326
93 iso_pu_bacteria 2615840624 2616297841 326
94 iso_pu_bacteria 2643221618 2644107106 326
95 iso_pu_bacteria 2643221655 2644311411 326
96 iso_pu_bacteria 2643221712 2644617086 326
97 iso_pu_bacteria 2718217882 2719184676 326
98 iso_pu_bacteria 2718217997 2719668669 326
99 iso_pu_bacteria 2718218009 2719728696 326
100 iso_pu_bacteria 2718218199 2720489362 326
101 iso_pu_bacteria 2718218232 2720610036 326
102 iso_pu_bacteria 2718218233 2720617460 326
103 iso_pu_bacteria 2718218235 2720628606 326
104 iso_pu_bacteria 2718218269 2720772556 326
105 iso_pu_bacteria 2718218363 2721144387 326
106 iso_pu_bacteria 2718218365 2721156340 326
107 iso_pu_bacteria 2718218366 2721161757 326
108 iso_pu_bacteria 2721755514 2722842902 326
109 iso_pu_bacteria 2721755556 2723029995 326
110 iso_pu_bacteria 2721755684 2723564400 326
111 iso_pu_bacteria 2721755685 2723569959 326
112 iso_pu_bacteria 2721755810 2724041721 326
113 iso_pu_bacteria 2721755819 2724092585 326
114 iso_pu_bacteria 2721755822 2724101506 326
115 iso_pu_bacteria 2721755823 2724112968 326
116 iso_pu_bacteria 2724679232 2725949614 326
117 iso_pu_bacteria 2728369352 2730110528 326
118 iso_pu_bacteria 2728369365 2730160791 326
119 iso_pu_bacteria 2728369397 2730295873 326
120 iso_pu_bacteria 2738541333 2739035363 326
121 iso_pu_bacteria 2765235942 2766069106 326
122 iso_pu_bacteria 2791355256 2793297827 326
123 iso_pu_bacteria 2791355259 2793312619 326
124 iso_pu_bacteria 2791355262 2793337557 326
125 iso_pu_bacteria 2791355264 2793345566 326
126 iso_pu_bacteria 2791355265 2793354974 326
127 iso_pu_bacteria 2791355266 2793363714 326
128 iso_pu_bacteria 2791355267 2793370350 326
129 iso_pu_bacteria 2802429605 2805927235 326
130 iso_pu_bacteria 2802429606 2805934337 326
131 iso_pu_bacteria 2802429633 2806048285 326
132 iso_pu_bacteria 2802429634 2806056070 326
133 iso_pu_bacteria 2802429635 2806062887 326
134 iso_pu_bacteria 2802429636 2806070491 326
135 iso_pu_bacteria 2802429637 2806077401 326
136 iso_pu_bacteria 2838022645 2838025311 326
137 iso_pu_bacteria 2838068647 2838068664 326
138 iso_pu_bacteria 2838074704 2838078445 326
139 iso_pu_bacteria 2838668709 2838669450 326
140 iso_pu_bacteria 2838701080 2838701821 326
141 iso_pu_bacteria 2839993093 2839995533 326
142 iso_pu_bacteria 2840764183 2840770465 326
143 iso_pu_bacteria 2841864319 2841865944 326
144 iso_pu_bacteria 2842163707 2842164135 326
145 iso_pu_bacteria 2842192696 2842196090 326
146 iso_pu_bacteria 2842198810 2842200877 326
147 iso_pu_bacteria 2842205361 2842209741 326
148 iso_pu_bacteria 2842217011 2842219901 326
149 iso_pu_bacteria 2842250916 2842251755 326
150 iso_pu_bacteria 2842264693 2842264995 326
151 iso_pu_bacteria 2842278818 2842283195 326
152 iso_pu_bacteria 2842317721 2842320155 326
153 iso_pu_bacteria 2842341865 2842347691 326
154 iso_pu_bacteria 2842363717 2842364190 326
155 iso_pu_bacteria 2842395702 2842397196 326
156 iso_pu_bacteria 2842422224 2842422810 326
157 iso_pu_bacteria 2842428310 2842428951 326
158 iso_pu_bacteria 2842434925 2842435565 326
159 iso_pu_bacteria 2842441272 2842441573 326
160 iso_pu_bacteria 2842462802 2842463376 326
161 iso_pu_bacteria 2842469257 2842469895 326
162 iso_pu_bacteria 2842489311 2842489731 326
163 iso_pu_bacteria 2842495871 2842498225 326
164 iso_pu_bacteria 2854916844 2854917252 326
165 iso_pu_bacteria 2933599457 2933600282 326
166 iso_pu_bacteria 2935901341 2935903236 326
167 iso_pu_bacteria 2936367885 2936374461 326
168 iso_pu_bacteria 2937843397 2937845857 326
169 iso_pu_bacteria 2954011201 2954015526 326
170 iso_pu_bacteria 2961170736 2961173102 326
171 iso_pu_bacteria 2970503327 2970505696 326
172 iso_pu_bacteria 2979808191 2979810417 326
173 iso_pu_bacteria 2996310559 2996312232 326
174 iso_pu_bacteria 639633055 639644825 326
175 iso_pu_bacteria 8005282627 8005288502 326
176 iso_pu_bacteria 8005289223 8005290494 326
177 iso_pu_bacteria 8005301065 8005301087 326
178 iso_pu_bacteria 8005307578 8005308005 326
179 iso_pu_bacteria 8005376324 8005379734 326
180 iso_pu_bacteria 8005430974 8005431420 326
181 iso_pu_bacteria 8005460587 8005467121 326
182 iso_pu_bacteria 8005497431 8005502909 326
183 iso_pu_bacteria 8005570704 8005571599 326
184 iso_pu_bacteria 8005619151 8005624060 326
185 iso_pu_bacteria 8005626139 8005629325 326
186 iso_pu_bacteria 8005668836 8005674339 326
187 iso_pu_bacteria 8005688590 8005689099 326
188 iso_pu_bacteria 8005695170 8005697824 326
189 iso_pu_bacteria 8018127388 8018132112 326
190 iso_pu_bacteria 8023680758 8023681830 326
191 iso_pu_bacteria 8024479707 8024482330 326
192 iso_pu_bacteria 8024501048 8024507258 326
193 iso_pu_bacteria 8056375014 8056377875 326
194 iso_pu_bacteria 8056382006 8056382541 326
195 iso_pu_bacteria 8057874678 8057878173 326
196 3300046515 Ga0495620_0051716 Ga0495620_0051716_646_1629 327
197 iso_pu_bacteria 2899259804 2899260161 327
198 3300005355 Ga0070671_100093290 Ga0070671_1000932902 329
199 3300009147 Ga0114129_10191383 Ga0114129_101913832 329
200 3300010375 Ga0105239_10116038 Ga0105239_101160382 329
201 3300048915 Ga0496112_0009464 Ga0496112_0009464_13_1002 329
202 3300050491 nmdc:mga00v17_83727_c1 nmdc:mga00v17_83727_c1_527_1516 329
203 3300050507 nmdc:mga05p37_243228_c1 nmdc:mga05p37_243228_c1_604_1593 329
204 3300003187 JGI25151J46595_10002908 JGI25151J46595_100029085 330
205 3300003790 Ga0055528_1026329 Ga0055528_10263292 330
206 3300003792 Ga0055540_1000096 Ga0055540_100009676 330
207 3300021320 Ga0214544_1013786 Ga0214544_10137865 330
208 3300025258 Ga0209129_1002275 Ga0209129_10022756 330
209 3300025273 Ga0209673_1000452 Ga0209673_100045261 330
210 3300025297 Ga0209758_1000380 Ga0209758_100038054 330
211 3300025298 Ga0209050_1003406 Ga0209050_10034067 330
212 3300025303 Ga0209051_1000027 Ga0209051_100002787 330
213 3300025304 Ga0209257_1001771 Ga0209257_10017716 330
214 3300041413 Ga0439465_0042685 Ga0439465_0042685_124_1116 330
215 3300041494 Ga0451837_0907937 Ga0451837_0907937_69_1061 330
216 3300046460 Ga0495638_0215439 Ga0495638_0215439_71_1063 330
217 3300046512 Ga0495610_0024033 Ga0495610_0024033_755_1747 330
218 3300046513 Ga0495616_0010680 Ga0495616_0010680_547_1539 330
219 3300046522 Ga0495643_0020523 Ga0495643_0020523_915_1907 330
220 3300046542 Ga0495597_0040892 Ga0495597_0040892_728_1720 330
221 3300046660 Ga0495625_0149712 Ga0495625_0149712_306_1298 330
222 3300046694 Ga0495649_0041228 Ga0495649_0041228_1199_2191 330
223 3300046810 Ga0495660_0024572 Ga0495660_0024572_335_1327 330
224 3300047318 Ga0495636_0139184 Ga0495636_0139184_12_1004 330
225 3300049570 Ga0501033_0022199 Ga0501033_0022199_478_1470 330
226 3300049579 Ga0501043_0149785 Ga0501043_0149785_184_1176 330
227 3300049581 Ga0501047_0173353 Ga0501047_0173353_294_1286 330
228 3300049822 Ga0501035_0129659 Ga0501035_0129659_177_1169 330
229 3300049823 Ga0501044_0075423 Ga0501044_0075423_1189_2181 330
230 3300053109 Ga0500569_009805 Ga0500569_009805_889_1881 330
231 3300053134 Ga0500658_0130226 Ga0500658_0130226_98_1090 330
232 3300053135 Ga0500659_0141151 Ga0500659_0141151_168_1160 330
233 3300053153 Ga0500616_0028484 Ga0500616_0028484_547_1539 330
234 iso_pu_bacteria 2537561587 2537874903 331
235 iso_pu_bacteria 2554235003 2554244235 331
236 iso_pu_bacteria 2558860242 2559297933 331
237 iso_pu_bacteria 2599185210 2599603953 331
238 iso_pu_bacteria 2643221582 2643917898 331
239 iso_pu_bacteria 2643221693 2644522437 331
240 iso_pu_bacteria 2808606387 2808989735 331
241 iso_pu_bacteria 2841859092 2841860958 331
242 iso_pu_bacteria 2842515876 2842518775 331
243 iso_pu_bacteria 2854896431 2854900097 331
244 iso_pu_bacteria 2894232714 2894239427 331
245 iso_pu_bacteria 2899792073 2899793421 331
246 iso_pu_bacteria 2899845264 2899848300 331
247 iso_pu_bacteria 2926754445 2926757525 331
248 iso_pu_bacteria 2926760298 2926764889 331
249 iso_pu_bacteria 2933011516 2933014401 331
250 iso_pu_bacteria 2933594066 2933597007 331
251 iso_pu_bacteria 650716007 650842340 331
252 iso_pu_bacteria 8003570095 8003573540 331
253 iso_pu_bacteria 8005382845 8005383503 331
254 iso_pu_bacteria 2524023209 2524457360 332
255 iso_pu_bacteria 2582581315 2585328709 332
256 iso_pu_bacteria 2582581316 2585335606 332
257 iso_pu_bacteria 2585427608 2585899977 332
258 iso_pu_bacteria 2615840698 2616555706 332
259 iso_pu_bacteria 2751185800 2753357884 332
260 iso_pu_bacteria 2758568016 2758640493 332
261 iso_pu_bacteria 2818991448 2819610981 332
262 iso_pu_bacteria 2818991453 2819642533 332
263 iso_pu_bacteria 2838029111 2838031645 332
264 iso_pu_bacteria 2842298080 2842299084 332
265 iso_pu_bacteria 2842357229 2842358550 332
266 iso_pu_bacteria 2842475841 2842478377 332
267 iso_pu_bacteria 2842502639 2842505677 332
268 iso_pu_bacteria 2842509118 2842511945 332
269 iso_pu_bacteria 2852387548 2852395007 332
270 iso_pu_bacteria 2854911287 2854913501 332
271 iso_pu_bacteria 2915650412 2915652350 332
272 iso_pu_bacteria 3005416602 3005422338 332
273 iso_pu_bacteria 8005314921 8005320325 332
274 iso_pu_bacteria 8005484373 8005488051 332
275 iso_pu_bacteria 8005645114 8005651627 332
276 iso_pu_bacteria 8005682033 8005685939 332
277 iso_pu_bacteria 8057575449 8057576273 332
278 3300003771 Ga0055526_1004568 Ga0055526_10045687 335
279 3300003790 Ga0055528_1010913 Ga0055528_10109133 335
280 3300003792 Ga0055540_1007666 Ga0055540_10076662 335
281 3300003856 Ga0058692_1003270 Ga0058692_10032702 335
282 3300013102 Ga0157371_10000005 Ga0157371_1000000550 335
283 3300025258 Ga0209129_1002804 Ga0209129_10028044 335
284 3300025273 Ga0209673_1018335 Ga0209673_10183352 335
285 3300025295 Ga0209564_1001253 Ga0209564_10012534 335
286 3300025297 Ga0209758_1011169 Ga0209758_10111693 335
287 3300025299 Ga0209256_1007249 Ga0209256_10072492 335
288 3300025304 Ga0209257_1009039 Ga0209257_10090393 335
289 3300027312 Ga0209371_1001420 Ga0209371_10014208 335
290 3300030500 Ga0268256_1000478 Ga0268256_100047811 335
291 3300031731 Ga0307405_10158512 Ga0307405_101585122 335
292 3300031995 Ga0307409_100427370 Ga0307409_1004273701 335
293 3300041413 Ga0439465_0005562 Ga0439465_0005562_1146_2159 335
294 3300047470 Ga0495681_0002860 Ga0495681_0002860_8017_9030 335
295 3300048920 Ga0496117_0000489 Ga0496117_0000489_13046_14059 335
296 3300048921 Ga0496118_0011436 Ga0496118_0011436_4380_5393 335
297 3300048921 Ga0496118_0208644 Ga0496118_0208644_75_1088 335
298 3300048924 Ga0496121_0033567 Ga0496121_0033567_2370_3383 335
299 3300048924 Ga0496121_0074239 Ga0496121_0074239_1372_2385 335
300 3300048925 Ga0496122_0004845 Ga0496122_0004845_6561_7574 335
301 3300048926 Ga0496123_0002585 Ga0496123_0002585_19500_20513 335
302 3300048927 Ga0496124_0009989 Ga0496124_0009989_6962_7975 335
303 3300048927 Ga0496124_0015244 Ga0496124_0015244_5951_6964 335
304 3300048929 Ga0496126_0068927 Ga0496126_0068927_1645_2658 335
305 3300050493 nmdc:mga0k408_162568_c1 nmdc:mga0k408_162568_c1_306_1319 335
306 3300002704 JGI25155J39150_1000043 JGI25155J39150_100004321 336
307 3300002705 JGI25156J39149_1000056 JGI25156J39149_100005661 336
308 3300002737 JGI25162J39368_1000661 JGI25162J39368_10006618 336
309 3300002738 JGI25154J39366_1000086 JGI25154J39366_100008621 336
310 3300002741 JGI25157J39369_1000086 JGI25157J39369_100008661 336
311 3300002987 JGI25159J45721_1000461 JGI25159J45721_100046112 336
312 3300003214 JGI25165J46597_1000604 JGI25165J46597_10006049 336
313 3300003322 rootL2_10020236 rootL2_100202367 336
314 3300003323 rootH1_10057386 rootH1_100573862 336
315 3300003354 JGI25160J50197_1000248 JGI25160J50197_100024812 336
316 3300003374 JGI25161J50226_1000183 JGI25161J50226_100018332 336
317 3300004625 Ga0055543_1000245 Ga0055543_100024532 336
318 3300005262 Ga0065165_1001012 Ga0065165_100101212 336
319 3300025206 Ga0209435_100039 Ga0209435_10003926 336
320 3300025233 Ga0209437_100330 Ga0209437_10033032 336
321 3300025246 Ga0209646_1000137 Ga0209646_100013785 336
322 3300025250 Ga0209026_1000135 Ga0209026_100013526 336
323 3300025256 Ga0209759_1000154 Ga0209759_100015485 336
324 3300025261 Ga0209233_1000304 Ga0209233_100030432 336
325 3300025284 Ga0209130_1000098 Ga0209130_1000098129 336
326 3300025302 Ga0207426_1000069 Ga0207426_1000069131 336
327 3300026078 Ga0207702_10095101 Ga0207702_100951012 336
328 3300027312 Ga0209371_1002392 Ga0209371_10023925 336
329 3300044684 Ga0466966_0025375 Ga0466966_0025375_758_1774 336
330 3300044694 Ga0466963_0000526 Ga0466963_0000526_1708_2724 336
331 3300044765 Ga0466970_0000549 Ga0466970_0000549_14867_15883 336
332 3300044842 Ga0466957_0003532 Ga0466957_0003532_2131_3147 336
333 3300045049 Ga0466959_0051236 Ga0466959_0051236_1577_2593 336
334 3300045836 Ga0466958_0022798 Ga0466958_0022798_867_1883 336
335 3300045976 Ga0466967_0007975 Ga0466967_0007975_5044_6060 336
336 3300046452 Ga0495617_014738 Ga0495617_014738_471_1487 336
337 3300046501 Ga0495607_0026357 Ga0495607_0026357_1383_2399 336
338 3300046506 Ga0495583_0025787 Ga0495583_0025787_1157_2173 336
339 3300046512 Ga0495610_0006123 Ga0495610_0006123_2503_3519 336
340 3300046522 Ga0495643_0060245 Ga0495643_0060245_132_1148 336
341 3300046660 Ga0495625_0004199 Ga0495625_0004199_10091_11107 336
342 3300047443 Ga0495687_005742 Ga0495687_005742_1950_2966 336
343 3300047446 Ga0495679_010372 Ga0495679_010372_2025_3041 336
344 3300047469 Ga0495673_0040295 Ga0495673_0040295_987_2003 336
345 3300048924 Ga0496121_0104297 Ga0496121_0104297_907_1923 336
346 3300048925 Ga0496122_0005943 Ga0496122_0005943_13158_14174 336
347 3300048925 Ga0496122_0006544 Ga0496122_0006544_6572_7588 336
348 3300048926 Ga0496123_0008836 Ga0496123_0008836_5192_6208 336
349 3300048927 Ga0496124_0189737 Ga0496124_0189737_146_1162 336
350 3300048928 Ga0496125_0000083 Ga0496125_0000083_37711_38727 336
351 3300048928 Ga0496125_0080068 Ga0496125_0080068_1408_2424 336
352 3300048929 Ga0496126_0165152 Ga0496126_0165152_179_1195 336
353 3300049460 Ga0495682_0014930 Ga0495682_0014930_1811_2827 336
354 3300053125 Ga0500618_000638 Ga0500618_000638_8555_9571 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02423

OCD_Mu_crystall

Ornithine cyclodeaminase/mu-crystallin family

3

323

0.96

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

121

254

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1omo-assembly1.cif.gz_B alanine dehydrogenase dimer w/bound nad (archaeal) 0.9609 2 331
1omo-assembly1.cif.gz_B alanine dehydrogenase dimer w/bound nad (archaeal) 0.958 2 331
6rqa-assembly1.cif.gz_B crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with nad+ 0.9492 3 330
6rqa-assembly1.cif.gz_B crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with nad+ 0.9435 3 330
6t3e-assembly1.cif.gz_A structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline 0.9405 5 328
ID Description Score Start End Superfamily
1vllA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 129 303 3.40.50.720
1vllA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 129 303 3.40.50.720
af_Q9HDZ0_133_310_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9346 134 303 3.40.50.720
1x7dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9214 129 303 3.40.50.720
af_Q9FLY0_138_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9188 139 303 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A848Y772-F1-model_v4 Cyclodeaminase 0.9763 56 330 GO:0005737
AF-A0A436CC16-F1-model_v4 Ectoine utilization protein EutC 0.9744 38 330 GO:0005737
AF-A0A1S7T3R3-F1-model_v4 deleted 0.9741 1 304
AF-A0A527WNU1-F1-model_v4 Ornithine cyclodeaminase family protein 0.9715 174 330 GO:0005737
AF-A0A440JEK7-F1-model_v4 deleted 0.9715 201 330

Feature Viewer

pLDDT pTM Quality
91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map