F419545

General Info

Members Datasets Scaffolds Average Seq Length
353 159 706 258

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0036686|Ga0501077_0036686_463_1341
Length 292
Sequence MVAAALGSWNVEPPLVFSLACAVLYWLGGRRQVSSRRLGLERRGRAALFYSGLAAIVLALDSPLDSLSSRLFAAHMTQHVLLLSVAPPLIVASAPWSRLWQPLPLDFRRAAARMVVLDPGWRLPRAAARELARPLPAFVLFNLNLLVWHVPALYDATLDNAAVHDLEHALFLLTGLLFWGQVIDSPPFRSRLDPLHRLAFVTGGIAVGWVLAIVLALARSPLYAAYASLDRRPGGLSALGDQQIAAGVMWVPGSLAFTIAFALILYRWLGPEPSASSAARPARLGVAGTTDS

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
63 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
64 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
65 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.46
Rhizosphere 87.54
Stem 0
Stem Tuber 0
Unclassified 16.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0036686 3300049593 Bacteria 3124
2 Ga0070658_10058473 3300005327 Bacteria 3138
3 Ga0070683_100017716 3300005329 Bacteria 6294
4 Ga0070683_100071029 3300005329 Bacteria 3248
5 Ga0070682_100248114 3300005337 Bacteria 1282
6 Ga0070660_100003251 3300005339 Bacteria 11151
7 Ga0070691_10082620 3300005341 Bacteria 1575
8 Ga0070692_10021953 3300005345 Bacteria 3112
9 Ga0070671_100115446 3300005355 Bacteria 2257
10 Ga0070659_100055070 3300005366 Bacteria 3133
11 Ga0070709_10011371 3300005434 Bacteria 4960
12 Ga0070709_10029862 3300005434 Unclassified 3265
13 Ga0070714_100005331 3300005435 Bacteria 9805
14 Ga0070714_100010935 3300005435 Bacteria 7187
15 Ga0070714_100075505 3300005435 Bacteria 2924
16 Ga0070714_100104472 3300005435 Unclassified 2500
17 Ga0070714_100335087 3300005435 Bacteria 1418
18 Ga0070713_100045335 3300005436 Bacteria 3602
19 Ga0070713_100113221 3300005436 Bacteria 2368
20 Ga0070713_100495212 3300005436 Unclassified 1153
21 Ga0070710_10016139 3300005437 Bacteria 3795
22 Ga0070710_10020817 3300005437 Bacteria 3409
23 Ga0070711_100026239 3300005439 Unclassified 3817
24 Ga0070708_100629082 3300005445 Bacteria 1012
25 Ga0070681_10008810 3300005458 Bacteria 9905
26 Ga0070681_10197242 3300005458 Bacteria 1932
27 Ga0070707_100000445 3300005468 Bacteria 40989
28 Ga0070707_100400350 3300005468 Bacteria 1333
29 Ga0070699_100441815 3300005518 Bacteria 1179
30 Ga0070679_100394056 3300005530 Bacteria 1331
31 Ga0070695_100001141 3300005545 Bacteria 14557
32 Ga0068855_100354164 3300005563 Bacteria 1616
33 Ga0068856_100009230 3300005614 Bacteria 9593
34 Ga0068856_100487001 3300005614 Bacteria 1254
35 Ga0070717_10002428 3300006028 Bacteria 13160
36 Ga0070717_10018542 3300006028 Bacteria 5437
37 Ga0070717_10044431 3300006028 Bacteria 3627
38 Ga0070717_10142211 3300006028 Bacteria 2070
39 Ga0070715_10000206 3300006163 Bacteria 13864
40 Ga0070716_100003710 3300006173 Bacteria 7232
41 Ga0070712_100055442 3300006175 Bacteria 2776
42 Ga0070712_100080346 3300006175 Unclassified 2360
43 Ga0105240_10021245 3300009093 Bacteria 8639
44 Ga0105240_10118207 3300009093 Bacteria 3195
45 Ga0157369_10003395 3300013105 Bacteria 18891
46 Ga0157369_10030605 3300013105 Bacteria 5935
47 Ga0206353_11131675 3300020082 Bacteria 4141
48 Ga0207692_10030235 3300025898 Bacteria 2581
49 Ga0207685_10007702 3300025905 Bacteria 3019
50 Ga0207699_10057033 3300025906 Bacteria 2331
51 Ga0207699_10137008 3300025906 Unclassified 1604
52 Ga0207705_10040844 3300025909 Bacteria 3327
53 Ga0207707_10086718 3300025912 Bacteria 2735
54 Ga0207707_10152985 3300025912 Bacteria 2017
55 Ga0207695_10057963 3300025913 Bacteria 4022
56 Ga0207695_10223659 3300025913 Bacteria 1789
57 Ga0207693_10006828 3300025915 Bacteria 9428
58 Ga0207693_10014121 3300025915 Bacteria 6431
59 Ga0207693_10078170 3300025915 Unclassified 2590
60 Ga0207663_10052861 3300025916 Bacteria 2535
61 Ga0207660_10452814 3300025917 Unclassified 1038
62 Ga0207657_10019430 3300025919 Bacteria 6452
63 Ga0207649_10189708 3300025920 Unclassified 1445
64 Ga0207652_10033882 3300025921 Bacteria 4302
65 Ga0207652_10158676 3300025921 Bacteria 2027
66 Ga0207646_10001908 3300025922 Bacteria 25106
67 Ga0207646_10301445 3300025922 Bacteria 1448
68 Ga0207694_10079137 3300025924 Bacteria 2578
69 Ga0207700_10089689 3300025928 Bacteria 2424
70 Ga0207700_10102143 3300025928 Bacteria 2289
71 Ga0207664_10004541 3300025929 Bacteria 9408
72 Ga0207664_10012474 3300025929 Bacteria 6078
73 Ga0207664_10026732 3300025929 Bacteria 4364
74 Ga0207664_10042412 3300025929 Bacteria 3551
75 Ga0207664_10496867 3300025929 Bacteria 1092
76 Ga0207690_10078151 3300025932 Bacteria 2302
77 Ga0207665_10001018 3300025939 Bacteria 18916
78 Ga0207661_10009909 3300025944 Bacteria 6843
79 Ga0207661_10028281 3300025944 Bacteria 4291
80 Ga0207667_10075984 3300025949 Bacteria 3487
81 Ga0207702_10088476 3300026078 Bacteria 2706
82 Ga0207702_10292745 3300026078 Bacteria 1543
83 Ga0265319_1008281 3300028563 Bacteria 4574
84 Ga0265318_10002281 3300028577 Bacteria 10313
85 Ga0265338_10002292 3300028800 Bacteria 29139
86 Ga0265338_10010581 3300028800 Bacteria 10789
87 Ga0265330_10061815 3300031235 Bacteria 1629
88 Ga0265332_10037631 3300031238 Bacteria 2098
89 Ga0265340_10140426 3300031247 Bacteria 1105
90 Ga0265339_10028738 3300031249 Bacteria 3159
91 Ga0265331_10029868 3300031250 Bacteria 2717
92 Ga0265316_10033504 3300031344 Bacteria 4182
93 Ga0265313_10033222 3300031595 Bacteria 2625
94 Ga0265314_10088301 3300031711 Bacteria 2025
95 Ga0373926_0014692 3300035083 Unclassified 2664
96 Ga0373945_0010503 3300035116 Unclassified 3049
97 Ga0373953_0057256 3300035117 Unclassified 1587
98 Ga0373943_0016781 3300035170 Bacteria 3345
99 Ga0373955_0132356 3300035172 Bacteria 1457
100 Ga0373933_0179809 3300035724 Bacteria 1349
101 Ga0373933_0208981 3300035724 Unclassified 1250
102 Ga0373947_0001831 3300035725 Bacteria 13012
103 Ga0373937_0000308 3300036401 Bacteria 46115
104 Ga0373937_0137164 3300036401 Bacteria 2288
105 Ga0373925_0001399 3300037068 Bacteria 20978
106 Ga0395898_0016031 3300037466 Bacteria 7675
107 Ga0466969_0104584 3300044656 Unclassified 1330
108 Ga0466969_0135518 3300044656 Bacteria 1140
109 Ga0466965_0026089 3300044683 Bacteria 2832
110 Ga0466965_0035903 3300044683 Bacteria 2430
111 Ga0466965_0041896 3300044683 Bacteria 2257
112 Ga0466965_0115071 3300044683 Unclassified 1385
113 Ga0466965_0160923 3300044683 Bacteria 1177
114 Ga0466961_0027277 3300044693 Bacteria 3672
115 Ga0466961_0092366 3300044693 Bacteria 1910
116 Ga0466963_0000063 3300044694 Bacteria 36209
117 Ga0466963_0000532 3300044694 Bacteria 17888
118 Ga0466963_0001170 3300044694 Bacteria 13766
119 Ga0466963_0001668 3300044694 Bacteria 12099
120 Ga0466963_0004971 3300044694 Bacteria 7757
121 Ga0466963_0011702 3300044694 Bacteria 5348
122 Ga0466963_0014976 3300044694 Bacteria 4792
123 Ga0466963_0019756 3300044694 Bacteria 4231
124 Ga0466963_0034635 3300044694 Bacteria 3286
125 Ga0466963_0046265 3300044694 Unclassified 2868
126 Ga0466963_0121702 3300044694 Unclassified 1796
127 Ga0466963_0169061 3300044694 Unclassified 1523
128 Ga0466964_0003765 3300044706 Bacteria 5559
129 Ga0466964_0005765 3300044706 Bacteria 4611
130 Ga0466964_0006123 3300044706 Bacteria 4485
131 Ga0466964_0015575 3300044706 Bacteria 2895
132 Ga0466964_0035232 3300044706 Bacteria 2000
133 Ga0466964_0052463 3300044706 Unclassified 1676
134 Ga0466971_0042618 3300044719 Unclassified 2039
135 Ga0466971_0089893 3300044719 Unclassified 1406
136 Ga0466968_0001349 3300044735 Bacteria 8764
137 Ga0466968_0014749 3300044735 Bacteria 3092
138 Ga0466968_0080645 3300044735 Bacteria 1429
139 Ga0466968_0117917 3300044735 Bacteria 1199
140 Ga0466970_0007339 3300044765 Bacteria 5522
141 Ga0466970_0011625 3300044765 Bacteria 4490
142 Ga0466970_0164263 3300044765 Unclassified 1229
143 Ga0466957_0002652 3300044842 Bacteria 9652
144 Ga0466957_0004191 3300044842 Bacteria 7991
145 Ga0466957_0028597 3300044842 Bacteria 3320
146 Ga0466957_0090061 3300044842 Bacteria 1921
147 Ga0466957_0534817 3300044842 Bacteria 815
148 Ga0466960_0032173 3300044901 Bacteria 2426
149 Ga0466960_0058099 3300044901 Bacteria 1888
150 Ga0466959_0013020 3300045049 Bacteria 6023
151 Ga0466959_0029532 3300045049 Bacteria 4062
152 Ga0466959_0034770 3300045049 Bacteria 3727
153 Ga0466958_0001870 3300045836 Bacteria 10285
154 Ga0466958_0003196 3300045836 Bacteria 8449
155 Ga0466958_0023014 3300045836 Bacteria 3653
156 Ga0466958_0043660 3300045836 Bacteria 2700
157 Ga0466958_0264241 3300045836 Bacteria 1102
158 Ga0466967_0000058 3300045976 Bacteria 40166
159 Ga0466967_0005094 3300045976 Bacteria 9023
160 Ga0466967_0005619 3300045976 Bacteria 8722
161 Ga0466967_0005902 3300045976 Bacteria 8583
162 Ga0466967_0007306 3300045976 Bacteria 7955
163 Ga0466967_0014251 3300045976 Bacteria 6184
164 Ga0466967_0023190 3300045976 Bacteria 5082
165 Ga0466967_0028569 3300045976 Bacteria 4657
166 Ga0466967_0031544 3300045976 Bacteria 4462
167 Ga0466967_0032831 3300045976 Bacteria 4388
168 Ga0466967_0042443 3300045976 Bacteria 3930
169 Ga0466967_0078644 3300045976 Bacteria 2971
170 Ga0466967_0186735 3300045976 Bacteria 1957
171 Ga0466967_0189870 3300045976 Bacteria 1941
172 Ga0466967_0205776 3300045976 Unclassified 1865
173 Ga0466967_0418092 3300045976 Bacteria 1306
174 Ga0466967_0434709 3300045976 Bacteria 1281
175 Ga0495592_0000410 3300046454 Bacteria 32753
176 Ga0495592_0108371 3300046454 Unclassified 1969
177 Ga0495592_0189853 3300046454 Bacteria 1393
178 Ga0495603_0011158 3300046455 Bacteria 5447
179 Ga0495603_0054422 3300046455 Unclassified 2372
180 Ga0495629_0037098 3300046459 Bacteria 3435
181 Ga0495629_0171099 3300046459 Bacteria 1507
182 Ga0495641_0013433 3300046461 Bacteria 4501
183 Ga0495641_0090884 3300046461 Bacteria 1364
184 Ga0495641_0128383 3300046461 Unclassified 1132
185 Ga0495651_0000034 3300046462 Bacteria 99213
186 Ga0495651_0001663 3300046462 Bacteria 17191
187 Ga0495651_0077030 3300046462 Bacteria 2525
188 Ga0495651_0286723 3300046462 Unclassified 1110
189 Ga0495653_0021748 3300046463 Bacteria 5193
190 Ga0495653_0032276 3300046463 Bacteria 4159
191 Ga0495653_0046315 3300046463 Bacteria 3368
192 Ga0495653_0051721 3300046463 Bacteria 3152
193 Ga0495653_0081468 3300046463 Bacteria 2392
194 Ga0495653_0263602 3300046463 Unclassified 1138
195 Ga0495580_0023243 3300046472 Bacteria 4555
196 Ga0495582_0038249 3300046473 Unclassified 2640
197 Ga0495582_0064107 3300046473 Unclassified 2028
198 Ga0495582_0307704 3300046473 Bacteria 911
199 Ga0495662_0007413 3300046476 Bacteria 5421
200 Ga0495664_0185423 3300046477 Unclassified 1261
201 Ga0495608_0001004 3300046511 Bacteria 19861
202 Ga0495608_0079165 3300046511 Bacteria 2137
203 Ga0495608_0087874 3300046511 Unclassified 2013
204 Ga0495608_0125233 3300046511 Unclassified 1646
205 Ga0495618_0002873 3300046514 Bacteria 10921
206 Ga0495618_0019528 3300046514 Bacteria 4170
207 Ga0495618_0255193 3300046514 Unclassified 1099
208 Ga0495628_0000184 3300046516 Bacteria 54832
209 Ga0495628_0106808 3300046516 Unclassified 2156
210 Ga0495630_0080898 3300046517 Bacteria 2451
211 Ga0495630_0083167 3300046517 Unclassified 2416
212 Ga0495630_0094514 3300046517 Bacteria 2260
213 Ga0495630_0524254 3300046517 Bacteria 908
214 Ga0495666_0001186 3300046526 Bacteria 12548
215 Ga0495652_0000319 3300046529 Bacteria 56845
216 Ga0495652_0018524 3300046529 Bacteria 6207
217 Ga0495665_0003054 3300046531 Bacteria 9046
218 Ga0495640_0007089 3300046533 Bacteria 8819
219 Ga0495640_0029579 3300046533 Bacteria 3931
220 Ga0495640_0067748 3300046533 Unclassified 2403
221 Ga0495587_0000055 3300046536 Bacteria 97024
222 Ga0495645_0000170 3300046543 Bacteria 45455
223 Ga0495645_0013468 3300046543 Bacteria 5782
224 Ga0495667_0054143 3300046559 Bacteria 2641
225 Ga0495667_0185672 3300046559 Bacteria 1333
226 Ga0495667_0274122 3300046559 Bacteria 1071
227 Ga0495634_0001802 3300046642 Bacteria 18504
228 Ga0495634_0156959 3300046642 Bacteria 1436
229 Ga0495634_0228203 3300046642 Unclassified 1146
230 Ga0495635_0005146 3300046663 Bacteria 9104
231 Ga0495635_0018050 3300046663 Bacteria 4926
232 Ga0495657_0012293 3300046675 Bacteria 6362
233 Ga0495657_0041290 3300046675 Bacteria 3158
234 Ga0495657_0061656 3300046675 Bacteria 2480
235 Ga0495599_0001220 3300046678 Bacteria 14572
236 Ga0495599_0004281 3300046678 Bacteria 8437
237 Ga0495599_0081653 3300046678 Unclassified 2019
238 Ga0495599_0179408 3300046678 Bacteria 1306
239 Ga0495623_0000149 3300046679 Bacteria 42958
240 Ga0495646_0008095 3300046680 Bacteria 6684
241 Ga0495646_0057444 3300046680 Unclassified 2329
242 Ga0495647_0001212 3300046681 Bacteria 7962
243 Ga0495647_0074914 3300046681 Bacteria 1361
244 Ga0495658_0007560 3300046683 Bacteria 5385
245 Ga0495658_0018980 3300046683 Bacteria 3584
246 Ga0495613_0019064 3300046689 Bacteria 5113
247 Ga0495613_0269869 3300046689 Bacteria 1184
248 Ga0495613_0274913 3300046689 Bacteria 1171
249 Ga0495624_0023583 3300046690 Bacteria 4057
250 Ga0495624_0170558 3300046690 Unclassified 1327
251 Ga0495600_0009590 3300046809 Bacteria 5986
252 Ga0495581_0014615 3300047315 Bacteria 4551
253 Ga0495604_0000019 3300047317 Bacteria 175064
254 Ga0495604_0000194 3300047317 Bacteria 54877
255 Ga0495604_0178040 3300047317 Bacteria 1489
256 Ga0495604_0216733 3300047317 Bacteria 1320
257 Ga0495674_0090914 3300047319 Unclassified 2607
258 Ga0495674_0307144 3300047319 Bacteria 1295
259 Ga0495674_0316381 3300047319 Bacteria 1272
260 Ga0495676_0022056 3300047321 Bacteria 5549
261 Ga0495680_0001661 3300047322 Bacteria 23654
262 Ga0495680_0032358 3300047322 Bacteria 4246
263 Ga0495680_0039745 3300047322 Bacteria 3751
264 Ga0495680_0158639 3300047322 Bacteria 1644
265 Ga0495680_0231844 3300047322 Bacteria 1314
266 Ga0495675_0000029 3300047444 Bacteria 105305
267 Ga0495684_0010365 3300047471 Bacteria 7210
268 Ga0495684_0051230 3300047471 Bacteria 3151
269 Ga0495684_0124647 3300047471 Bacteria 1938
270 Ga0495684_0319407 3300047471 Bacteria 1110
271 Ga0495593_0000750 3300047673 Bacteria 18855
272 Ga0495602_0000741 3300048088 Bacteria 30911
273 Ga0495614_0000802 3300048089 Bacteria 13308
274 Ga0496101_0080143 3300048904 Bacteria 2411
275 Ga0496101_0108310 3300048904 Unclassified 2089
276 Ga0496101_0705992 3300048904 Unclassified 796
277 Ga0496102_0008004 3300048905 Bacteria 9034
278 Ga0496102_0026730 3300048905 Bacteria 5151
279 Ga0496102_0109461 3300048905 Bacteria 2574
280 Ga0496103_0013564 3300048906 Bacteria 4833
281 Ga0496104_0020783 3300048907 Bacteria 6020
282 Ga0496104_0029797 3300048907 Bacteria 5065
283 Ga0496104_0090178 3300048907 Bacteria 2929
284 Ga0496104_0162282 3300048907 Bacteria 2143
285 Ga0496104_0629895 3300048907 Unclassified 982
286 Ga0496105_0002189 3300048908 Bacteria 14153
287 Ga0496105_0013935 3300048908 Bacteria 6390
288 Ga0496105_0036127 3300048908 Bacteria 4069
289 Ga0496105_0061013 3300048908 Bacteria 3111
290 Ga0496105_0338907 3300048908 Unclassified 1202
291 Ga0496106_0005421 3300048909 Bacteria 9436
292 Ga0496106_0007960 3300048909 Bacteria 7831
293 Ga0496106_0100344 3300048909 Bacteria 2245
294 Ga0496106_0271450 3300048909 Unclassified 1358
295 Ga0496107_0012567 3300048910 Bacteria 5912
296 Ga0496108_0006809 3300048911 Bacteria 9249
297 Ga0496108_0050383 3300048911 Bacteria 3485
298 Ga0496109_0004307 3300048912 Bacteria 11885
299 Ga0496109_0115606 3300048912 Unclassified 2496
300 Ga0496109_0132008 3300048912 Bacteria 2331
301 Ga0496109_0155816 3300048912 Unclassified 2139
302 Ga0496109_0171171 3300048912 Bacteria 2037
303 Ga0496111_0047464 3300048914 Unclassified 3093
304 Ga0496111_0085527 3300048914 Bacteria 2306
305 Ga0496112_0026522 3300048915 Bacteria 5576
306 Ga0496112_0056886 3300048915 Bacteria 3850
307 Ga0496112_0269951 3300048915 Unclassified 1649
308 Ga0496112_0528943 3300048915 Bacteria 1113
309 Ga0496113_0023803 3300048916 Bacteria 4346
310 Ga0496113_0112546 3300048916 Bacteria 2120
311 Ga0496113_0165001 3300048916 Unclassified 1752
312 Ga0496113_0262202 3300048916 Bacteria 1380
313 Ga0496114_0043431 3300048917 Bacteria 3727
314 Ga0496114_0063168 3300048917 Bacteria 3100
315 Ga0496114_0133306 3300048917 Bacteria 2147
316 Ga0496115_0049714 3300048918 Bacteria 3357
317 Ga0496115_0059236 3300048918 Bacteria 3083
318 Ga0501046_0264138 3300049580 Unclassified 1264
319 Ga0501047_0032715 3300049581 Bacteria 5021
320 Ga0501069_0057507 3300049585 Unclassified 2168
321 Ga0501070_0002407 3300049586 Bacteria 16412
322 Ga0501070_0020590 3300049586 Bacteria 5532
323 Ga0501070_0196119 3300049586 Bacteria 1658
324 Ga0501072_0003796 3300049588 Bacteria 11406
325 Ga0501073_0028864 3300049589 Bacteria 3964
326 Ga0501073_0128591 3300049589 Unclassified 1756
327 Ga0501074_0003478 3300049590 Bacteria 11175
328 Ga0501074_0023194 3300049590 Bacteria 4514
329 Ga0501079_0094077 3300049741 Bacteria 2322
330 Ga0501079_0107968 3300049741 Bacteria 2161
331 Ga0501080_0019143 3300049742 Bacteria 6340
332 Ga0501080_0240715 3300049742 Bacteria 1651
333 Ga0501080_0246063 3300049742 Unclassified 1631
334 Ga0501081_0024386 3300049743 Bacteria 4061
335 Ga0501083_0000442 3300049744 Bacteria 26662
336 Ga0501035_0118069 3300049822 Bacteria 2321
337 Ga0501045_0066827 3300049824 Bacteria 2639
338 Ga0495601_0000082 3300053077 Bacteria 51242
339 Ga0495601_0006082 3300053077 Bacteria 7041
340 Ga0495601_0101277 3300053077 Unclassified 1860
341 Ga0495601_0105907 3300053077 Unclassified 1818
342 Ga0495601_0260686 3300053077 Bacteria 1131
343 Ga0495612_0028757 3300053078 Bacteria 2239
344 Ga0495595_0007038 3300053084 Bacteria 4595
345 Ga0495595_0010756 3300053084 Bacteria 3812
346 Ga0495595_0082406 3300053084 Bacteria 1534
347 Ga0495619_0004172 3300053085 Bacteria 9228
348 Ga0495619_0012968 3300053085 Bacteria 5251
349 Ga0495619_0082351 3300053085 Bacteria 2169
350 Ga0495619_0147294 3300053085 Unclassified 1623
351 Ga0501082_0165713 3300060353 Bacteria 1920
352 Ga0466962_0001028 3300061719 Bacteria 12768
353 Ga0466962_0002528 3300061719 Bacteria 8686
354 Ga0501077_0036686
355 Ga0070658_10058473
356 Ga0070683_100017716
357 Ga0070683_100071029
358 Ga0070682_100248114
359 Ga0070660_100003251
360 Ga0070691_10082620
361 Ga0070692_10021953
362 Ga0070671_100115446
363 Ga0070659_100055070
364 Ga0070709_10011371
365 Ga0070709_10029862
366 Ga0070714_100005331
367 Ga0070714_100010935
368 Ga0070714_100075505
369 Ga0070714_100104472
370 Ga0070714_100335087
371 Ga0070713_100045335
372 Ga0070713_100113221
373 Ga0070713_100495212
374 Ga0070710_10016139
375 Ga0070710_10020817
376 Ga0070711_100026239
377 Ga0070708_100629082
378 Ga0070681_10008810
379 Ga0070681_10197242
380 Ga0070707_100000445
381 Ga0070707_100400350
382 Ga0070699_100441815
383 Ga0070679_100394056
384 Ga0070695_100001141
385 Ga0068855_100354164
386 Ga0068856_100009230
387 Ga0068856_100487001
388 Ga0070717_10002428
389 Ga0070717_10018542
390 Ga0070717_10044431
391 Ga0070717_10142211
392 Ga0070715_10000206
393 Ga0070716_100003710
394 Ga0070712_100055442
395 Ga0070712_100080346
396 Ga0105240_10021245
397 Ga0105240_10118207
398 Ga0157369_10003395
399 Ga0157369_10030605
400 Ga0206353_11131675
401 Ga0207692_10030235
402 Ga0207685_10007702
403 Ga0207699_10057033
404 Ga0207699_10137008
405 Ga0207705_10040844
406 Ga0207707_10086718
407 Ga0207707_10152985
408 Ga0207695_10057963
409 Ga0207695_10223659
410 Ga0207693_10006828
411 Ga0207693_10014121
412 Ga0207693_10078170
413 Ga0207663_10052861
414 Ga0207660_10452814
415 Ga0207657_10019430
416 Ga0207649_10189708
417 Ga0207652_10033882
418 Ga0207652_10158676
419 Ga0207646_10001908
420 Ga0207646_10301445
421 Ga0207694_10079137
422 Ga0207700_10089689
423 Ga0207700_10102143
424 Ga0207664_10004541
425 Ga0207664_10012474
426 Ga0207664_10026732
427 Ga0207664_10042412
428 Ga0207664_10496867
429 Ga0207690_10078151
430 Ga0207665_10001018
431 Ga0207661_10009909
432 Ga0207661_10028281
433 Ga0207667_10075984
434 Ga0207702_10088476
435 Ga0207702_10292745
436 Ga0265319_1008281
437 Ga0265318_10002281
438 Ga0265338_10002292
439 Ga0265338_10010581
440 Ga0265330_10061815
441 Ga0265332_10037631
442 Ga0265340_10140426
443 Ga0265339_10028738
444 Ga0265331_10029868
445 Ga0265316_10033504
446 Ga0265313_10033222
447 Ga0265314_10088301
448 Ga0373926_0014692
449 Ga0373945_0010503
450 Ga0373953_0057256
451 Ga0373943_0016781
452 Ga0373955_0132356
453 Ga0373933_0179809
454 Ga0373933_0208981
455 Ga0373947_0001831
456 Ga0373937_0000308
457 Ga0373937_0137164
458 Ga0373925_0001399
459 Ga0395898_0016031
460 Ga0466969_0104584
461 Ga0466969_0135518
462 Ga0466965_0026089
463 Ga0466965_0035903
464 Ga0466965_0041896
465 Ga0466965_0115071
466 Ga0466965_0160923
467 Ga0466961_0027277
468 Ga0466961_0092366
469 Ga0466963_0000063
470 Ga0466963_0000532
471 Ga0466963_0001170
472 Ga0466963_0001668
473 Ga0466963_0004971
474 Ga0466963_0011702
475 Ga0466963_0014976
476 Ga0466963_0019756
477 Ga0466963_0034635
478 Ga0466963_0046265
479 Ga0466963_0121702
480 Ga0466963_0169061
481 Ga0466964_0003765
482 Ga0466964_0005765
483 Ga0466964_0006123
484 Ga0466964_0015575
485 Ga0466964_0035232
486 Ga0466964_0052463
487 Ga0466971_0042618
488 Ga0466971_0089893
489 Ga0466968_0001349
490 Ga0466968_0014749
491 Ga0466968_0080645
492 Ga0466968_0117917
493 Ga0466970_0007339
494 Ga0466970_0011625
495 Ga0466970_0164263
496 Ga0466957_0002652
497 Ga0466957_0004191
498 Ga0466957_0028597
499 Ga0466957_0090061
500 Ga0466957_0534817
501 Ga0466960_0032173
502 Ga0466960_0058099
503 Ga0466959_0013020
504 Ga0466959_0029532
505 Ga0466959_0034770
506 Ga0466958_0001870
507 Ga0466958_0003196
508 Ga0466958_0023014
509 Ga0466958_0043660
510 Ga0466958_0264241
511 Ga0466967_0000058
512 Ga0466967_0005094
513 Ga0466967_0005619
514 Ga0466967_0005902
515 Ga0466967_0007306
516 Ga0466967_0014251
517 Ga0466967_0023190
518 Ga0466967_0028569
519 Ga0466967_0031544
520 Ga0466967_0032831
521 Ga0466967_0042443
522 Ga0466967_0078644
523 Ga0466967_0186735
524 Ga0466967_0189870
525 Ga0466967_0205776
526 Ga0466967_0418092
527 Ga0466967_0434709
528 Ga0495592_0000410
529 Ga0495592_0108371
530 Ga0495592_0189853
531 Ga0495603_0011158
532 Ga0495603_0054422
533 Ga0495629_0037098
534 Ga0495629_0171099
535 Ga0495641_0013433
536 Ga0495641_0090884
537 Ga0495641_0128383
538 Ga0495651_0000034
539 Ga0495651_0001663
540 Ga0495651_0077030
541 Ga0495651_0286723
542 Ga0495653_0021748
543 Ga0495653_0032276
544 Ga0495653_0046315
545 Ga0495653_0051721
546 Ga0495653_0081468
547 Ga0495653_0263602
548 Ga0495580_0023243
549 Ga0495582_0038249
550 Ga0495582_0064107
551 Ga0495582_0307704
552 Ga0495662_0007413
553 Ga0495664_0185423
554 Ga0495608_0001004
555 Ga0495608_0079165
556 Ga0495608_0087874
557 Ga0495608_0125233
558 Ga0495618_0002873
559 Ga0495618_0019528
560 Ga0495618_0255193
561 Ga0495628_0000184
562 Ga0495628_0106808
563 Ga0495630_0080898
564 Ga0495630_0083167
565 Ga0495630_0094514
566 Ga0495630_0524254
567 Ga0495666_0001186
568 Ga0495652_0000319
569 Ga0495652_0018524
570 Ga0495665_0003054
571 Ga0495640_0007089
572 Ga0495640_0029579
573 Ga0495640_0067748
574 Ga0495587_0000055
575 Ga0495645_0000170
576 Ga0495645_0013468
577 Ga0495667_0054143
578 Ga0495667_0185672
579 Ga0495667_0274122
580 Ga0495634_0001802
581 Ga0495634_0156959
582 Ga0495634_0228203
583 Ga0495635_0005146
584 Ga0495635_0018050
585 Ga0495657_0012293
586 Ga0495657_0041290
587 Ga0495657_0061656
588 Ga0495599_0001220
589 Ga0495599_0004281
590 Ga0495599_0081653
591 Ga0495599_0179408
592 Ga0495623_0000149
593 Ga0495646_0008095
594 Ga0495646_0057444
595 Ga0495647_0001212
596 Ga0495647_0074914
597 Ga0495658_0007560
598 Ga0495658_0018980
599 Ga0495613_0019064
600 Ga0495613_0269869
601 Ga0495613_0274913
602 Ga0495624_0023583
603 Ga0495624_0170558
604 Ga0495600_0009590
605 Ga0495581_0014615
606 Ga0495604_0000019
607 Ga0495604_0000194
608 Ga0495604_0178040
609 Ga0495604_0216733
610 Ga0495674_0090914
611 Ga0495674_0307144
612 Ga0495674_0316381
613 Ga0495676_0022056
614 Ga0495680_0001661
615 Ga0495680_0032358
616 Ga0495680_0039745
617 Ga0495680_0158639
618 Ga0495680_0231844
619 Ga0495675_0000029
620 Ga0495684_0010365
621 Ga0495684_0051230
622 Ga0495684_0124647
623 Ga0495684_0319407
624 Ga0495593_0000750
625 Ga0495602_0000741
626 Ga0495614_0000802
627 Ga0496101_0080143
628 Ga0496101_0108310
629 Ga0496101_0705992
630 Ga0496102_0008004
631 Ga0496102_0026730
632 Ga0496102_0109461
633 Ga0496103_0013564
634 Ga0496104_0020783
635 Ga0496104_0029797
636 Ga0496104_0090178
637 Ga0496104_0162282
638 Ga0496104_0629895
639 Ga0496105_0002189
640 Ga0496105_0013935
641 Ga0496105_0036127
642 Ga0496105_0061013
643 Ga0496105_0338907
644 Ga0496106_0005421
645 Ga0496106_0007960
646 Ga0496106_0100344
647 Ga0496106_0271450
648 Ga0496107_0012567
649 Ga0496108_0006809
650 Ga0496108_0050383
651 Ga0496109_0004307
652 Ga0496109_0115606
653 Ga0496109_0132008
654 Ga0496109_0155816
655 Ga0496109_0171171
656 Ga0496111_0047464
657 Ga0496111_0085527
658 Ga0496112_0026522
659 Ga0496112_0056886
660 Ga0496112_0269951
661 Ga0496112_0528943
662 Ga0496113_0023803
663 Ga0496113_0112546
664 Ga0496113_0165001
665 Ga0496113_0262202
666 Ga0496114_0043431
667 Ga0496114_0063168
668 Ga0496114_0133306
669 Ga0496115_0049714
670 Ga0496115_0059236
671 Ga0501046_0264138
672 Ga0501047_0032715
673 Ga0501069_0057507
674 Ga0501070_0002407
675 Ga0501070_0020590
676 Ga0501070_0196119
677 Ga0501072_0003796
678 Ga0501073_0028864
679 Ga0501073_0128591
680 Ga0501074_0003478
681 Ga0501074_0023194
682 Ga0501079_0094077
683 Ga0501079_0107968
684 Ga0501080_0019143
685 Ga0501080_0240715
686 Ga0501080_0246063
687 Ga0501081_0024386
688 Ga0501083_0000442
689 Ga0501035_0118069
690 Ga0501045_0066827
691 Ga0495601_0000082
692 Ga0495601_0006082
693 Ga0495601_0101277
694 Ga0495601_0105907
695 Ga0495601_0260686
696 Ga0495612_0028757
697 Ga0495595_0007038
698 Ga0495595_0010756
699 Ga0495595_0082406
700 Ga0495619_0004172
701 Ga0495619_0012968
702 Ga0495619_0082351
703 Ga0495619_0147294
704 Ga0501082_0165713
705 Ga0466962_0001028
706 Ga0466962_0002528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09678

Caa3_CtaG

Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG)

23

270

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.4111 106 234
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.3885 106 234
6wkt-assembly1.cif.gz_A cu(i)-bound copper storage protein bscsp3 0.3571 117 236
7mjq-assembly1.cif.gz_G vascular katp channel: kir6.1 sur2b quatrefoil-like conformation 2 0.3475 55 239
5vov-assembly1.cif.gz_H structure of ampa receptor-tarp complex 0.3399 107 239
ID Description Score Start End Superfamily
af_B4FUV0_1_167_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4445 108 239 1.20.140.150
af_O61200_26_295_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.437 12 239 1.20.1070.10
af_A0A2R8QQ76_61_215_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4272 114 239 1.20.140.150
af_Q2FWH7_385_490_1.20.120.620 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Backbone structure of the membrane domain of e. Coli histidine kinase receptor kdpd, 0.4238 114 240 1.20.120.620
af_Q5Z976_74_282_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4217 29 236 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A538LFA1-F1-model_v4 Cytochrome c oxidase assembly protein 0.9543 1 259 GO:0005886
AF-A0A538LFA1-F1-model_v4 Cytochrome c oxidase assembly protein 0.9505 1 259 GO:0005886
AF-A0A535RRU2-F1-model_v4 Cytochrome c oxidase assembly protein 0.9478 1 239 GO:0005886
AF-A0A535U1J4-F1-model_v4 Cytochrome c oxidase assembly protein 0.9456 1 236 GO:0005886
AF-A0A3L7WXI4-F1-model_v4 Cytochrome c oxidase assembly protein 0.9411 1 239 GO:0005886

Map