F419521

General Info

Members Datasets Scaffolds Average Seq Length
353 217 352 121

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0081380|Ga0496115_0081380_1335_1763
Length 142
Sequence MSHGKRALADWTTGAEAIVYQSCAACGSLQYFHRSFCRACGAPDPIEKRASGEGTVYAASLVVRAATPETRAHVPYNIVLVDTVEGFRMMAHGDNDLAIGDRVTARFSQFAGRLVPYFARTKIMRVRSASRRKHESFTASKR

Samples

Sample ID Description Type Environment
1 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
213 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.57
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 0.57
Rhizoplane 4.53
Rhizosphere 86.12
Stem 0
Stem Tuber 0
Unclassified 4.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10272979 3300005327 Bacteria 1438
2 Ga0070658_11882770 3300005327 Bacteria 517
3 Ga0070683_100742190 3300005329 Bacteria 940
4 Ga0068869_100237607 3300005334 Bacteria 1450
5 Ga0070680_100299541 3300005336 Bacteria 1363
6 Ga0070682_101595303 3300005337 Bacteria 564
7 Ga0070660_100202908 3300005339 Bacteria 1608
8 Ga0070660_101258581 3300005339 Bacteria 628
9 Ga0070691_11045128 3300005341 Bacteria 512
10 Ga0070661_100330157 3300005344 Bacteria 1193
11 Ga0070659_100258555 3300005366 Bacteria 1444
12 Ga0070659_100771689 3300005366 Bacteria 835
13 Ga0070709_10027055 3300005434 Bacteria 3407
14 Ga0070714_100009368 3300005435 Bacteria 7692
15 Ga0070713_100878518 3300005436 Bacteria 862
16 Ga0070710_10001763 3300005437 Bacteria 10233
17 Ga0070711_100117471 3300005439 Bacteria 1962
18 Ga0070711_100685897 3300005439 Bacteria 861
19 Ga0070711_101115876 3300005439 Bacteria 680
20 Ga0070708_101277783 3300005445 Bacteria 686
21 Ga0070678_101943558 3300005456 Bacteria 556
22 Ga0070681_10884500 3300005458 Bacteria 811
23 Ga0070681_10992158 3300005458 Bacteria 759
24 Ga0070698_100092442 3300005471 Bacteria 3006
25 Ga0070679_100053808 3300005530 Bacteria 4007
26 Ga0070684_100033234 3300005535 Bacteria 4402
27 Ga0068853_100383179 3300005539 Bacteria 1313
28 Ga0068855_100103017 3300005563 Bacteria 3284
29 Ga0068855_100483496 3300005563 Bacteria 1347
30 Ga0070664_100228334 3300005564 Bacteria 1668
31 Ga0070664_100590211 3300005564 Bacteria 1030
32 Ga0068857_100539889 3300005577 Bacteria 1097
33 Ga0068852_100793577 3300005616 Bacteria 961
34 Ga0068861_101211100 3300005719 Bacteria 731
35 Ga0068870_10742686 3300005840 Bacteria 681
36 Ga0068863_100281738 3300005841 Bacteria 1610
37 Ga0068863_102211994 3300005841 Bacteria 560
38 Ga0068862_101455233 3300005844 Bacteria 689
39 Ga0081540_1009547 3300005983 Bacteria 6676
40 Ga0070717_10209346 3300006028 Bacteria 1711
41 Ga0070717_10295670 3300006028 Bacteria 1439
42 Ga0070715_10063913 3300006163 Bacteria 1624
43 Ga0070716_100003007 3300006173 Bacteria 7861
44 Ga0070716_100183489 3300006173 Bacteria 1376
45 Ga0070716_100785545 3300006173 Bacteria 736
46 Ga0070712_100156427 3300006175 Bacteria 1756
47 Ga0070712_100253605 3300006175 Bacteria 1407
48 Ga0097621_100595575 3300006237 Bacteria 1010
49 Ga0075434_101340786 3300006871 Bacteria 726
50 Ga0099794_10048953 3300007265 Bacteria 2030
51 Ga0099795_10010931 3300007788 Bacteria 2693
52 Ga0099795_10025533 3300007788 Bacteria 1982
53 Ga0105240_10017726 3300009093 Bacteria 9589
54 Ga0105240_10055947 3300009093 Bacteria 4938
55 Ga0105247_10050654 3300009101 Bacteria 2555
56 Ga0105247_11207017 3300009101 Bacteria 603
57 Ga0105247_11336612 3300009101 Bacteria 577
58 Ga0105241_10607857 3300009174 Bacteria 988
59 Ga0105237_10354550 3300009545 Bacteria 1471
60 Ga0105238_10025601 3300009551 Bacteria 6015
61 Ga0099796_10158087 3300010159 Bacteria 897
62 Ga0099796_10204382 3300010159 Bacteria 803
63 Ga0105239_11230038 3300010375 Bacteria 863
64 Ga0105239_12859336 3300010375 Bacteria 563
65 Ga0157369_10291507 3300013105 Bacteria 1699
66 Ga0157374_12467589 3300013296 Bacteria 547
67 Ga0163162_11069237 3300013306 Bacteria 914
68 Ga0163163_12949408 3300014325 Bacteria 531
69 Ga0157380_12569922 3300014326 Bacteria 575
70 Ga0206356_11050083 3300020070 Bacteria 722
71 Ga0206353_11388822 3300020082 Bacteria 607
72 Ga0213872_10102510 3300021361 Bacteria 1275
73 Ga0207692_10090645 3300025898 Bacteria 1657
74 Ga0207692_10542400 3300025898 Bacteria 742
75 Ga0207710_10045971 3300025900 Bacteria 1948
76 Ga0207647_10109761 3300025904 Bacteria 1631
77 Ga0207685_10047868 3300025905 Bacteria 1635
78 Ga0207699_10020543 3300025906 Bacteria 3542
79 Ga0207699_10099121 3300025906 Bacteria 1845
80 Ga0207699_10222210 3300025906 Bacteria 1290
81 Ga0207645_10124744 3300025907 Bacteria 1673
82 Ga0207705_10935572 3300025909 Bacteria 671
83 Ga0207684_10501982 3300025910 Bacteria 1040
84 Ga0207654_10844869 3300025911 Bacteria 662
85 Ga0207707_10026196 3300025912 Bacteria 5097
86 Ga0207707_10894819 3300025912 Bacteria 734
87 Ga0207695_10145249 3300025913 Bacteria 2317
88 Ga0207695_10877815 3300025913 Bacteria 777
89 Ga0207671_10648365 3300025914 Bacteria 841
90 Ga0207693_10019854 3300025915 Bacteria 5344
91 Ga0207693_10177777 3300025915 Bacteria 1674
92 Ga0207693_10557940 3300025915 Bacteria 893
93 Ga0207663_10124942 3300025916 Bacteria 1768
94 Ga0207663_10265919 3300025916 Bacteria 1268
95 Ga0207663_10440562 3300025916 Bacteria 1003
96 Ga0207657_10028782 3300025919 Bacteria 5062
97 Ga0207657_10072825 3300025919 Bacteria 2905
98 Ga0207646_10697415 3300025922 Bacteria 908
99 Ga0207694_10905061 3300025924 Bacteria 746
100 Ga0207700_10007311 3300025928 Bacteria 6741
101 Ga0207700_10061225 3300025928 Bacteria 2854
102 Ga0207700_10569735 3300025928 Bacteria 1006
103 Ga0207700_11070450 3300025928 Bacteria 721
104 Ga0207690_10122192 3300025932 Bacteria 1893
105 Ga0207665_10006200 3300025939 Bacteria 7941
106 Ga0207665_10248825 3300025939 Bacteria 1313
107 Ga0207689_10127188 3300025942 Bacteria 2096
108 Ga0207661_10129699 3300025944 Bacteria 2158
109 Ga0207679_10205886 3300025945 Bacteria 1647
110 Ga0207679_10860039 3300025945 Bacteria 828
111 Ga0207667_10488671 3300025949 Bacteria 1249
112 Ga0207667_11470086 3300025949 Bacteria 653
113 Ga0207639_10038360 3300026041 Bacteria 3563
114 Ga0207639_11326640 3300026041 Bacteria 675
115 Ga0207674_10051145 3300026116 Bacteria 4217
116 Ga0209179_1032479 3300027512 Bacteria 1076
117 Ga0209588_1173628 3300027671 Bacteria 678
118 Ga0265330_10077434 3300031235 Bacteria 1435
119 Ga0265328_10098398 3300031239 Bacteria 1083
120 Ga0265340_10027514 3300031247 Bacteria 2866
121 Ga0265339_10288107 3300031249 Bacteria 785
122 Ga0265331_10335887 3300031250 Bacteria 677
123 Ga0265316_10262550 3300031344 Bacteria 1266
124 Ga0265316_10452124 3300031344 Bacteria 921
125 Ga0265316_10636518 3300031344 Bacteria 755
126 Ga0307509_10152918 3300031507 Bacteria 2219
127 Ga0307509_10268136 3300031507 Bacteria 1477
128 Ga0307508_10017025 3300031616 Bacteria 6611
129 Ga0307508_10135172 3300031616 Bacteria 2069
130 Ga0265342_10018394 3300031712 Bacteria 4528
131 Ga0307510_10024690 3300033180 Bacteria 6943
132 Ga0315911_1000006 3300033442 Bacteria 414563
133 Ga0373934_0036891 3300035086 Bacteria 1925
134 Ga0373934_0102765 3300035086 Bacteria 1156
135 Ga0373944_0075462 3300035089 Bacteria 1105
136 Ga0373923_0009238 3300035111 Bacteria 3552
137 Ga0373923_0028542 3300035111 Bacteria 2232
138 Ga0373936_0022020 3300035113 Bacteria 2481
139 Ga0373936_0052506 3300035113 Bacteria 1652
140 Ga0373936_0057211 3300035113 Bacteria 1586
141 Ga0373953_0001006 3300035117 Bacteria 7948
142 Ga0373953_0065434 3300035117 Bacteria 1492
143 Ga0373954_0001568 3300035118 Bacteria 9318
144 Ga0373956_0003001 3300035119 Bacteria 6835
145 Ga0373956_0147851 3300035119 Bacteria 1105
146 Ga0373957_0001326 3300035120 Bacteria 6654
147 Ga0373957_0098693 3300035120 Bacteria 1167
148 Ga0373943_0017885 3300035170 Bacteria 3250
149 Ga0373943_0027264 3300035170 Bacteria 2683
150 Ga0373943_0535947 3300035170 Bacteria 686
151 Ga0373946_0008929 3300035171 Bacteria 3684
152 Ga0373946_0069619 3300035171 Bacteria 1516
153 Ga0373955_0001817 3300035172 Bacteria 9170
154 Ga0373955_0048632 3300035172 Bacteria 2300
155 Ga0373924_0004760 3300035410 Bacteria 4763
156 Ga0373924_0030710 3300035410 Bacteria 2155
157 Ga0373931_0493197 3300035691 Bacteria 789
158 Ga0373935_0002430 3300035692 Bacteria 10661
159 Ga0373935_0041590 3300035692 Bacteria 2888
160 Ga0373935_0081502 3300035692 Bacteria 2104
161 Ga0373935_0262869 3300035692 Bacteria 1211
162 Ga0373927_0004184 3300035695 Bacteria 10138
163 Ga0373927_0040983 3300035695 Bacteria 3003
164 Ga0373933_0002116 3300035724 Bacteria 11404
165 Ga0373933_0123889 3300035724 Bacteria 1620
166 Ga0373947_0002441 3300035725 Bacteria 11206
167 Ga0373947_0177410 3300035725 Bacteria 1385
168 Ga0373937_0005719 3300036401 Bacteria 10677
169 Ga0373937_0046565 3300036401 Bacteria 3966
170 Ga0373937_0703090 3300036401 Bacteria 957
171 Ga0373925_0003313 3300037068 Bacteria 12515
172 Ga0373925_0027329 3300037068 Bacteria 4177
173 Ga0373925_0041898 3300037068 Bacteria 3396
174 Ga0373925_0124237 3300037068 Bacteria 2006
175 Ga0373925_0146731 3300037068 Bacteria 1850
176 Ga0373925_0866763 3300037068 Bacteria 744
177 Ga0436363_0995142 3300039450 Bacteria 582
178 Ga0451802_2085169 3300041460 Bacteria 803
179 Ga0451843_0714505 3300041509 Bacteria 1488
180 Ga0451853_1537720 3300041512 Bacteria 2614
181 Ga0466963_0079627 3300044694 Bacteria 2217
182 Ga0466957_0308854 3300044842 Bacteria 1064
183 Ga0495592_0005707 3300046454 Bacteria 9209
184 Ga0495592_0233493 3300046454 Bacteria 1223
185 Ga0495592_0274208 3300046454 Bacteria 1105
186 Ga0495603_0000147 3300046455 Bacteria 35043
187 Ga0495603_0027946 3300046455 Bacteria 3402
188 Ga0495603_0041016 3300046455 Bacteria 2769
189 Ga0495629_0000221 3300046459 Bacteria 50647
190 Ga0495629_0002680 3300046459 Bacteria 13629
191 Ga0495629_0204780 3300046459 Bacteria 1364
192 Ga0495641_0014903 3300046461 Bacteria 4186
193 Ga0495651_0007486 3300046462 Bacteria 8346
194 Ga0495651_0167198 3300046462 Bacteria 1569
195 Ga0495651_0297936 3300046462 Bacteria 1083
196 Ga0495651_0547529 3300046462 Bacteria 736
197 Ga0495653_0019482 3300046463 Bacteria 5502
198 Ga0495653_0174955 3300046463 Bacteria 1478
199 Ga0495650_0100469 3300046471 Bacteria 1087
200 Ga0495580_0010948 3300046472 Bacteria 7036
201 Ga0495582_0002170 3300046473 Bacteria 10980
202 Ga0495639_0000346 3300046475 Bacteria 22385
203 Ga0495662_0005862 3300046476 Bacteria 6144
204 Ga0495664_0053323 3300046477 Bacteria 2404
205 Ga0495664_0165906 3300046477 Bacteria 1340
206 Ga0495664_0245680 3300046477 Bacteria 1082
207 Ga0495664_0313710 3300046477 Bacteria 946
208 Ga0495594_0002462 3300046499 Bacteria 9633
209 Ga0495594_0744830 3300046499 Bacteria 553
210 Ga0495608_0024476 3300046511 Bacteria 4127
211 Ga0495608_0569673 3300046511 Bacteria 681
212 Ga0495628_0013526 3300046516 Bacteria 6863
213 Ga0495628_0086519 3300046516 Bacteria 2430
214 Ga0495628_1249368 3300046516 Bacteria 502
215 Ga0495630_0001015 3300046517 Bacteria 19454
216 Ga0495666_0010706 3300046526 Bacteria 4574
217 Ga0495666_0363887 3300046526 Bacteria 651
218 Ga0495652_0017835 3300046529 Bacteria 6335
219 Ga0495652_0024730 3300046529 Bacteria 5315
220 Ga0495652_0083886 3300046529 Bacteria 2622
221 Ga0495652_0780179 3300046529 Bacteria 637
222 Ga0495665_0002215 3300046531 Bacteria 10533
223 Ga0495640_0015178 3300046533 Bacteria 5801
224 Ga0495640_0023837 3300046533 Bacteria 4452
225 Ga0495640_0378262 3300046533 Bacteria 871
226 Ga0495586_0116973 3300046535 Bacteria 1487
227 Ga0495586_0129765 3300046535 Bacteria 1411
228 Ga0495587_0061013 3300046536 Bacteria 2209
229 Ga0495587_0117252 3300046536 Bacteria 1526
230 Ga0495587_0247310 3300046536 Bacteria 1003
231 Ga0495645_0060629 3300046543 Bacteria 2742
232 Ga0495645_0139002 3300046543 Bacteria 1696
233 Ga0495622_0001624 3300046557 Bacteria 11097
234 Ga0495667_0011879 3300046559 Bacteria 5898
235 Ga0495667_0018182 3300046559 Bacteria 4748
236 Ga0495667_0021445 3300046559 Bacteria 4359
237 Ga0495634_0007712 3300046642 Bacteria 8055
238 Ga0495634_0215676 3300046642 Bacteria 1186
239 Ga0495635_0006846 3300046663 Bacteria 7965
240 Ga0495635_0015022 3300046663 Bacteria 5417
241 Ga0495657_0011163 3300046675 Bacteria 6728
242 Ga0495657_0148744 3300046675 Bacteria 1455
243 Ga0495599_0013258 3300046678 Bacteria 5093
244 Ga0495599_0061476 3300046678 Bacteria 2347
245 Ga0495599_0070215 3300046678 Bacteria 2186
246 Ga0495599_0138237 3300046678 Bacteria 1512
247 Ga0495623_0007351 3300046679 Bacteria 7148
248 Ga0495623_0189296 3300046679 Bacteria 1190
249 Ga0495623_0284645 3300046679 Bacteria 918
250 Ga0495646_0012735 3300046680 Bacteria 5346
251 Ga0495646_0099195 3300046680 Bacteria 1672
252 Ga0495647_0000698 3300046681 Bacteria 9993
253 Ga0495658_0001522 3300046683 Bacteria 12158
254 Ga0495613_0020521 3300046689 Bacteria 4926
255 Ga0495613_0245632 3300046689 Bacteria 1250
256 Ga0495624_0000302 3300046690 Bacteria 38829
257 Ga0495600_0007205 3300046809 Bacteria 6789
258 Ga0495600_0166337 3300046809 Bacteria 1424
259 Ga0495600_0210529 3300046809 Bacteria 1246
260 Ga0495581_0001155 3300047315 Bacteria 14456
261 Ga0495604_0011489 3300047317 Bacteria 7032
262 Ga0495604_0119087 3300047317 Bacteria 1913
263 Ga0495604_0824349 3300047317 Bacteria 583
264 Ga0495674_0002173 3300047319 Bacteria 19253
265 Ga0495674_0019199 3300047319 Bacteria 6350
266 Ga0495674_0672012 3300047319 Bacteria 815
267 Ga0495674_0728114 3300047319 Bacteria 776
268 Ga0495676_0019861 3300047321 Bacteria 5905
269 Ga0495676_0208893 3300047321 Bacteria 1352
270 Ga0495676_0298066 3300047321 Bacteria 1088
271 Ga0495680_0014528 3300047322 Bacteria 6816
272 Ga0495680_0016545 3300047322 Bacteria 6331
273 Ga0495675_0014578 3300047444 Bacteria 4969
274 Ga0495675_0228182 3300047444 Bacteria 1124
275 Ga0495684_0001939 3300047471 Bacteria 16583
276 Ga0495684_0061204 3300047471 Bacteria 2864
277 Ga0495684_0710327 3300047471 Bacteria 665
278 Ga0495686_0588473 3300047472 Bacteria 577
279 Ga0495593_0001254 3300047673 Bacteria 14890
280 Ga0495593_0006032 3300047673 Bacteria 7129
281 Ga0495593_0145399 3300047673 Bacteria 1200
282 Ga0495602_0021377 3300048088 Bacteria 6371
283 Ga0495602_0842117 3300048088 Bacteria 613
284 Ga0496102_0463089 3300048905 Bacteria 1189
285 Ga0496104_0103945 3300048907 Bacteria 2721
286 Ga0496105_0277551 3300048908 Bacteria 1352
287 Ga0496106_0001093 3300048909 Bacteria 20033
288 Ga0496107_0004901 3300048910 Bacteria 9097
289 Ga0496109_0056156 3300048912 Bacteria 3593
290 Ga0496109_0573650 3300048912 Bacteria 1063
291 Ga0496110_0088961 3300048913 Bacteria 2759
292 Ga0496112_0119159 3300048915 Bacteria 2609
293 Ga0496112_0730965 3300048915 Bacteria 917
294 Ga0496112_1026576 3300048915 Bacteria 744
295 Ga0496113_0252383 3300048916 Bacteria 1408
296 Ga0496115_0027090 3300048918 Bacteria 4479
297 Ga0496115_0081380 3300048918 Bacteria 2638
298 Ga0496115_0188061 3300048918 Bacteria 1706
299 Ga0496117_0115193 3300048920 Bacteria 1664
300 Ga0496118_0002001 3300048921 Bacteria 28876
301 Ga0496121_0000983 3300048924 Bacteria 51050
302 Ga0496121_0095807 3300048924 Bacteria 2305
303 Ga0496124_0008234 3300048927 Bacteria 10933
304 Ga0496125_0082162 3300048928 Bacteria 2457
305 Ga0496126_0031694 3300048929 Bacteria 4989
306 Ga0496126_0322265 3300048929 Bacteria 1270
307 Ga0496126_0601736 3300048929 Bacteria 866
308 Ga0501031_0013091 3300049568 Bacteria 5412
309 Ga0501032_0044320 3300049569 Bacteria 3011
310 Ga0501034_0045300 3300049571 Bacteria 4445
311 Ga0501036_0001566 3300049572 Bacteria 17669
312 Ga0501037_0024783 3300049573 Bacteria 4436
313 Ga0501038_0000575 3300049574 Bacteria 32506
314 Ga0501039_0007888 3300049575 Bacteria 8112
315 Ga0501042_0361956 3300049578 Bacteria 1050
316 Ga0501046_0001536 3300049580 Bacteria 22030
317 Ga0501047_0084717 3300049581 Bacteria 3046
318 Ga0501067_0022377 3300049583 Bacteria 3498
319 Ga0501072_0097639 3300049588 Bacteria 2335
320 Ga0501073_0044150 3300049589 Bacteria 3141
321 Ga0501079_0099941 3300049741 Bacteria 2249
322 Ga0501080_0066184 3300049742 Bacteria 3360
323 Ga0501035_0030699 3300049822 Bacteria 4898
324 Ga0501044_0008397 3300049823 Bacteria 11327
325 Ga0501045_0076131 3300049824 Bacteria 2472
326 nmdc:mga06z11_667504_c1 3300050494 Bacteria 633
327 nmdc:mga07m45_824751_c1 3300050496 Bacteria 531
328 nmdc:mga0n895_1126266_c1 3300050512 Bacteria 761
329 Ga0495601_0159611 3300053077 Bacteria 1473
330 Ga0495601_0192013 3300053077 Bacteria 1334
331 Ga0495612_0054723 3300053078 Bacteria 1644
332 Ga0500635_0001666 3300053080 Bacteria 5366
333 Ga0495595_0002815 3300053084 Bacteria 6843
334 Ga0495595_0029145 3300053084 Bacteria 2469
335 Ga0495595_0094610 3300053084 Bacteria 1436
336 Ga0495619_0003924 3300053085 Bacteria 9553
337 Ga0495619_0008420 3300053085 Bacteria 6520
338 Ga0495619_0020960 3300053085 Bacteria 4169
339 Ga0495619_0798183 3300053085 Bacteria 638
340 Ga0500651_0091752 3300053093 Bacteria 1869
341 Ga0500566_0001514 3300053094 Bacteria 13633
342 Ga0500554_002055 3300053102 Bacteria 3896
343 Ga0500595_000152 3300053119 Bacteria 45452
344 Ga0500559_0166430 3300053136 Bacteria 1037
345 Ga0500603_000358 3300053150 Bacteria 11917
346 Ga0500603_063467 3300053150 Bacteria 1038
347 Ga0500638_008578 3300053162 Bacteria 4368
348 Ga0500637_0000244 3300053178 Bacteria 20194
349 Ga0500637_0000652 3300053178 Bacteria 13763
350 Ga0501084_0108168 3300054114 Bacteria 2336
351 Ga0500661_000738 3300055283 Bacteria 6135
352 Ga0501082_0242151 3300060353 Bacteria 1570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10102510 Ga0213872_101025102 111
2 3300005844 Ga0068862_101455233 Ga0068862_1014552332 113
3 3300035170 Ga0373943_0027264 Ga0373943_0027264_1644_2009 113
4 3300046455 Ga0495603_0027946 Ga0495603_0027946_421_786 113
5 3300046526 Ga0495666_0363887 Ga0495666_0363887_34_399 113
6 3300047321 Ga0495676_0298066 Ga0495676_0298066_363_728 113
7 3300005983 Ga0081540_1009547 Ga0081540_10095476 114
8 3300006173 Ga0070716_100785545 Ga0070716_1007855452 114
9 3300014326 Ga0157380_12569922 Ga0157380_125699222 114
10 3300035691 Ga0373931_0493197 Ga0373931_0493197_163_531 114
11 3300047472 Ga0495686_0588473 Ga0495686_0588473_176_535 114
12 iso_pu_bacteria 2524023210 2524465780 115
13 3300005435 Ga0070714_100009368 Ga0070714_1000093684 116
14 3300005437 Ga0070710_10001763 Ga0070710_100017634 116
15 3300005439 Ga0070711_100117471 Ga0070711_1001174714 116
16 3300006163 Ga0070715_10063913 Ga0070715_100639132 116
17 3300006173 Ga0070716_100003007 Ga0070716_1000030077 116
18 3300006175 Ga0070712_100156427 Ga0070712_1001564272 116
19 3300009101 Ga0105247_11336612 Ga0105247_113366121 116
20 3300013296 Ga0157374_12467589 Ga0157374_124675892 116
21 3300025898 Ga0207692_10542400 Ga0207692_105424002 116
22 3300025905 Ga0207685_10047868 Ga0207685_100478682 116
23 3300025906 Ga0207699_10020543 Ga0207699_100205432 116
24 3300025915 Ga0207693_10019854 Ga0207693_100198545 116
25 3300025916 Ga0207663_10440562 Ga0207663_104405622 116
26 3300025939 Ga0207665_10006200 Ga0207665_100062007 116
27 3300044694 Ga0466963_0079627 Ga0466963_0079627_1136_1504 116
28 3300044842 Ga0466957_0308854 Ga0466957_0308854_216_584 116
29 3300046471 Ga0495650_0100469 Ga0495650_0100469_284_649 116
30 3300050494 nmdc:mga06z11_667504_c1 nmdc:mga06z11_667504_c1_20_370 116
31 3300050496 nmdc:mga07m45_824751_c1 nmdc:mga07m45_824751_c1_95_445 116
32 3300031344 Ga0265316_10636518 Ga0265316_106365181 117
33 3300033180 Ga0307510_10024690 Ga0307510_100246906 117
34 3300037068 Ga0373925_0866763 Ga0373925_0866763_102_473 117
35 3300053080 Ga0500635_0001666 Ga0500635_0001666_3713_4084 117
36 3300053102 Ga0500554_002055 Ga0500554_002055_420_791 117
37 3300053150 Ga0500603_000358 Ga0500603_000358_5681_6052 117
38 3300053178 Ga0500637_0000652 Ga0500637_0000652_3943_4314 117
39 3300005334 Ga0068869_100237607 Ga0068869_1002376072 118
40 3300005339 Ga0070660_100202908 Ga0070660_1002029082 118
41 3300005366 Ga0070659_100258555 Ga0070659_1002585552 118
42 3300005439 Ga0070711_100685897 Ga0070711_1006858971 118
43 3300005456 Ga0070678_101943558 Ga0070678_1019435582 118
44 3300005563 Ga0068855_100483496 Ga0068855_1004834962 118
45 3300005719 Ga0068861_101211100 Ga0068861_1012111002 118
46 3300006028 Ga0070717_10295670 Ga0070717_102956701 118
47 3300006871 Ga0075434_101340786 Ga0075434_1013407862 118
48 3300009101 Ga0105247_11207017 Ga0105247_112070172 118
49 3300025898 Ga0207692_10090645 Ga0207692_100906452 118
50 3300025906 Ga0207699_10099121 Ga0207699_100991212 118
51 3300025916 Ga0207663_10124942 Ga0207663_101249422 118
52 3300025919 Ga0207657_10072825 Ga0207657_100728252 118
53 3300025928 Ga0207700_10061225 Ga0207700_100612253 118
54 3300025939 Ga0207665_10248825 Ga0207665_102488251 118
55 3300025942 Ga0207689_10127188 Ga0207689_101271882 118
56 3300025949 Ga0207667_11470086 Ga0207667_114700862 118
57 3300035692 Ga0373935_0262869 Ga0373935_0262869_255_617 118
58 3300050512 nmdc:mga0n895_1126266_c1 nmdc:mga0n895_1126266_c1_303_659 118
59 3300005564 Ga0070664_100590211 Ga0070664_1005902112 119
60 3300005840 Ga0068870_10742686 Ga0068870_107426862 119
61 3300013306 Ga0163162_11069237 Ga0163162_110692373 119
62 3300025904 Ga0207647_10109761 Ga0207647_101097613 119
63 3300025907 Ga0207645_10124744 Ga0207645_101247442 119
64 3300025922 Ga0207646_10697415 Ga0207646_106974151 119
65 3300025945 Ga0207679_10860039 Ga0207679_108600392 119
66 3300031616 Ga0307508_10017025 Ga0307508_100170254 119
67 3300033442 Ga0315911_1000006 Ga0315911_1000006308 119
68 3300037068 Ga0373925_0041898 Ga0373925_0041898_1770_2135 119
69 3300037068 Ga0373925_0146731 Ga0373925_0146731_972_1331 119
70 3300039450 Ga0436363_0995142 Ga0436363_0995142_165_524 119
71 3300041460 Ga0451802_2085169 Ga0451802_2085169_25_384 119
72 3300041509 Ga0451843_0714505 Ga0451843_0714505_25_384 119
73 3300041512 Ga0451853_1537720 Ga0451853_1537720_1147_1506 119
74 3300046459 Ga0495629_0204780 Ga0495629_0204780_241_600 119
75 3300046477 Ga0495664_0313710 Ga0495664_0313710_290_649 119
76 3300046516 Ga0495628_1249368 Ga0495628_1249368_119_478 119
77 3300048910 Ga0496107_0004901 Ga0496107_0004901_7258_7617 119
78 3300048912 Ga0496109_0573650 Ga0496109_0573650_166_525 119
79 3300048915 Ga0496112_0730965 Ga0496112_0730965_61_420 119
80 3300053084 Ga0495595_0029145 Ga0495595_0029145_207_566 119
81 3300053085 Ga0495619_0020960 Ga0495619_0020960_385_744 119
82 3300053094 Ga0500566_0001514 Ga0500566_0001514_6323_6682 119
83 3300053119 Ga0500595_000152 Ga0500595_000152_31858_32217 119
84 3300053136 Ga0500559_0166430 Ga0500559_0166430_209_568 119
85 3300053150 Ga0500603_063467 Ga0500603_063467_456_815 119
86 3300053162 Ga0500638_008578 Ga0500638_008578_3092_3451 119
87 3300053178 Ga0500637_0000244 Ga0500637_0000244_18326_18685 119
88 3300055283 Ga0500661_000738 Ga0500661_000738_3927_4286 119
89 3300005841 Ga0068863_100281738 Ga0068863_1002817383 120
90 3300009093 Ga0105240_10017726 Ga0105240_100177269 120
91 3300025913 Ga0207695_10877815 Ga0207695_108778151 120
92 3300031235 Ga0265330_10077434 Ga0265330_100774342 120
93 3300031239 Ga0265328_10098398 Ga0265328_100983983 120
94 3300031247 Ga0265340_10027514 Ga0265340_100275143 120
95 3300031249 Ga0265339_10288107 Ga0265339_102881072 120
96 3300031344 Ga0265316_10262550 Ga0265316_102625502 120
97 3300031712 Ga0265342_10018394 Ga0265342_100183942 120
98 3300035086 Ga0373934_0036891 Ga0373934_0036891_479_841 120
99 3300035111 Ga0373923_0028542 Ga0373923_0028542_698_1060 120
100 3300035113 Ga0373936_0052506 Ga0373936_0052506_29_391 120
101 3300035117 Ga0373953_0001006 Ga0373953_0001006_6308_6670 120
102 3300035118 Ga0373954_0001568 Ga0373954_0001568_5058_5420 120
103 3300035119 Ga0373956_0003001 Ga0373956_0003001_3979_4341 120
104 3300035120 Ga0373957_0001326 Ga0373957_0001326_4991_5353 120
105 3300035172 Ga0373955_0001817 Ga0373955_0001817_3895_4257 120
106 3300035410 Ga0373924_0004760 Ga0373924_0004760_3426_3788 120
107 3300035724 Ga0373933_0002116 Ga0373933_0002116_602_964 120
108 3300036401 Ga0373937_0005719 Ga0373937_0005719_5092_5454 120
109 3300046454 Ga0495592_0005707 Ga0495592_0005707_5443_5805 120
110 3300046459 Ga0495629_0002680 Ga0495629_0002680_3390_3752 120
111 3300046462 Ga0495651_0007486 Ga0495651_0007486_4607_4969 120
112 3300046463 Ga0495653_0019482 Ga0495653_0019482_4715_5077 120
113 3300046511 Ga0495608_0024476 Ga0495608_0024476_1451_1813 120
114 3300046516 Ga0495628_0013526 Ga0495628_0013526_438_800 120
115 3300046529 Ga0495652_0017835 Ga0495652_0017835_4356_4718 120
116 3300046529 Ga0495652_0780179 Ga0495652_0780179_220_582 120
117 3300046533 Ga0495640_0023837 Ga0495640_0023837_1727_2089 120
118 3300046536 Ga0495587_0061013 Ga0495587_0061013_1160_1522 120
119 3300046543 Ga0495645_0060629 Ga0495645_0060629_191_553 120
120 3300046559 Ga0495667_0011879 Ga0495667_0011879_930_1292 120
121 3300046663 Ga0495635_0006846 Ga0495635_0006846_3878_4240 120
122 3300046675 Ga0495657_0011163 Ga0495657_0011163_1711_2073 120
123 3300046678 Ga0495599_0013258 Ga0495599_0013258_1156_1518 120
124 3300046679 Ga0495623_0007351 Ga0495623_0007351_5708_6070 120
125 3300046680 Ga0495646_0012735 Ga0495646_0012735_4529_4891 120
126 3300046689 Ga0495613_0245632 Ga0495613_0245632_442_804 120
127 3300046809 Ga0495600_0007205 Ga0495600_0007205_5709_6071 120
128 3300047317 Ga0495604_0011489 Ga0495604_0011489_1476_1838 120
129 3300047319 Ga0495674_0019199 Ga0495674_0019199_4899_5261 120
130 3300047322 Ga0495680_0014528 Ga0495680_0014528_4979_5341 120
131 3300047444 Ga0495675_0014578 Ga0495675_0014578_426_788 120
132 3300047471 Ga0495684_0001939 Ga0495684_0001939_10784_11146 120
133 3300047673 Ga0495593_0006032 Ga0495593_0006032_459_821 120
134 3300048088 Ga0495602_0021377 Ga0495602_0021377_5290_5652 120
135 3300048905 Ga0496102_0463089 Ga0496102_0463089_178_540 120
136 3300048918 Ga0496115_0188061 Ga0496115_0188061_222_584 120
137 3300053077 Ga0495601_0159611 Ga0495601_0159611_35_397 120
138 3300053084 Ga0495595_0002815 Ga0495595_0002815_1344_1706 120
139 3300053085 Ga0495619_0003924 Ga0495619_0003924_426_788 120
140 3300006028 Ga0070717_10209346 Ga0070717_102093463 121
141 3300006173 Ga0070716_100183489 Ga0070716_1001834893 121
142 3300006175 Ga0070712_100253605 Ga0070712_1002536052 121
143 3300006237 Ga0097621_100595575 Ga0097621_1005955753 121
144 3300009101 Ga0105247_10050654 Ga0105247_100506545 121
145 3300009174 Ga0105241_10607857 Ga0105241_106078572 121
146 3300010375 Ga0105239_12859336 Ga0105239_128593361 121
147 3300025900 Ga0207710_10045971 Ga0207710_100459712 121
148 3300025911 Ga0207654_10844869 Ga0207654_108448692 121
149 3300025915 Ga0207693_10177777 Ga0207693_101777772 121
150 3300025928 Ga0207700_10007311 Ga0207700_100073117 121
151 3300025928 Ga0207700_11070450 Ga0207700_110704502 121
152 3300031507 Ga0307509_10152918 Ga0307509_101529183 121
153 3300031507 Ga0307509_10268136 Ga0307509_102681362 121
154 3300048907 Ga0496104_0103945 Ga0496104_0103945_714_1079 121
155 3300048909 Ga0496106_0001093 Ga0496106_0001093_11345_11710 121
156 3300048912 Ga0496109_0056156 Ga0496109_0056156_2637_3002 121
157 3300048915 Ga0496112_0119159 Ga0496112_0119159_226_591 121
158 3300048916 Ga0496113_0252383 Ga0496113_0252383_780_1145 121
159 3300048920 Ga0496117_0115193 Ga0496117_0115193_955_1320 121
160 3300048921 Ga0496118_0002001 Ga0496118_0002001_18094_18459 121
161 3300048924 Ga0496121_0000983 Ga0496121_0000983_10427_10792 121
162 3300048924 Ga0496121_0095807 Ga0496121_0095807_642_1007 121
163 3300048927 Ga0496124_0008234 Ga0496124_0008234_8291_8656 121
164 3300048928 Ga0496125_0082162 Ga0496125_0082162_1090_1455 121
165 3300048929 Ga0496126_0031694 Ga0496126_0031694_2646_3011 121
166 3300048929 Ga0496126_0601736 Ga0496126_0601736_159_524 121
167 3300053093 Ga0500651_0091752 Ga0500651_0091752_1233_1598 121
168 3300005327 Ga0070658_11882770 Ga0070658_118827701 122
169 3300005329 Ga0070683_100742190 Ga0070683_1007421902 122
170 3300005336 Ga0070680_100299541 Ga0070680_1002995412 122
171 3300005337 Ga0070682_101595303 Ga0070682_1015953032 122
172 3300005339 Ga0070660_101258581 Ga0070660_1012585811 122
173 3300005341 Ga0070691_11045128 Ga0070691_110451281 122
174 3300005344 Ga0070661_100330157 Ga0070661_1003301572 122
175 3300005366 Ga0070659_100771689 Ga0070659_1007716892 122
176 3300005434 Ga0070709_10027055 Ga0070709_100270552 122
177 3300005436 Ga0070713_100878518 Ga0070713_1008785182 122
178 3300005439 Ga0070711_101115876 Ga0070711_1011158761 122
179 3300005445 Ga0070708_101277783 Ga0070708_1012777832 122
180 3300005458 Ga0070681_10884500 Ga0070681_108845001 122
181 3300005530 Ga0070679_100053808 Ga0070679_1000538083 122
182 3300005535 Ga0070684_100033234 Ga0070684_1000332341 122
183 3300005539 Ga0068853_100383179 Ga0068853_1003831791 122
184 3300005563 Ga0068855_100103017 Ga0068855_1001030173 122
185 3300005564 Ga0070664_100228334 Ga0070664_1002283342 122
186 3300005577 Ga0068857_100539889 Ga0068857_1005398892 122
187 3300005616 Ga0068852_100793577 Ga0068852_1007935772 122
188 3300005841 Ga0068863_102211994 Ga0068863_1022119941 122
189 3300007265 Ga0099794_10048953 Ga0099794_100489532 122
190 3300007788 Ga0099795_10025533 Ga0099795_100255332 122
191 3300009093 Ga0105240_10055947 Ga0105240_100559472 122
192 3300009545 Ga0105237_10354550 Ga0105237_103545502 122
193 3300009551 Ga0105238_10025601 Ga0105238_100256015 122
194 3300010375 Ga0105239_11230038 Ga0105239_112300381 122
195 3300013105 Ga0157369_10291507 Ga0157369_102915072 122
196 3300020070 Ga0206356_11050083 Ga0206356_110500831 122
197 3300020082 Ga0206353_11388822 Ga0206353_113888221 122
198 3300025906 Ga0207699_10222210 Ga0207699_102222102 122
199 3300025909 Ga0207705_10935572 Ga0207705_109355722 122
200 3300025910 Ga0207684_10501982 Ga0207684_105019822 122
201 3300025912 Ga0207707_10026196 Ga0207707_100261962 122
202 3300025912 Ga0207707_10894819 Ga0207707_108948192 122
203 3300025913 Ga0207695_10145249 Ga0207695_101452494 122
204 3300025914 Ga0207671_10648365 Ga0207671_106483652 122
205 3300025916 Ga0207663_10265919 Ga0207663_102659192 122
206 3300025919 Ga0207657_10028782 Ga0207657_100287827 122
207 3300025924 Ga0207694_10905061 Ga0207694_109050612 122
208 3300025928 Ga0207700_10569735 Ga0207700_105697352 122
209 3300025932 Ga0207690_10122192 Ga0207690_101221922 122
210 3300025944 Ga0207661_10129699 Ga0207661_101296992 122
211 3300025945 Ga0207679_10205886 Ga0207679_102058862 122
212 3300025949 Ga0207667_10488671 Ga0207667_104886712 122
213 3300026041 Ga0207639_10038360 Ga0207639_100383604 122
214 3300026116 Ga0207674_10051145 Ga0207674_100511453 122
215 3300031344 Ga0265316_10452124 Ga0265316_104521242 122
216 3300046462 Ga0495651_0547529 Ga0495651_0547529_272_640 122
217 3300046477 Ga0495664_0245680 Ga0495664_0245680_110_478 122
218 3300046678 Ga0495599_0138237 Ga0495599_0138237_859_1227 122
219 3300047319 Ga0495674_0672012 Ga0495674_0672012_384_752 122
220 3300048908 Ga0496105_0277551 Ga0496105_0277551_755_1123 122
221 3300048913 Ga0496110_0088961 Ga0496110_0088961_659_1027 122
222 3300048915 Ga0496112_1026576 Ga0496112_1026576_196_564 122
223 3300048918 Ga0496115_0027090 Ga0496115_0027090_1533_1901 122
224 3300005458 Ga0070681_10992158 Ga0070681_109921582 123
225 3300005471 Ga0070698_100092442 Ga0070698_1000924422 123
226 3300007788 Ga0099795_10010931 Ga0099795_100109312 123
227 3300010159 Ga0099796_10158087 Ga0099796_101580872 123
228 3300010159 Ga0099796_10204382 Ga0099796_102043822 123
229 3300014325 Ga0163163_12949408 Ga0163163_129494081 123
230 3300025915 Ga0207693_10557940 Ga0207693_105579403 123
231 3300027512 Ga0209179_1032479 Ga0209179_10324792 123
232 3300027671 Ga0209588_1173628 Ga0209588_11736282 123
233 3300031250 Ga0265331_10335887 Ga0265331_103358871 123
234 3300031616 Ga0307508_10135172 Ga0307508_101351722 123
235 3300035086 Ga0373934_0102765 Ga0373934_0102765_92_463 123
236 3300035113 Ga0373936_0057211 Ga0373936_0057211_624_995 123
237 3300035117 Ga0373953_0065434 Ga0373953_0065434_688_1059 123
238 3300035120 Ga0373957_0098693 Ga0373957_0098693_374_745 123
239 3300035170 Ga0373943_0535947 Ga0373943_0535947_192_563 123
240 3300035171 Ga0373946_0069619 Ga0373946_0069619_479_850 123
241 3300035172 Ga0373955_0048632 Ga0373955_0048632_635_1006 123
242 3300035410 Ga0373924_0030710 Ga0373924_0030710_392_763 123
243 3300035692 Ga0373935_0041590 Ga0373935_0041590_522_893 123
244 3300035692 Ga0373935_0081502 Ga0373935_0081502_538_909 123
245 3300035695 Ga0373927_0040983 Ga0373927_0040983_306_677 123
246 3300035724 Ga0373933_0123889 Ga0373933_0123889_889_1260 123
247 3300035725 Ga0373947_0177410 Ga0373947_0177410_322_693 123
248 3300036401 Ga0373937_0703090 Ga0373937_0703090_558_929 123
249 3300037068 Ga0373925_0027329 Ga0373925_0027329_3064_3435 123
250 3300046454 Ga0495592_0274208 Ga0495592_0274208_405_776 123
251 3300046455 Ga0495603_0041016 Ga0495603_0041016_10_381 123
252 3300046462 Ga0495651_0167198 Ga0495651_0167198_651_1022 123
253 3300046463 Ga0495653_0174955 Ga0495653_0174955_719_1090 123
254 3300046477 Ga0495664_0165906 Ga0495664_0165906_228_599 123
255 3300046499 Ga0495594_0744830 Ga0495594_0744830_149_520 123
256 3300046516 Ga0495628_0086519 Ga0495628_0086519_1243_1614 123
257 3300046529 Ga0495652_0083886 Ga0495652_0083886_1424_1795 123
258 3300046533 Ga0495640_0378262 Ga0495640_0378262_221_592 123
259 3300046535 Ga0495586_0129765 Ga0495586_0129765_570_941 123
260 3300046536 Ga0495587_0117252 Ga0495587_0117252_1085_1456 123
261 3300046543 Ga0495645_0139002 Ga0495645_0139002_540_911 123
262 3300046559 Ga0495667_0021445 Ga0495667_0021445_935_1306 123
263 3300046642 Ga0495634_0215676 Ga0495634_0215676_97_468 123
264 3300046675 Ga0495657_0148744 Ga0495657_0148744_749_1120 123
265 3300046678 Ga0495599_0070215 Ga0495599_0070215_1635_2006 123
266 3300046679 Ga0495623_0189296 Ga0495623_0189296_716_1087 123
267 3300046680 Ga0495646_0099195 Ga0495646_0099195_792_1163 123
268 3300046809 Ga0495600_0166337 Ga0495600_0166337_583_954 123
269 3300047317 Ga0495604_0119087 Ga0495604_0119087_840_1211 123
270 3300047319 Ga0495674_0728114 Ga0495674_0728114_176_547 123
271 3300047321 Ga0495676_0208893 Ga0495676_0208893_701_1072 123
272 3300047322 Ga0495680_0016545 Ga0495680_0016545_709_1080 123
273 3300047444 Ga0495675_0228182 Ga0495675_0228182_77_448 123
274 3300047471 Ga0495684_0710327 Ga0495684_0710327_75_446 123
275 3300047673 Ga0495593_0145399 Ga0495593_0145399_653_1024 123
276 3300048088 Ga0495602_0842117 Ga0495602_0842117_122_493 123
277 3300048918 Ga0496115_0081380 Ga0496115_0081380_1335_1763 123
278 3300048929 Ga0496126_0322265 Ga0496126_0322265_482_853 123
279 3300053077 Ga0495601_0192013 Ga0495601_0192013_633_1004 123
280 3300053078 Ga0495612_0054723 Ga0495612_0054723_596_967 123
281 3300053084 Ga0495595_0094610 Ga0495595_0094610_200_571 123
282 3300053085 Ga0495619_0798183 Ga0495619_0798183_203_574 123
283 3300005327 Ga0070658_10272979 Ga0070658_102729792 124
284 3300026041 Ga0207639_11326640 Ga0207639_113266402 124
285 3300035089 Ga0373944_0075462 Ga0373944_0075462_212_586 124
286 3300035111 Ga0373923_0009238 Ga0373923_0009238_1423_1797 124
287 3300035113 Ga0373936_0022020 Ga0373936_0022020_189_563 124
288 3300035119 Ga0373956_0147851 Ga0373956_0147851_18_392 124
289 3300035170 Ga0373943_0017885 Ga0373943_0017885_325_699 124
290 3300035171 Ga0373946_0008929 Ga0373946_0008929_1188_1562 124
291 3300035692 Ga0373935_0002430 Ga0373935_0002430_5381_5755 124
292 3300035695 Ga0373927_0004184 Ga0373927_0004184_8727_9101 124
293 3300035725 Ga0373947_0002441 Ga0373947_0002441_6386_6760 124
294 3300036401 Ga0373937_0046565 Ga0373937_0046565_1221_1595 124
295 3300037068 Ga0373925_0003313 Ga0373925_0003313_1101_1475 124
296 3300037068 Ga0373925_0124237 Ga0373925_0124237_1098_1472 124
297 3300046454 Ga0495592_0233493 Ga0495592_0233493_692_1066 124
298 3300046455 Ga0495603_0000147 Ga0495603_0000147_30294_30668 124
299 3300046459 Ga0495629_0000221 Ga0495629_0000221_13807_14181 124
300 3300046461 Ga0495641_0014903 Ga0495641_0014903_135_509 124
301 3300046462 Ga0495651_0297936 Ga0495651_0297936_313_687 124
302 3300046472 Ga0495580_0010948 Ga0495580_0010948_3811_4185 124
303 3300046473 Ga0495582_0002170 Ga0495582_0002170_6775_7149 124
304 3300046475 Ga0495639_0000346 Ga0495639_0000346_3964_4338 124
305 3300046476 Ga0495662_0005862 Ga0495662_0005862_2030_2404 124
306 3300046477 Ga0495664_0053323 Ga0495664_0053323_196_570 124
307 3300046499 Ga0495594_0002462 Ga0495594_0002462_4230_4604 124
308 3300046511 Ga0495608_0569673 Ga0495608_0569673_106_480 124
309 3300046517 Ga0495630_0001015 Ga0495630_0001015_10477_10851 124
310 3300046526 Ga0495666_0010706 Ga0495666_0010706_1024_1398 124
311 3300046529 Ga0495652_0024730 Ga0495652_0024730_3698_4072 124
312 3300046531 Ga0495665_0002215 Ga0495665_0002215_5192_5566 124
313 3300046533 Ga0495640_0015178 Ga0495640_0015178_4115_4489 124
314 3300046535 Ga0495586_0116973 Ga0495586_0116973_770_1144 124
315 3300046536 Ga0495587_0247310 Ga0495587_0247310_131_505 124
316 3300046557 Ga0495622_0001624 Ga0495622_0001624_6989_7363 124
317 3300046559 Ga0495667_0018182 Ga0495667_0018182_2947_3321 124
318 3300046642 Ga0495634_0007712 Ga0495634_0007712_3825_4199 124
319 3300046663 Ga0495635_0015022 Ga0495635_0015022_1204_1578 124
320 3300046678 Ga0495599_0061476 Ga0495599_0061476_842_1216 124
321 3300046679 Ga0495623_0284645 Ga0495623_0284645_184_558 124
322 3300046681 Ga0495647_0000698 Ga0495647_0000698_2622_2996 124
323 3300046683 Ga0495658_0001522 Ga0495658_0001522_7618_7992 124
324 3300046689 Ga0495613_0020521 Ga0495613_0020521_2609_2983 124
325 3300046690 Ga0495624_0000302 Ga0495624_0000302_36433_36807 124
326 3300046809 Ga0495600_0210529 Ga0495600_0210529_207_581 124
327 3300047315 Ga0495581_0001155 Ga0495581_0001155_11196_11570 124
328 3300047317 Ga0495604_0824349 Ga0495604_0824349_43_417 124
329 3300047319 Ga0495674_0002173 Ga0495674_0002173_15018_15392 124
330 3300047321 Ga0495676_0019861 Ga0495676_0019861_1677_2051 124
331 3300047471 Ga0495684_0061204 Ga0495684_0061204_2420_2794 124
332 3300047673 Ga0495593_0001254 Ga0495593_0001254_7673_8047 124
333 3300049568 Ga0501031_0013091 Ga0501031_0013091_1417_1791 124
334 3300049569 Ga0501032_0044320 Ga0501032_0044320_1476_1850 124
335 3300049571 Ga0501034_0045300 Ga0501034_0045300_229_603 124
336 3300049572 Ga0501036_0001566 Ga0501036_0001566_4592_4966 124
337 3300049573 Ga0501037_0024783 Ga0501037_0024783_3842_4216 124
338 3300049574 Ga0501038_0000575 Ga0501038_0000575_22580_22954 124
339 3300049575 Ga0501039_0007888 Ga0501039_0007888_5582_5956 124
340 3300049578 Ga0501042_0361956 Ga0501042_0361956_372_746 124
341 3300049580 Ga0501046_0001536 Ga0501046_0001536_11031_11405 124
342 3300049581 Ga0501047_0084717 Ga0501047_0084717_2330_2704 124
343 3300049583 Ga0501067_0022377 Ga0501067_0022377_990_1364 124
344 3300049588 Ga0501072_0097639 Ga0501072_0097639_1296_1670 124
345 3300049589 Ga0501073_0044150 Ga0501073_0044150_850_1224 124
346 3300049741 Ga0501079_0099941 Ga0501079_0099941_531_905 124
347 3300049742 Ga0501080_0066184 Ga0501080_0066184_2834_3208 124
348 3300049822 Ga0501035_0030699 Ga0501035_0030699_2340_2714 124
349 3300049823 Ga0501044_0008397 Ga0501044_0008397_2265_2639 124
350 3300049824 Ga0501045_0076131 Ga0501045_0076131_1296_1670 124
351 3300053085 Ga0495619_0008420 Ga0495619_0008420_2188_2562 124
352 3300054114 Ga0501084_0108168 Ga0501084_0108168_773_1147 124
353 3300060353 Ga0501082_0242151 Ga0501082_0242151_706_1080 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

47

108

0.92

PF12172

DUF35_N

Rubredoxin-like zinc ribbon domain (DUF35_N)

11

45

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m3k-assembly1.cif.gz_E a multi-component acyltransferase phlabc from pseudomonas protegens 0.8393 20 120
6ok1-assembly1.cif.gz_D ltp2-chsh2(duf35) aldolase 0.7786 20 118
7pyt-assembly1.cif.gz_A benzoylsuccinyl-coa thiolase with coenzyme a 0.7776 15 120
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.7719 51 90
6et9-assembly1.cif.gz_F structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.7655 18 120
ID Description Score Start End Superfamily
1vhgB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7548 54 92 3.90.79.10
af_A0A0R0K9J8_1_307_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7231 52 90 3.30.420.10
af_Q5KQP4_57_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6893 49 90 3.30.420.10
af_Q8LSQ2_65_122_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6776 53 96 2.40.50.40
af_Q3L8U1_691_750_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6738 53 90 2.40.50.40
ID Description Score Start End GO Terms
AF-A0A7T9ERK1-F1-model_v4 deleted 0.8858 18 119
AF-A0A8B2NS40-F1-model_v4 DNA-binding protein 0.8715 16 120 GO:0003677
AF-A0A179SHD8-F1-model_v4 DNA-binding protein 0.8675 20 120
AF-A0A0P7ZMG8-F1-model_v4 Putative nucleic-acid-binding protein containing a Zn-ribbon 0.8641 18 121
AF-A0A515KJQ8-F1-model_v4 DNA-binding protein 0.8639 11 120 GO:0003677

Feature Viewer

pLDDT pTM Quality
83.91 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map