F419309

General Info

Members Datasets Scaffolds Average Seq Length
353 154 702 279

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100066787|Ga0070698_1000667873
Length 292
Sequence MRNRVAASVMAVVAALACSSVVSAQRGQARQGGAPAVKEGFISEGIPKMPDPPGPAPKRDLSGAWVGPATTNKPDPVPPMTAAGQAAFKERKSYGVASRLGGQGRDQAGEPESNDPFITCDPLGFPRNLLAHAITARGGTLIGSAPDRILIAYEQQRVWREIFTDGRALPKAVDVRGAPESRYYGYSIGHWENDTTFVVETTGLDERAWLDEEGHPRSSMAHITERYTRVDQYNMQVTVTVDDPKFYTKPWTFMRANFYWMKAQDFSESLCVPSEAIEYRDSLAKPSGINIK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 27.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100066787 3300005471 Unclassified 3618
2 Ga0065704_10002050 3300005289 Bacteria 9174
3 Ga0065715_10091952 3300005293 Bacteria 5437
4 Ga0065715_10096659 3300005293 Bacteria 3844
5 Ga0065715_10129310 3300005293 Unclassified 2047
6 Ga0065707_10107912 3300005295 Unclassified 2532
7 Ga0070676_10022265 3300005328 Bacteria 3553
8 Ga0070690_100015779 3300005330 Bacteria 4513
9 Ga0070690_100023519 3300005330 Bacteria 3779
10 Ga0070670_100028770 3300005331 Bacteria 4784
11 Ga0070680_100090529 3300005336 Unclassified 2533
12 Ga0070680_100325009 3300005336 Unclassified 1306
13 Ga0070689_100009081 3300005340 Bacteria 7038
14 Ga0070689_100119097 3300005340 Unclassified 2108
15 Ga0070691_10171967 3300005341 Unclassified 1123
16 Ga0070687_100010693 3300005343 Unclassified 3983
17 Ga0070687_100191752 3300005343 Bacteria 1232
18 Ga0070692_10006215 3300005345 Bacteria 5170
19 Ga0070692_10106019 3300005345 Bacteria 1548
20 Ga0070669_100003423 3300005353 Bacteria 11427
21 Ga0070669_100007513 3300005353 Bacteria 7807
22 Ga0070675_100000119 3300005354 Bacteria 46621
23 Ga0070675_100001322 3300005354 Bacteria 18112
24 Ga0070675_100088614 3300005354 Unclassified 2590
25 Ga0070675_100267394 3300005354 Bacteria 1500
26 Ga0070671_100141074 3300005355 Unclassified 2033
27 Ga0070673_100042537 3300005364 Bacteria 3504
28 Ga0070673_100048723 3300005364 Unclassified 3305
29 Ga0070673_100086295 3300005364 Bacteria 2557
30 Ga0070673_100150811 3300005364 Unclassified 1969
31 Ga0070688_100004905 3300005365 Bacteria 7001
32 Ga0070688_100011003 3300005365 Bacteria 5014
33 Ga0070688_100048181 3300005365 Unclassified 2647
34 Ga0070688_100212128 3300005365 Unclassified 1360
35 Ga0070659_100118608 3300005366 Bacteria 2141
36 Ga0070703_10022293 3300005406 Bacteria 1858
37 Ga0070713_100010880 3300005436 Bacteria 6596
38 Ga0070701_10008520 3300005438 Unclassified 4441
39 Ga0070701_10009768 3300005438 Unclassified 4215
40 Ga0070701_10017968 3300005438 Bacteria 3317
41 Ga0070701_10153883 3300005438 Bacteria 1326
42 Ga0070705_100000684 3300005440 Bacteria 19432
43 Ga0070705_100006513 3300005440 Bacteria 5731
44 Ga0070705_100027434 3300005440 Unclassified 3109
45 Ga0070705_100056605 3300005440 Bacteria 2309
46 Ga0070700_100004007 3300005441 Bacteria 7656
47 Ga0070694_100002845 3300005444 Bacteria 10283
48 Ga0070694_100021737 3300005444 Bacteria 4105
49 Ga0070694_100226227 3300005444 Unclassified 1405
50 Ga0070708_100218702 3300005445 Bacteria 1786
51 Ga0070662_100009791 3300005457 Bacteria 6278
52 Ga0070662_100100856 3300005457 Bacteria 2185
53 Ga0070662_100240102 3300005457 Bacteria 1453
54 Ga0068867_100004226 3300005459 Bacteria 10107
55 Ga0068867_100044278 3300005459 Bacteria 3260
56 Ga0070685_10069420 3300005466 Unclassified 2084
57 Ga0070706_100226869 3300005467 Unclassified 1744
58 Ga0070707_100108046 3300005468 Bacteria 2699
59 Ga0070707_100534187 3300005468 Bacteria 1135
60 Ga0070698_100062160 3300005471 Bacteria 3767
61 Ga0070698_100177468 3300005471 Bacteria 2069
62 Ga0070698_100185866 3300005471 Bacteria 2016
63 Ga0070698_100277501 3300005471 Bacteria 1608
64 Ga0070698_100602762 3300005471 Unclassified 1039
65 Ga0070699_100000268 3300005518 Bacteria 49871
66 Ga0070699_100017209 3300005518 Bacteria 6208
67 Ga0070699_100294093 3300005518 Unclassified 1456
68 Ga0070679_100333150 3300005530 Unclassified 1466
69 Ga0070684_100030313 3300005535 Bacteria 4594
70 Ga0070684_100366639 3300005535 Bacteria 1326
71 Ga0070672_100114481 3300005543 Bacteria 2202
72 Ga0070686_100064016 3300005544 Bacteria 2384
73 Ga0070695_100000565 3300005545 Bacteria 19525
74 Ga0070696_100000299 3300005546 Bacteria 29928
75 Ga0070696_100012708 3300005546 Bacteria 5654
76 Ga0070704_100000460 3300005549 Bacteria 19185
77 Ga0070704_100017303 3300005549 Bacteria 4582
78 Ga0070704_100023056 3300005549 Unclassified 4058
79 Ga0070704_100042430 3300005549 Unclassified 3147
80 Ga0070704_100102718 3300005549 Bacteria 2158
81 Ga0070704_100426671 3300005549 Unclassified 1137
82 Ga0070704_100515252 3300005549 Unclassified 1040
83 Ga0070664_100012670 3300005564 Bacteria 6866
84 Ga0070664_100016441 3300005564 Bacteria 6066
85 Ga0070664_100040409 3300005564 Bacteria 3932
86 Ga0070664_100139125 3300005564 Bacteria 2137
87 Ga0070664_100644555 3300005564 Unclassified 984
88 Ga0068857_100008754 3300005577 Bacteria 8766
89 Ga0068857_100086841 3300005577 Bacteria 2798
90 Ga0068857_100156231 3300005577 Bacteria 2068
91 Ga0070702_100019545 3300005615 Unclassified 3536
92 Ga0070702_100058342 3300005615 Unclassified 2236
93 Ga0068852_100150739 3300005616 Bacteria 2162
94 Ga0068859_100005740 3300005617 Bacteria 12621
95 Ga0068859_100018455 3300005617 Bacteria 7011
96 Ga0068859_100185575 3300005617 Bacteria 2163
97 Ga0068864_100041368 3300005618 Unclassified 3942
98 Ga0068864_100049009 3300005618 Bacteria 3633
99 Ga0068864_100086239 3300005618 Bacteria 2762
100 Ga0068864_100111639 3300005618 Unclassified 2436
101 Ga0068861_100001273 3300005719 Bacteria 15747
102 Ga0068861_100001936 3300005719 Bacteria 13340
103 Ga0068861_100264606 3300005719 Bacteria 1474
104 Ga0068861_100369350 3300005719 Unclassified 1264
105 Ga0068870_10006918 3300005840 Bacteria 5030
106 Ga0068870_10018246 3300005840 Bacteria 3385
107 Ga0068863_100136906 3300005841 Unclassified 2340
108 Ga0068858_100023832 3300005842 Bacteria 5703
109 Ga0068858_100220545 3300005842 Bacteria 1796
110 Ga0068860_100001722 3300005843 Bacteria 23339
111 Ga0068860_100014254 3300005843 Bacteria 7795
112 Ga0068860_100048373 3300005843 Bacteria 4053
113 Ga0068862_100000994 3300005844 Bacteria 27130
114 Ga0068862_100004775 3300005844 Bacteria 11406
115 Ga0081455_10160097 3300005937 Unclassified 1727
116 Ga0081539_10000025 3300005985 Bacteria 340255
117 Ga0081539_10003725 3300005985 Bacteria 18161
118 Ga0097621_100045848 3300006237 Bacteria 3533
119 Ga0068871_100250510 3300006358 Unclassified 1542
120 Ga0075428_100003266 3300006844 Bacteria 17744
121 Ga0075428_100008065 3300006844 Bacteria 11696
122 Ga0075428_100035719 3300006844 Bacteria 5478
123 Ga0075428_100038550 3300006844 Bacteria 5259
124 Ga0075428_100044640 3300006844 Bacteria 4869
125 Ga0075428_100103355 3300006844 Unclassified 3107
126 Ga0075428_100335997 3300006844 Bacteria 1623
127 Ga0075430_100018424 3300006846 Bacteria 5940
128 Ga0075430_100091736 3300006846 Bacteria 2540
129 Ga0075430_100251467 3300006846 Bacteria 1464
130 Ga0075431_100160293 3300006847 Bacteria 2313
131 Ga0075431_100229610 3300006847 Unclassified 1891
132 Ga0075431_100308839 3300006847 Bacteria 1597
133 Ga0075433_10088127 3300006852 Bacteria 2742
134 Ga0075433_10103083 3300006852 Unclassified 2527
135 Ga0075433_10216537 3300006852 Bacteria 1702
136 Ga0075434_100005230 3300006871 Bacteria 11789
137 Ga0075434_100018968 3300006871 Bacteria 6648
138 Ga0075434_100040603 3300006871 Bacteria 4607
139 Ga0075434_100098366 3300006871 Unclassified 2931
140 Ga0075434_100154577 3300006871 Bacteria 2314
141 Ga0075429_100006153 3300006880 Bacteria 10374
142 Ga0075429_100026828 3300006880 Bacteria 5002
143 Ga0075429_100032096 3300006880 Unclassified 4565
144 Ga0075429_100059661 3300006880 Unclassified 3323
145 Ga0075429_100093171 3300006880 Bacteria 2627
146 Ga0075429_100315808 3300006880 Unclassified 1367
147 Ga0075429_100347430 3300006880 Bacteria 1299
148 Ga0068865_100258411 3300006881 Bacteria 1378
149 Ga0097620_100005741 3300006931 Bacteria 12621
150 Ga0097620_100018454 3300006931 Bacteria 7011
151 Ga0097620_100185582 3300006931 Bacteria 2163
152 Ga0075435_100007095 3300007076 Bacteria 7956
153 Ga0075435_100100427 3300007076 Unclassified 2397
154 Ga0075435_100144365 3300007076 Bacteria 1998
155 Ga0111539_10025985 3300009094 Bacteria 7166
156 Ga0111539_10037188 3300009094 Bacteria 5880
157 Ga0111539_10054853 3300009094 Unclassified 4740
158 Ga0111539_10164005 3300009094 Unclassified 2599
159 Ga0111539_10213124 3300009094 Bacteria 2250
160 Ga0105245_10865207 3300009098 Unclassified 944
161 Ga0114129_10002458 3300009147 Bacteria 25718
162 Ga0114129_10007358 3300009147 Bacteria 15672
163 Ga0114129_10022237 3300009147 Bacteria 9002
164 Ga0114129_10023442 3300009147 Bacteria 8751
165 Ga0114129_10029686 3300009147 Bacteria 7742
166 Ga0114129_10085718 3300009147 Bacteria 4370
167 Ga0114129_10140770 3300009147 Unclassified 3307
168 Ga0114129_10237301 3300009147 Bacteria 2453
169 Ga0105243_10368179 3300009148 Bacteria 1325
170 Ga0105243_10470210 3300009148 Bacteria 1184
171 Ga0105249_10006243 3300009553 Bacteria 10351
172 Ga0105249_10024932 3300009553 Bacteria 5381
173 Ga0157375_10002540 3300013308 Bacteria 15836
174 Ga0157375_10036024 3300013308 Unclassified 4729
175 Ga0157375_10308483 3300013308 Bacteria 1747
176 Ga0157377_10011043 3300014745 Bacteria 4493
177 Ga0157377_10039222 3300014745 Unclassified 2619
178 Ga0157376_10111814 3300014969 Unclassified 2406
179 Ga0157376_10161644 3300014969 Bacteria 2031
180 Ga0207697_10040587 3300025315 Bacteria 1911
181 Ga0207653_10027290 3300025885 Bacteria 1833
182 Ga0207645_10044273 3300025907 Bacteria 2849
183 Ga0207645_10053926 3300025907 Bacteria 2568
184 Ga0207643_10011522 3300025908 Unclassified 4776
185 Ga0207643_10051996 3300025908 Bacteria 2326
186 Ga0207643_10157246 3300025908 Bacteria 1366
187 Ga0207684_10273310 3300025910 Bacteria 1458
188 Ga0207707_10018147 3300025912 Bacteria 6132
189 Ga0207660_10226840 3300025917 Archaea 1468
190 Ga0207660_10270005 3300025917 Unclassified 1347
191 Ga0207662_10021094 3300025918 Unclassified 3719
192 Ga0207662_10022811 3300025918 Unclassified 3592
193 Ga0207646_10148287 3300025922 Bacteria 2115
194 Ga0207646_10218676 3300025922 Bacteria 1721
195 Ga0207646_10275998 3300025922 Unclassified 1519
196 Ga0207681_10000477 3300025923 Bacteria 28008
197 Ga0207650_10013786 3300025925 Bacteria 5605
198 Ga0207659_10001007 3300025926 Bacteria 16762
199 Ga0207659_10001770 3300025926 Bacteria 12775
200 Ga0207659_10016635 3300025926 Bacteria 4791
201 Ga0207659_10063432 3300025926 Bacteria 2671
202 Ga0207659_10248290 3300025926 Bacteria 1443
203 Ga0207644_10099461 3300025931 Unclassified 2182
204 Ga0207706_10009430 3300025933 Bacteria 8961
205 Ga0207706_10127776 3300025933 Bacteria 2235
206 Ga0207670_10006051 3300025936 Bacteria 6688
207 Ga0207670_10041953 3300025936 Bacteria 3012
208 Ga0207704_10201274 3300025938 Bacteria 1458
209 Ga0207691_10005385 3300025940 Bacteria 12354
210 Ga0207691_10085284 3300025940 Unclassified 2835
211 Ga0207711_10497695 3300025941 Bacteria 1136
212 Ga0207679_10040870 3300025945 Bacteria 3322
213 Ga0207679_10052714 3300025945 Unclassified 2985
214 Ga0207679_10057966 3300025945 Bacteria 2867
215 Ga0207679_10073552 3300025945 Bacteria 2586
216 Ga0207679_10121928 3300025945 Bacteria 2077
217 Ga0207651_10092805 3300025960 Bacteria 2215
218 Ga0207651_10463314 3300025960 Bacteria 1089
219 Ga0207712_10022231 3300025961 Bacteria 4173
220 Ga0207677_10131680 3300026023 Bacteria 1900
221 Ga0207703_10103321 3300026035 Unclassified 2419
222 Ga0207703_10103937 3300026035 Bacteria 2412
223 Ga0207708_10012023 3300026075 Bacteria 6449
224 Ga0207708_10042254 3300026075 Bacteria 3475
225 Ga0207708_10080831 3300026075 Bacteria 2497
226 Ga0207641_10022018 3300026088 Bacteria 5242
227 Ga0207641_10030436 3300026088 Bacteria 4472
228 Ga0207648_10001806 3300026089 Bacteria 23448
229 Ga0207648_10003982 3300026089 Bacteria 15339
230 Ga0207648_10391622 3300026089 Bacteria 1258
231 Ga0207676_10011691 3300026095 Bacteria 6279
232 Ga0207676_10137599 3300026095 Unclassified 2086
233 Ga0207676_10189336 3300026095 Unclassified 1809
234 Ga0207676_10299165 3300026095 Unclassified 1468
235 Ga0207674_10022752 3300026116 Bacteria 6725
236 Ga0207674_10030931 3300026116 Bacteria 5627
237 Ga0207674_10060907 3300026116 Unclassified 3815
238 Ga0207674_10065868 3300026116 Unclassified 3651
239 Ga0207674_10447404 3300026116 Bacteria 1249
240 Ga0207675_100001903 3300026118 Bacteria 20813
241 Ga0207675_100006716 3300026118 Bacteria 10879
242 Ga0207675_100493680 3300026118 Bacteria 1218
243 Ga0207698_10151660 3300026142 Bacteria 2013
244 Ga0207428_10004294 3300027907 Bacteria 13628
245 Ga0207428_10011416 3300027907 Bacteria 7851
246 Ga0207428_10392953 3300027907 Unclassified 1016
247 Ga0268265_10000430 3300028380 Bacteria 44554
248 Ga0268265_10001426 3300028380 Bacteria 20225
249 Ga0268264_10013155 3300028381 Bacteria 6806
250 Ga0268264_10519525 3300028381 Bacteria 1164
251 Ga0307416_100932574 3300032002 Unclassified 969
252 Ga0373934_0061577 3300035086 Bacteria 1495
253 Ga0373940_0122173 3300035088 Unclassified 809
254 Ga0373941_0192752 3300035115 Unclassified 771
255 Ga0373960_0054584 3300035121 Bacteria 1195
256 Ga0373961_0029209 3300035241 Bacteria 1526
257 Ga0373961_0029924 3300035241 Bacteria 1511
258 Ga0373933_0178423 3300035724 Bacteria 1354
259 Ga0373937_0042811 3300036401 Unclassified 4132
260 Ga0373937_0065080 3300036401 Bacteria 3355
261 Ga0439460_0015281 3300042461 Unclassified 2030
262 Ga0451576_0016905 3300045051 Bacteria 8035
263 Ga0451576_0054389 3300045051 Bacteria 4191
264 Ga0451576_0059047 3300045051 Bacteria 4005
265 Ga0451576_0063134 3300045051 Bacteria 3861
266 Ga0451576_0065700 3300045051 Unclassified 3776
267 Ga0451576_0088796 3300045051 Unclassified 3215
268 Ga0451576_0097263 3300045051 Bacteria 3061
269 Ga0451576_0311201 3300045051 Unclassified 1648
270 Ga0495603_0032004 3300046455 Unclassified 3166
271 Ga0495629_0008030 3300046459 Bacteria 7767
272 Ga0495629_0129489 3300046459 Bacteria 1758
273 Ga0495584_0057379 3300046491 Bacteria 1959
274 Ga0495584_0076076 3300046491 Bacteria 1688
275 Ga0495585_0142044 3300046492 Unclassified 1257
276 Ga0495663_0024902 3300046525 Bacteria 1742
277 Ga0495642_0032864 3300046528 Bacteria 2084
278 Ga0495598_0028431 3300046537 Bacteria 1551
279 Ga0495598_0135507 3300046537 Unclassified 848
280 Ga0495621_0003876 3300046539 Unclassified 4154
281 Ga0495621_0033860 3300046539 Unclassified 1763
282 Ga0495621_0038684 3300046539 Bacteria 1665
283 Ga0495645_0047354 3300046543 Bacteria 3133
284 Ga0495645_0447848 3300046543 Bacteria 815
285 Ga0495656_0101269 3300046615 Bacteria 1333
286 Ga0495659_0001752 3300046664 Bacteria 7215
287 Ga0495659_0003332 3300046664 Bacteria 5153
288 Ga0495659_0007627 3300046664 Bacteria 3429
289 Ga0495659_0008716 3300046664 Bacteria 3229
290 Ga0495659_0029902 3300046664 Bacteria 1893
291 Ga0495659_0040661 3300046664 Bacteria 1658
292 Ga0495588_0028435 3300046674 Bacteria 2797
293 Ga0495669_0112307 3300046684 Bacteria 1273
294 Ga0495670_0040017 3300046691 Unclassified 2338
295 Ga0495636_0133437 3300047318 Bacteria 1105
296 Ga0495675_0123037 3300047444 Bacteria 1615
297 Ga0495677_0070517 3300047445 Unclassified 1302
298 Ga0495685_059222 3300047447 Bacteria 1292
299 Ga0501039_0064870 3300049575 Unclassified 2832
300 Ga0501040_0088867 3300049576 Bacteria 2146
301 Ga0501042_0015075 3300049578 Bacteria 5286
302 Ga0501046_0156409 3300049580 Unclassified 1717
303 Ga0501067_0052122 3300049583 Unclassified 2267
304 Ga0501070_0188106 3300049586 Bacteria 1698
305 Ga0501074_0216522 3300049590 Unclassified 1364
306 Ga0501079_0141778 3300049741 Unclassified 1872
307 Ga0501081_0123471 3300049743 Unclassified 1846
308 Ga0501045_0012962 3300049824 Bacteria 5876
309 nmdc:mga05p37_136715_c1 3300050507 Unclassified 3004
310 nmdc:mga05p37_17626_c1 3300050507 Bacteria 4370
311 nmdc:mga05p37_1802_c1 3300050507 Bacteria 24981
312 nmdc:mga05p37_280597_c1 3300050507 Bacteria 1987
313 nmdc:mga05p37_333202_c1 3300050507 Unclassified 1792
314 nmdc:mga05p37_34387_c1 3300050507 Bacteria 6208
315 nmdc:mga05p37_66973_c1 3300050507 Bacteria 4417
316 nmdc:mga05p37_7721_c1 3300050507 Bacteria 12697
317 nmdc:mga09592_11410_c1 3300050508 Bacteria 7225
318 nmdc:mga09592_153419_c1 3300050508 Bacteria 1988
319 nmdc:mga09592_22170_c1 3300050508 Bacteria 5241
320 nmdc:mga09592_306264_c1 3300050508 Bacteria 1377
321 nmdc:mga09592_31437_c1 3300050508 Unclassified 4424
322 nmdc:mga09592_354726_c1 3300050508 Bacteria 1269
323 nmdc:mga09592_38446_c1 3300050508 Unclassified 4017
324 nmdc:mga09592_56473_c1 3300050508 Bacteria 3317
325 nmdc:mga0qj67_11926_c1 3300050509 Bacteria 6530
326 nmdc:mga0qj67_268336_c1 3300050509 Bacteria 1384
327 nmdc:mga0qj67_488728_c1 3300050509 Unclassified 990
328 nmdc:mga0qj67_6121_c1 3300050509 Bacteria 8821
329 nmdc:mga0qj67_67709_c1 3300050509 Bacteria 2845
330 nmdc:mga06r32_115675_c1 3300050510 Bacteria 2642
331 nmdc:mga06r32_9006_c1 3300050510 Bacteria 8993
332 nmdc:mga08y16_115604_c1 3300050511 Unclassified 2793
333 nmdc:mga08y16_121495_c1 3300050511 Unclassified 2718
334 nmdc:mga08y16_18706_c1 3300050511 Bacteria 7297
335 nmdc:mga08y16_7153_c1 3300050511 Bacteria 11713
336 nmdc:mga08y16_81764_c1 3300050511 Bacteria 3367
337 nmdc:mga0n895_13653_c1 3300050512 Bacteria 7341
338 nmdc:mga0n895_13662_c1 3300050512 Bacteria 7340
339 nmdc:mga0n895_305106_c1 3300050512 Bacteria 1614
340 nmdc:mga0n895_47679_c1 3300050512 Bacteria 4190
341 nmdc:mga0rr50_121571_c1 3300050513 Bacteria 2079
342 nmdc:mga0rr50_66769_c1 3300050513 Unclassified 2730
343 nmdc:mga0rr50_83003_c1 3300050513 Unclassified 2476
344 nmdc:mga08x19_116386_c1 3300050514 Bacteria 1787
345 nmdc:mga08x19_199673_c1 3300050514 Bacteria 1370
346 nmdc:mga0a205_118920_c1 3300050515 Unclassified 2541
347 nmdc:mga0a205_199160_c1 3300050515 Bacteria 1893
348 nmdc:mga0a205_86698_c1 3300050515 Bacteria 3024
349 Ga0501084_0281837 3300054114 Bacteria 1403
350 Ga0501082_0030862 3300060353 Bacteria 4620
351 Ga0530510_0004580 3300061734 Bacteria 9568
352 Ga0070698_100066787
353 Ga0065704_10002050
354 Ga0065715_10091952
355 Ga0065715_10096659
356 Ga0065715_10129310
357 Ga0065707_10107912
358 Ga0070676_10022265
359 Ga0070690_100015779
360 Ga0070690_100023519
361 Ga0070670_100028770
362 Ga0070680_100090529
363 Ga0070680_100325009
364 Ga0070689_100009081
365 Ga0070689_100119097
366 Ga0070691_10171967
367 Ga0070687_100010693
368 Ga0070687_100191752
369 Ga0070692_10006215
370 Ga0070692_10106019
371 Ga0070669_100003423
372 Ga0070669_100007513
373 Ga0070675_100000119
374 Ga0070675_100001322
375 Ga0070675_100088614
376 Ga0070675_100267394
377 Ga0070671_100141074
378 Ga0070673_100042537
379 Ga0070673_100048723
380 Ga0070673_100086295
381 Ga0070673_100150811
382 Ga0070688_100004905
383 Ga0070688_100011003
384 Ga0070688_100048181
385 Ga0070688_100212128
386 Ga0070659_100118608
387 Ga0070703_10022293
388 Ga0070713_100010880
389 Ga0070701_10008520
390 Ga0070701_10009768
391 Ga0070701_10017968
392 Ga0070701_10153883
393 Ga0070705_100000684
394 Ga0070705_100006513
395 Ga0070705_100027434
396 Ga0070705_100056605
397 Ga0070700_100004007
398 Ga0070694_100002845
399 Ga0070694_100021737
400 Ga0070694_100226227
401 Ga0070708_100218702
402 Ga0070662_100009791
403 Ga0070662_100100856
404 Ga0070662_100240102
405 Ga0068867_100004226
406 Ga0068867_100044278
407 Ga0070685_10069420
408 Ga0070706_100226869
409 Ga0070707_100108046
410 Ga0070707_100534187
411 Ga0070698_100062160
412 Ga0070698_100177468
413 Ga0070698_100185866
414 Ga0070698_100277501
415 Ga0070698_100602762
416 Ga0070699_100000268
417 Ga0070699_100017209
418 Ga0070699_100294093
419 Ga0070679_100333150
420 Ga0070684_100030313
421 Ga0070684_100366639
422 Ga0070672_100114481
423 Ga0070686_100064016
424 Ga0070695_100000565
425 Ga0070696_100000299
426 Ga0070696_100012708
427 Ga0070704_100000460
428 Ga0070704_100017303
429 Ga0070704_100023056
430 Ga0070704_100042430
431 Ga0070704_100102718
432 Ga0070704_100426671
433 Ga0070704_100515252
434 Ga0070664_100012670
435 Ga0070664_100016441
436 Ga0070664_100040409
437 Ga0070664_100139125
438 Ga0070664_100644555
439 Ga0068857_100008754
440 Ga0068857_100086841
441 Ga0068857_100156231
442 Ga0070702_100019545
443 Ga0070702_100058342
444 Ga0068852_100150739
445 Ga0068859_100005740
446 Ga0068859_100018455
447 Ga0068859_100185575
448 Ga0068864_100041368
449 Ga0068864_100049009
450 Ga0068864_100086239
451 Ga0068864_100111639
452 Ga0068861_100001273
453 Ga0068861_100001936
454 Ga0068861_100264606
455 Ga0068861_100369350
456 Ga0068870_10006918
457 Ga0068870_10018246
458 Ga0068863_100136906
459 Ga0068858_100023832
460 Ga0068858_100220545
461 Ga0068860_100001722
462 Ga0068860_100014254
463 Ga0068860_100048373
464 Ga0068862_100000994
465 Ga0068862_100004775
466 Ga0081455_10160097
467 Ga0081539_10000025
468 Ga0081539_10003725
469 Ga0097621_100045848
470 Ga0068871_100250510
471 Ga0075428_100003266
472 Ga0075428_100008065
473 Ga0075428_100035719
474 Ga0075428_100038550
475 Ga0075428_100044640
476 Ga0075428_100103355
477 Ga0075428_100335997
478 Ga0075430_100018424
479 Ga0075430_100091736
480 Ga0075430_100251467
481 Ga0075431_100160293
482 Ga0075431_100229610
483 Ga0075431_100308839
484 Ga0075433_10088127
485 Ga0075433_10103083
486 Ga0075433_10216537
487 Ga0075434_100005230
488 Ga0075434_100018968
489 Ga0075434_100040603
490 Ga0075434_100098366
491 Ga0075434_100154577
492 Ga0075429_100006153
493 Ga0075429_100026828
494 Ga0075429_100032096
495 Ga0075429_100059661
496 Ga0075429_100093171
497 Ga0075429_100315808
498 Ga0075429_100347430
499 Ga0068865_100258411
500 Ga0097620_100005741
501 Ga0097620_100018454
502 Ga0097620_100185582
503 Ga0075435_100007095
504 Ga0075435_100100427
505 Ga0075435_100144365
506 Ga0111539_10025985
507 Ga0111539_10037188
508 Ga0111539_10054853
509 Ga0111539_10164005
510 Ga0111539_10213124
511 Ga0105245_10865207
512 Ga0114129_10002458
513 Ga0114129_10007358
514 Ga0114129_10022237
515 Ga0114129_10023442
516 Ga0114129_10029686
517 Ga0114129_10085718
518 Ga0114129_10140770
519 Ga0114129_10237301
520 Ga0105243_10368179
521 Ga0105243_10470210
522 Ga0105249_10006243
523 Ga0105249_10024932
524 Ga0157375_10002540
525 Ga0157375_10036024
526 Ga0157375_10308483
527 Ga0157377_10011043
528 Ga0157377_10039222
529 Ga0157376_10111814
530 Ga0157376_10161644
531 Ga0207697_10040587
532 Ga0207653_10027290
533 Ga0207645_10044273
534 Ga0207645_10053926
535 Ga0207643_10011522
536 Ga0207643_10051996
537 Ga0207643_10157246
538 Ga0207684_10273310
539 Ga0207707_10018147
540 Ga0207660_10226840
541 Ga0207660_10270005
542 Ga0207662_10021094
543 Ga0207662_10022811
544 Ga0207646_10148287
545 Ga0207646_10218676
546 Ga0207646_10275998
547 Ga0207681_10000477
548 Ga0207650_10013786
549 Ga0207659_10001007
550 Ga0207659_10001770
551 Ga0207659_10016635
552 Ga0207659_10063432
553 Ga0207659_10248290
554 Ga0207644_10099461
555 Ga0207706_10009430
556 Ga0207706_10127776
557 Ga0207670_10006051
558 Ga0207670_10041953
559 Ga0207704_10201274
560 Ga0207691_10005385
561 Ga0207691_10085284
562 Ga0207711_10497695
563 Ga0207679_10040870
564 Ga0207679_10052714
565 Ga0207679_10057966
566 Ga0207679_10073552
567 Ga0207679_10121928
568 Ga0207651_10092805
569 Ga0207651_10463314
570 Ga0207712_10022231
571 Ga0207677_10131680
572 Ga0207703_10103321
573 Ga0207703_10103937
574 Ga0207708_10012023
575 Ga0207708_10042254
576 Ga0207708_10080831
577 Ga0207641_10022018
578 Ga0207641_10030436
579 Ga0207648_10001806
580 Ga0207648_10003982
581 Ga0207648_10391622
582 Ga0207676_10011691
583 Ga0207676_10137599
584 Ga0207676_10189336
585 Ga0207676_10299165
586 Ga0207674_10022752
587 Ga0207674_10030931
588 Ga0207674_10060907
589 Ga0207674_10065868
590 Ga0207674_10447404
591 Ga0207675_100001903
592 Ga0207675_100006716
593 Ga0207675_100493680
594 Ga0207698_10151660
595 Ga0207428_10004294
596 Ga0207428_10011416
597 Ga0207428_10392953
598 Ga0268265_10000430
599 Ga0268265_10001426
600 Ga0268264_10013155
601 Ga0268264_10519525
602 Ga0307416_100932574
603 Ga0373934_0061577
604 Ga0373940_0122173
605 Ga0373941_0192752
606 Ga0373960_0054584
607 Ga0373961_0029209
608 Ga0373961_0029924
609 Ga0373933_0178423
610 Ga0373937_0042811
611 Ga0373937_0065080
612 Ga0439460_0015281
613 Ga0451576_0016905
614 Ga0451576_0054389
615 Ga0451576_0059047
616 Ga0451576_0063134
617 Ga0451576_0065700
618 Ga0451576_0088796
619 Ga0451576_0097263
620 Ga0451576_0311201
621 Ga0495603_0032004
622 Ga0495629_0008030
623 Ga0495629_0129489
624 Ga0495584_0057379
625 Ga0495584_0076076
626 Ga0495585_0142044
627 Ga0495663_0024902
628 Ga0495642_0032864
629 Ga0495598_0028431
630 Ga0495598_0135507
631 Ga0495621_0003876
632 Ga0495621_0033860
633 Ga0495621_0038684
634 Ga0495645_0047354
635 Ga0495645_0447848
636 Ga0495656_0101269
637 Ga0495659_0001752
638 Ga0495659_0003332
639 Ga0495659_0007627
640 Ga0495659_0008716
641 Ga0495659_0029902
642 Ga0495659_0040661
643 Ga0495588_0028435
644 Ga0495669_0112307
645 Ga0495670_0040017
646 Ga0495636_0133437
647 Ga0495675_0123037
648 Ga0495677_0070517
649 Ga0495685_059222
650 Ga0501039_0064870
651 Ga0501040_0088867
652 Ga0501042_0015075
653 Ga0501046_0156409
654 Ga0501067_0052122
655 Ga0501070_0188106
656 Ga0501074_0216522
657 Ga0501079_0141778
658 Ga0501081_0123471
659 Ga0501045_0012962
660 nmdc:mga05p37_136715_c1
661 nmdc:mga05p37_17626_c1
662 nmdc:mga05p37_1802_c1
663 nmdc:mga05p37_280597_c1
664 nmdc:mga05p37_333202_c1
665 nmdc:mga05p37_34387_c1
666 nmdc:mga05p37_66973_c1
667 nmdc:mga05p37_7721_c1
668 nmdc:mga09592_11410_c1
669 nmdc:mga09592_153419_c1
670 nmdc:mga09592_22170_c1
671 nmdc:mga09592_306264_c1
672 nmdc:mga09592_31437_c1
673 nmdc:mga09592_354726_c1
674 nmdc:mga09592_38446_c1
675 nmdc:mga09592_56473_c1
676 nmdc:mga0qj67_11926_c1
677 nmdc:mga0qj67_268336_c1
678 nmdc:mga0qj67_488728_c1
679 nmdc:mga0qj67_6121_c1
680 nmdc:mga0qj67_67709_c1
681 nmdc:mga06r32_115675_c1
682 nmdc:mga06r32_9006_c1
683 nmdc:mga08y16_115604_c1
684 nmdc:mga08y16_121495_c1
685 nmdc:mga08y16_18706_c1
686 nmdc:mga08y16_7153_c1
687 nmdc:mga08y16_81764_c1
688 nmdc:mga0n895_13653_c1
689 nmdc:mga0n895_13662_c1
690 nmdc:mga0n895_305106_c1
691 nmdc:mga0n895_47679_c1
692 nmdc:mga0rr50_121571_c1
693 nmdc:mga0rr50_66769_c1
694 nmdc:mga0rr50_83003_c1
695 nmdc:mga08x19_116386_c1
696 nmdc:mga08x19_199673_c1
697 nmdc:mga0a205_118920_c1
698 nmdc:mga0a205_199160_c1
699 nmdc:mga0a205_86698_c1
700 Ga0501084_0281837
701 Ga0501082_0030862
702 Ga0530510_0004580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s0p-assembly3.cif.gz_F copper-reconstituted tomato chloroplast superoxide dismutase 0.7701 179 227
3s0p-assembly1.cif.gz_B copper-reconstituted tomato chloroplast superoxide dismutase 0.7669 179 227
3s0p-assembly4.cif.gz_H copper-reconstituted tomato chloroplast superoxide dismutase 0.7669 179 227
6fp6-assembly1.cif.gz_B complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7177 175 227
5bp3-assembly2.cif.gz_A-3 dehydratase domain (dh) of a mycocerosic acid synthase-like (mas-like) pks, crystal form 2 0.6909 200 250
ID Description Score Start End Superfamily
2essA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7928 200 245 3.10.129.10
af_Q54IX3_938_1201_3.10.129.110 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.7903 205 251 3.10.129.110
af_Q54FQ1_990_1262_3.10.129.110 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.7324 204 256 3.10.129.110
af_F1QJ27_67_335_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7164 169 212 3.40.50.300
3khpB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6886 200 244 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1F2S5M9-F1-model_v4 Uncharacterized protein 0.8601 124 255
AF-A0A2V9CU41-F1-model_v4 Uncharacterized protein 0.859 148 236
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.8496 119 250
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.8433 119 250
AF-A0A1Q7FWK8-F1-model_v4 LPS export ABC transporter periplasmic protein LptC 0.8369 114 254

Map