F419161

General Info

Members Datasets Scaffolds Average Seq Length
352 212 352 227

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0000904|Ga0496108_0000904_22295_23092
Length 265
Sequence VLIQGPCHDRLELRFSSLFNLNHKEAPMAPRIIVSYDDTDNDRDALALGRLLAFSGAELSLAYVRHAQGGALEQKEAEDLLERGAEAVGAPDMPRHVIVNPGTSVGLTELAEQENADIIVFGSEYRTADGLVKPGISAHKLLLGGPAAIAVAPAGLRERPSAGVTTIGILDEGDDAARATAASLAAALGAGVADFKGTPVDLLVVGSRPESPQGKVTLSASSDYAVEAATYPVLVVPRGVTIRFDAAVPEPQAPQDEPEAPPVTA

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 11.08
Rhizosphere 84.09
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10031783 3300003659 Bacteria 1127
2 Ga0070658_10032896 3300005327 Bacteria 4170
3 Ga0070683_100001764 3300005329 Bacteria 16833
4 Ga0070683_100004081 3300005329 Bacteria 11970
5 Ga0070677_10000021 3300005333 Bacteria 47171
6 Ga0070682_100000334 3300005337 Bacteria 32362
7 Ga0068868_100000615 3300005338 Bacteria 23958
8 Ga0070660_100210304 3300005339 Bacteria 1579
9 Ga0070660_100229107 3300005339 Bacteria 1512
10 Ga0070689_100027653 3300005340 Bacteria 4277
11 Ga0070687_100033698 3300005343 Bacteria 2530
12 Ga0070661_100000255 3300005344 Bacteria 43552
13 Ga0070692_10175873 3300005345 Viruses 1237
14 Ga0070668_100008466 3300005347 Bacteria 7640
15 Ga0070674_100000034 3300005356 Bacteria 63783
16 Ga0070674_100001938 3300005356 Bacteria 11300
17 Ga0070688_100003986 3300005365 Bacteria 7652
18 Ga0070688_100008337 3300005365 Bacteria 5624
19 Ga0070659_100000954 3300005366 Bacteria 21269
20 Ga0070667_100048020 3300005367 Bacteria 3592
21 Ga0070667_100113221 3300005367 Bacteria 2354
22 Ga0070714_100001276 3300005435 Bacteria 18215
23 Ga0070714_100045577 3300005435 Bacteria 3717
24 Ga0070714_100052229 3300005435 Bacteria 3486
25 Ga0070713_100000101 3300005436 Bacteria 54832
26 Ga0070711_100165473 3300005439 Bacteria 1681
27 Ga0070662_100000001 3300005457 Bacteria 317995
28 Ga0070681_10015709 3300005458 Bacteria 7545
29 Ga0070681_10393981 3300005458 Bacteria 1296
30 Ga0070685_10001176 3300005466 Bacteria 14005
31 Ga0070679_100000365 3300005530 Bacteria 38496
32 Ga0070684_100021460 3300005535 Bacteria 5374
33 Ga0070684_100041158 3300005535 Bacteria 3983
34 Ga0068853_100240008 3300005539 Unclassified 1661
35 Ga0070686_100033718 3300005544 Bacteria 3148
36 Ga0070693_100001286 3300005547 Bacteria 11337
37 Ga0070693_100134450 3300005547 Bacteria 1550
38 Ga0068857_100045400 3300005577 Bacteria 3898
39 Ga0068854_100000267 3300005578 Bacteria 35526
40 Ga0068854_100017154 3300005578 Bacteria 4841
41 Ga0068856_100001040 3300005614 Bacteria 29492
42 Ga0068856_100026649 3300005614 Bacteria 5637
43 Ga0070702_100233551 3300005615 Bacteria 1237
44 Ga0068852_100000132 3300005616 Bacteria 50593
45 Ga0068859_101112114 3300005617 Unclassified 869
46 Ga0068866_10000005 3300005718 Bacteria 196339
47 Ga0068866_10000891 3300005718 Bacteria 13181
48 Ga0068851_10002447 3300005834 Bacteria 8147
49 Ga0068851_10004966 3300005834 Bacteria 6025
50 Ga0068863_100000050 3300005841 Bacteria 130200
51 Ga0068858_100000017 3300005842 Bacteria 186913
52 Ga0068860_100590315 3300005843 Unclassified 1116
53 Ga0068862_100006605 3300005844 Bacteria 9618
54 Ga0081455_10001231 3300005937 Bacteria 31996
55 Ga0081455_10051128 3300005937 Bacteria 3546
56 Ga0081540_1000046 3300005983 Bacteria 131375
57 Ga0070717_10000006 3300006028 Bacteria 353403
58 Ga0075365_10311936 3300006038 Bacteria 1107
59 Ga0075368_10048130 3300006042 Bacteria 1689
60 Ga0075363_100408192 3300006048 Bacteria 799
61 Ga0075364_10200306 3300006051 Bacteria 1353
62 Ga0070712_100000003 3300006175 Bacteria 253696
63 Ga0075369_10014393 3300006186 Bacteria 3159
64 Ga0075433_10020838 3300006852 Bacteria 5488
65 Ga0075433_10188661 3300006852 Bacteria 1834
66 Ga0075434_100077172 3300006871 Bacteria 3326
67 Ga0068865_100000039 3300006881 Bacteria 73689
68 Ga0068865_100540610 3300006881 Unclassified 977
69 Ga0097620_101112210 3300006931 Unclassified 869
70 Ga0075435_100039664 3300007076 Bacteria 3759
71 Ga0105240_10108593 3300009093 Bacteria 3361
72 Ga0111539_10640010 3300009094 Bacteria 1238
73 Ga0105245_10000022 3300009098 Bacteria 181225
74 Ga0105245_10001911 3300009098 Bacteria 18926
75 Ga0105245_10007491 3300009098 Bacteria 9564
76 Ga0105245_10025648 3300009098 Bacteria 5183
77 Ga0105245_10289515 3300009098 Unclassified 1604
78 Ga0105245_10683842 3300009098 Bacteria 1058
79 Ga0105247_10000832 3300009101 Bacteria 23437
80 Ga0105241_10209044 3300009174 Bacteria 1634
81 Ga0105242_10003703 3300009176 Bacteria 11898
82 Ga0105242_10091353 3300009176 Bacteria 2563
83 Ga0105248_10000017 3300009177 Bacteria 298089
84 Ga0105248_10315184 3300009177 Bacteria 1762
85 Ga0105238_10000016 3300009551 Bacteria 236218
86 Ga0105249_10000054 3300009553 Bacteria 162883
87 Ga0105249_10024928 3300009553 Bacteria 5381
88 Ga0105249_10475417 3300009553 Bacteria 1292
89 Ga0105239_10067201 3300010375 Bacteria 3938
90 Ga0157371_10005762 3300013102 Bacteria 10381
91 Ga0157370_10018159 3300013104 Bacteria 7079
92 Ga0157370_10022495 3300013104 Bacteria 6272
93 Ga0157369_10000803 3300013105 Bacteria 40158
94 Ga0157378_10003220 3300013297 Bacteria 14521
95 Ga0157378_10052238 3300013297 Unclassified 3637
96 Ga0157378_10519642 3300013297 Bacteria 1192
97 Ga0163162_10998599 3300013306 Bacteria 946
98 Ga0157372_10000407 3300013307 Bacteria 47331
99 Ga0157372_10463320 3300013307 Bacteria 1477
100 Ga0157375_10000194 3300013308 Bacteria 56860
101 Ga0157375_10013139 3300013308 Bacteria 7357
102 Ga0157375_10258097 3300013308 Bacteria 1904
103 Ga0163163_10979274 3300014325 Bacteria 909
104 Ga0157379_10029192 3300014968 Bacteria 4905
105 Ga0157379_10037859 3300014968 Bacteria 4302
106 Ga0207656_10000620 3300025321 Bacteria 11627
107 Ga0207656_10001698 3300025321 Bacteria 7310
108 Ga0207682_10000020 3300025893 Bacteria 64537
109 Ga0207642_10000005 3300025899 Bacteria 401934
110 Ga0207642_10000681 3300025899 Bacteria 10448
111 Ga0207710_10000227 3300025900 Bacteria 48932
112 Ga0207688_10127969 3300025901 Bacteria 1487
113 Ga0207654_10025727 3300025911 Bacteria 3178
114 Ga0207707_10136672 3300025912 Bacteria 2143
115 Ga0207695_10081727 3300025913 Bacteria 3269
116 Ga0207693_10000009 3300025915 Bacteria 168990
117 Ga0207693_10006350 3300025915 Bacteria 9795
118 Ga0207663_10263933 3300025916 Bacteria 1273
119 Ga0207663_10576573 3300025916 Bacteria 882
120 Ga0207663_10709317 3300025916 Unclassified 797
121 Ga0207657_10285320 3300025919 Bacteria 1310
122 Ga0207649_10000015 3300025920 Bacteria 245662
123 Ga0207652_10000536 3300025921 Bacteria 38532
124 Ga0207694_10000012 3300025924 Bacteria 411218
125 Ga0207687_10000025 3300025927 Bacteria 175177
126 Ga0207687_10000065 3300025927 Bacteria 80752
127 Ga0207687_10001395 3300025927 Bacteria 16502
128 Ga0207687_10001642 3300025927 Bacteria 15441
129 Ga0207700_10000019 3300025928 Bacteria 183117
130 Ga0207664_10000060 3300025929 Bacteria 116764
131 Ga0207664_10008355 3300025929 Bacteria 7214
132 Ga0207664_10038748 3300025929 Bacteria 3697
133 Ga0207664_10042397 3300025929 Bacteria 3552
134 Ga0207706_10000003 3300025933 Bacteria 345011
135 Ga0207686_10001801 3300025934 Bacteria 11912
136 Ga0207686_10058571 3300025934 Unclassified 2429
137 Ga0207686_10352027 3300025934 Bacteria 1109
138 Ga0207686_10691134 3300025934 Unclassified 810
139 Ga0207709_10099872 3300025935 Bacteria 1916
140 Ga0207670_10024168 3300025936 Bacteria 3795
141 Ga0207669_10000002 3300025937 Bacteria 377651
142 Ga0207669_10000060 3300025937 Bacteria 54757
143 Ga0207704_10000165 3300025938 Bacteria 35234
144 Ga0207711_10000011 3300025941 Bacteria 518817
145 Ga0207661_10009098 3300025944 Bacteria 7118
146 Ga0207661_10010577 3300025944 Bacteria 6646
147 Ga0207661_10738496 3300025944 Bacteria 906
148 Ga0207667_10662091 3300025949 Bacteria 1049
149 Ga0207712_10000032 3300025961 Bacteria 210628
150 Ga0207712_10608579 3300025961 Unclassified 946
151 Ga0207668_10007808 3300025972 Bacteria 6364
152 Ga0207640_10002975 3300025981 Bacteria 9123
153 Ga0207640_10012422 3300025981 Bacteria 4848
154 Ga0207640_10177945 3300025981 Bacteria 1592
155 Ga0207658_10026209 3300025986 Bacteria 4085
156 Ga0207658_10082253 3300025986 Bacteria 2472
157 Ga0207677_10000163 3300026023 Bacteria 52869
158 Ga0207703_10000030 3300026035 Bacteria 199014
159 Ga0207639_10166800 3300026041 Unclassified 1861
160 Ga0207702_10000349 3300026078 Bacteria 52941
161 Ga0207702_10068076 3300026078 Bacteria 3058
162 Ga0207702_10313114 3300026078 Bacteria 1493
163 Ga0207641_10004313 3300026088 Bacteria 12349
164 Ga0207641_10526971 3300026088 Unclassified 1150
165 Ga0207674_10092994 3300026116 Bacteria 3005
166 Ga0207698_10000014 3300026142 Bacteria 240703
167 Ga0268265_10034234 3300028380 Unclassified 3700
168 Ga0265337_1002089 3300028556 Bacteria 9441
169 Ga0265326_10000024 3300028558 Bacteria 112928
170 Ga0265326_10000033 3300028558 Bacteria 91972
171 Ga0265319_1000037 3300028563 Bacteria 115642
172 Ga0265334_10000078 3300028573 Bacteria 70145
173 Ga0265323_10168337 3300028653 Bacteria 697
174 Ga0265322_10000017 3300028654 Bacteria 114833
175 Ga0265336_10019377 3300028666 Bacteria 2195
176 Ga0265338_10000051 3300028800 Bacteria 211202
177 Ga0265338_10018497 3300028800 Bacteria 7456
178 Ga0265324_10000479 3300029957 Bacteria 28017
179 Ga0265332_10028836 3300031238 Unclassified 2428
180 Ga0265328_10002684 3300031239 Bacteria 7960
181 Ga0265320_10000010 3300031240 Bacteria 250501
182 Ga0265329_10045987 3300031242 Bacteria 1394
183 Ga0265331_10000505 3300031250 Bacteria 36592
184 Ga0265327_10000040 3300031251 Bacteria 291052
185 Ga0265316_10031948 3300031344 Unclassified 4301
186 Ga0265313_10042670 3300031595 Bacteria 2226
187 Ga0265314_10000803 3300031711 Bacteria 37303
188 Ga0265342_10079499 3300031712 Bacteria 1896
189 Ga0316583_10164854 3300032133 Unclassified 771
190 Ga0373953_0170355 3300035117 Bacteria 937
191 Ga0373924_0226122 3300035410 Bacteria 827
192 Ga0373937_0047810 3300036401 Bacteria 3915
193 Ga0316582_0416473 3300036647 Bacteria 926
194 Ga0436360_0475298 3300039438 Bacteria 5245
195 Ga0436363_1293873 3300039450 Bacteria 984
196 Ga0436363_1662024 3300039450 Unclassified 907
197 Ga0466963_0000051 3300044694 Bacteria 39254
198 Ga0466963_0058658 3300044694 Bacteria 2567
199 Ga0466963_0140851 3300044694 Bacteria 1671
200 Ga0495592_0366595 3300046454 Bacteria 920
201 Ga0495603_0003294 3300046455 Bacteria 9611
202 Ga0495603_0017863 3300046455 Bacteria 4294
203 Ga0495629_0003154 3300046459 Bacteria 12483
204 Ga0495629_0022365 3300046459 Bacteria 4508
205 Ga0495629_0042208 3300046459 Bacteria 3206
206 Ga0495641_0018394 3300046461 Archaea 3606
207 Ga0495641_0052780 3300046461 Unclassified 1852
208 Ga0495651_0561868 3300046462 Unclassified 724
209 Ga0495653_0112075 3300046463 Bacteria 1959
210 Ga0495653_0155047 3300046463 Bacteria 1596
211 Ga0495582_0000002 3300046473 Bacteria 219909
212 Ga0495662_0019399 3300046476 Bacteria 3288
213 Ga0495662_0022903 3300046476 Bacteria 3015
214 Ga0495662_0069045 3300046476 Bacteria 1712
215 Ga0495594_0000001 3300046499 Bacteria 293051
216 Ga0495606_0000886 3300046507 Bacteria 44754
217 Ga0495608_0000071 3300046511 Bacteria 77182
218 Ga0495608_0003011 3300046511 Bacteria 12031
219 Ga0495618_0000051 3300046514 Bacteria 87668
220 Ga0495620_0000154 3300046515 Bacteria 55875
221 Ga0495628_0032279 3300046516 Bacteria 4228
222 Ga0495630_0000027 3300046517 Bacteria 146589
223 Ga0495630_0000125 3300046517 Bacteria 61325
224 Ga0495652_0000009 3300046529 Bacteria 311000
225 Ga0495652_0136895 3300046529 Bacteria 1931
226 Ga0495586_0008656 3300046535 Bacteria 5418
227 Ga0495587_0001679 3300046536 Bacteria 14777
228 Ga0495587_0085269 3300046536 Bacteria 1829
229 Ga0495645_0005720 3300046543 Bacteria 8566
230 Ga0495645_0029900 3300046543 Bacteria 3967
231 Ga0495622_0000033 3300046557 Bacteria 124162
232 Ga0495667_0000019 3300046559 Bacteria 181645
233 Ga0495667_0082351 3300046559 Bacteria 2091
234 Ga0495634_0000728 3300046642 Bacteria 31906
235 Ga0495634_0001282 3300046642 Bacteria 23024
236 Ga0495634_0010090 3300046642 Bacteria 6933
237 Ga0495634_0023515 3300046642 Bacteria 4330
238 Ga0495625_0453204 3300046660 Bacteria 792
239 Ga0495635_0000017 3300046663 Bacteria 195506
240 Ga0495635_0012168 3300046663 Bacteria 6033
241 Ga0495635_0048705 3300046663 Bacteria 2921
242 Ga0495657_0000096 3300046675 Bacteria 77239
243 Ga0495657_0017703 3300046675 Bacteria 5169
244 Ga0495599_0102178 3300046678 Bacteria 1787
245 Ga0495647_0000707 3300046681 Bacteria 9923
246 Ga0495658_0000001 3300046683 Bacteria 385362
247 Ga0495658_0002175 3300046683 Bacteria 9917
248 Ga0495658_0016565 3300046683 Bacteria 3794
249 Ga0495669_0000067 3300046684 Bacteria 68406
250 Ga0495669_0003115 3300046684 Bacteria 6824
251 Ga0495613_0000067 3300046689 Bacteria 101960
252 Ga0495613_0000155 3300046689 Bacteria 67203
253 Ga0495613_0040081 3300046689 Bacteria 3471
254 Ga0495624_0000200 3300046690 Bacteria 45997
255 Ga0495624_0353748 3300046690 Unclassified 883
256 Ga0495600_0001022 3300046809 Bacteria 15110
257 Ga0495600_0132196 3300046809 Bacteria 1622
258 Ga0495604_0000252 3300047317 Bacteria 47517
259 Ga0495604_0004840 3300047317 Bacteria 10669
260 Ga0495672_0116586 3300047320 Unclassified 1426
261 Ga0495676_0001522 3300047321 Bacteria 20074
262 Ga0495676_0014385 3300047321 Bacteria 7081
263 Ga0495676_0430178 3300047321 Unclassified 873
264 Ga0495680_0001106 3300047322 Bacteria 29781
265 Ga0495680_0003503 3300047322 Bacteria 15397
266 Ga0495680_0009313 3300047322 Bacteria 8845
267 Ga0495680_0268229 3300047322 Bacteria 1206
268 Ga0495675_0000036 3300047444 Bacteria 91842
269 Ga0495679_032643 3300047446 Bacteria 1668
270 Ga0495684_0328312 3300047471 Bacteria 1092
271 Ga0495593_0151117 3300047673 Bacteria 1174
272 Ga0495602_0000548 3300048088 Bacteria 35114
273 Ga0495602_0045718 3300048088 Bacteria 3960
274 Ga0496100_0000006 3300048903 Bacteria 297429
275 Ga0496100_0063756 3300048903 Bacteria 2436
276 Ga0496101_0000009 3300048904 Bacteria 297429
277 Ga0496101_0034365 3300048904 Bacteria 3580
278 Ga0496102_0512533 3300048905 Bacteria 1122
279 Ga0496102_0829426 3300048905 Bacteria 847
280 Ga0496104_0000029 3300048907 Bacteria 202968
281 Ga0496104_0002134 3300048907 Bacteria 17161
282 Ga0496105_0000002 3300048908 Bacteria 753215
283 Ga0496105_0001818 3300048908 Bacteria 15276
284 Ga0496106_0000072 3300048909 Bacteria 80978
285 Ga0496106_0001291 3300048909 Bacteria 18817
286 Ga0496106_0298775 3300048909 Bacteria 1291
287 Ga0496107_0000015 3300048910 Bacteria 173644
288 Ga0496107_0025573 3300048910 Bacteria 4180
289 Ga0496108_0000004 3300048911 Bacteria 545055
290 Ga0496108_0000239 3300048911 Bacteria 49308
291 Ga0496108_0000904 3300048911 Bacteria 23112
292 Ga0496108_0002920 3300048911 Bacteria 13744
293 Ga0496108_0016161 3300048911 Bacteria 6085
294 Ga0496108_0589093 3300048911 Bacteria 969
295 Ga0496109_0000011 3300048912 Bacteria 234908
296 Ga0496109_0000031 3300048912 Bacteria 163998
297 Ga0496109_0000304 3300048912 Bacteria 46522
298 Ga0496109_0000369 3300048912 Bacteria 41635
299 Ga0496109_0009459 3300048912 Bacteria 8309
300 Ga0496110_0000171 3300048913 Bacteria 39922
301 Ga0496110_0244054 3300048913 Unclassified 1635
302 Ga0496111_0000020 3300048914 Bacteria 67992
303 Ga0496112_0000641 3300048915 Bacteria 24272
304 Ga0496112_0083023 3300048915 Bacteria 3168
305 Ga0496113_0000002 3300048916 Bacteria 220193
306 Ga0496113_0406397 3300048916 Unclassified 1093
307 Ga0496114_0000003 3300048917 Bacteria 630981
308 Ga0496114_0067954 3300048917 Bacteria 2991
309 Ga0496114_0112217 3300048917 Bacteria 2336
310 Ga0496115_0000022 3300048918 Bacteria 164224
311 Ga0496115_0000027 3300048918 Bacteria 145505
312 Ga0496115_0044379 3300048918 Bacteria 3545
313 Ga0496116_0000138 3300048919 Bacteria 151606
314 Ga0496117_0002585 3300048920 Bacteria 22522
315 Ga0496118_0001672 3300048921 Bacteria 32516
316 Ga0496118_0261894 3300048921 Unclassified 975
317 Ga0496119_0004068 3300048922 Bacteria 14751
318 Ga0496119_0007922 3300048922 Bacteria 9454
319 Ga0496120_0001397 3300048923 Bacteria 29221
320 Ga0496126_0046969 3300048929 Bacteria 3955
321 Ga0496126_0094459 3300048929 Bacteria 2624
322 Ga0501047_0138259 3300049581 Unclassified 2315
323 Ga0501070_0005207 3300049586 Bacteria 11084
324 Ga0501083_0022284 3300049744 Bacteria 4395
325 nmdc:mga0yw44_236774_c1 3300050492 Bacteria 1213
326 nmdc:mga05p37_472487_c1 3300050507 Bacteria 1446
327 nmdc:mga0n895_247189_c1 3300050512 Bacteria 1810
328 nmdc:mga0n895_397584_c1 3300050512 Bacteria 1394
329 nmdc:mga0rr50_45221_c1 3300050513 Bacteria 3234
330 nmdc:mga08x19_493569_c1 3300050514 Bacteria 864
331 nmdc:mga0a205_560075_c1 3300050515 Bacteria 998
332 nmdc:mga0a205_9195_c1 3300050515 Bacteria 9020
333 Ga0495601_0000019 3300053077 Bacteria 161673
334 Ga0495601_0011249 3300053077 Bacteria 5347
335 Ga0495601_0016446 3300053077 Bacteria 4483
336 Ga0495601_0068018 3300053077 Bacteria 2270
337 Ga0495601_0266869 3300053077 Bacteria 1117
338 Ga0495612_0010522 3300053078 Bacteria 3739
339 Ga0495612_0038164 3300053078 Bacteria 1952
340 Ga0495612_0046990 3300053078 Bacteria 1768
341 Ga0495612_0151123 3300053078 Bacteria 1011
342 Ga0495595_0000009 3300053084 Bacteria 193039
343 Ga0495595_0163261 3300053084 Bacteria 1100
344 Ga0495619_0000001 3300053085 Bacteria 586054
345 Ga0495619_0000022 3300053085 Bacteria 184144
346 Ga0495619_0000124 3300053085 Bacteria 56387
347 Ga0495619_0000177 3300053085 Bacteria 46800
348 Ga0495619_0000649 3300053085 Bacteria 22812
349 Ga0495619_0002165 3300053085 Bacteria 13016
350 Ga0495619_0007570 3300053085 Bacteria 6875
351 Ga0495619_0169723 3300053085 Bacteria 1508
352 Ga0495619_0208904 3300053085 Bacteria 1352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10007491 Ga0105245_100074912 202
2 3300025927 Ga0207687_10001395 Ga0207687_100013958 202
3 3300046536 Ga0495587_0085269 Ga0495587_0085269_462_1193 203
4 3300047322 Ga0495680_0003503 Ga0495680_0003503_3679_4401 203
5 3300046663 Ga0495635_0012168 Ga0495635_0012168_420_1064 204
6 3300048903 Ga0496100_0063756 Ga0496100_0063756_976_1689 205
7 3300048904 Ga0496101_0034365 Ga0496101_0034365_761_1474 205
8 3300013104 Ga0157370_10022495 Ga0157370_100224958 207
9 3300005539 Ga0068853_100240008 Ga0068853_1002400082 208
10 3300026041 Ga0207639_10166800 Ga0207639_101668002 208
11 3300005329 Ga0070683_100001764 Ga0070683_1000017642 209
12 3300005535 Ga0070684_100041158 Ga0070684_1000411582 209
13 3300025944 Ga0207661_10010577 Ga0207661_100105777 209
14 3300046559 Ga0495667_0000019 Ga0495667_0000019_78948_79625 212
15 3300047322 Ga0495680_0001106 Ga0495680_0001106_8745_9422 212
16 3300005365 Ga0070688_100003986 Ga0070688_1000039865 215
17 3300005466 Ga0070685_10001176 Ga0070685_100011765 215
18 3300046683 Ga0495658_0002175 Ga0495658_0002175_4325_4996 215
19 3300005347 Ga0070668_100008466 Ga0070668_1000084665 216
20 3300005356 Ga0070674_100001938 Ga0070674_1000019388 216
21 3300005367 Ga0070667_100048020 Ga0070667_1000480202 216
22 3300005617 Ga0068859_101112114 Ga0068859_1011121141 216
23 3300005718 Ga0068866_10000891 Ga0068866_100008915 216
24 3300005843 Ga0068860_100590315 Ga0068860_1005903152 216
25 3300005844 Ga0068862_100006605 Ga0068862_1000066056 216
26 3300006038 Ga0075365_10311936 Ga0075365_103119362 216
27 3300006042 Ga0075368_10048130 Ga0075368_100481302 216
28 3300006051 Ga0075364_10200306 Ga0075364_102003062 216
29 3300006186 Ga0075369_10014393 Ga0075369_100143935 216
30 3300006931 Ga0097620_101112210 Ga0097620_1011122101 216
31 3300009098 Ga0105245_10289515 Ga0105245_102895154 216
32 3300009176 Ga0105242_10091353 Ga0105242_100913532 216
33 3300009553 Ga0105249_10024928 Ga0105249_100249282 216
34 3300009553 Ga0105249_10475417 Ga0105249_104754172 216
35 3300013297 Ga0157378_10519642 Ga0157378_105196421 216
36 3300014968 Ga0157379_10029192 Ga0157379_100291924 216
37 3300025899 Ga0207642_10000681 Ga0207642_100006818 216
38 3300025901 Ga0207688_10127969 Ga0207688_101279691 216
39 3300025916 Ga0207663_10709317 Ga0207663_107093171 216
40 3300025919 Ga0207657_10285320 Ga0207657_102853203 216
41 3300025934 Ga0207686_10352027 Ga0207686_103520271 216
42 3300025934 Ga0207686_10691134 Ga0207686_106911341 216
43 3300025935 Ga0207709_10099872 Ga0207709_100998723 216
44 3300025937 Ga0207669_10000002 Ga0207669_1000000254 216
45 3300025961 Ga0207712_10608579 Ga0207712_106085792 216
46 3300025972 Ga0207668_10007808 Ga0207668_100078084 216
47 3300025981 Ga0207640_10177945 Ga0207640_101779452 216
48 3300025986 Ga0207658_10026209 Ga0207658_100262094 216
49 3300026088 Ga0207641_10526971 Ga0207641_105269711 216
50 3300028380 Ga0268265_10034234 Ga0268265_100342342 216
51 3300039450 Ga0436363_1293873 Ga0436363_1293873_242_934 216
52 3300039450 Ga0436363_1662024 Ga0436363_1662024_129_821 216
53 3300046476 Ga0495662_0022903 Ga0495662_0022903_1379_2059 216
54 3300046642 Ga0495634_0023515 Ga0495634_0023515_549_1271 216
55 3300046660 Ga0495625_0453204 Ga0495625_0453204_91_741 216
56 3300046663 Ga0495635_0048705 Ga0495635_0048705_317_1021 216
57 3300046684 Ga0495669_0003115 Ga0495669_0003115_3367_4047 216
58 3300047321 Ga0495676_0430178 Ga0495676_0430178_150_830 216
59 3300048905 Ga0496102_0512533 Ga0496102_0512533_156_824 216
60 3300048911 Ga0496108_0002920 Ga0496108_0002920_4043_4759 216
61 3300048917 Ga0496114_0067954 Ga0496114_0067954_2039_2707 216
62 3300050492 nmdc:mga0yw44_236774_c1 nmdc:mga0yw44_236774_c1_104_790 216
63 3300003659 JGI25404J52841_10031783 JGI25404J52841_100317831 217
64 3300005327 Ga0070658_10032896 Ga0070658_100328963 217
65 3300005329 Ga0070683_100004081 Ga0070683_1000040815 217
66 3300005333 Ga0070677_10000021 Ga0070677_1000002132 217
67 3300005337 Ga0070682_100000334 Ga0070682_1000003349 217
68 3300005338 Ga0068868_100000615 Ga0068868_1000006156 217
69 3300005339 Ga0070660_100210304 Ga0070660_1002103042 217
70 3300005339 Ga0070660_100229107 Ga0070660_1002291072 217
71 3300005340 Ga0070689_100027653 Ga0070689_1000276534 217
72 3300005343 Ga0070687_100033698 Ga0070687_1000336983 217
73 3300005344 Ga0070661_100000255 Ga0070661_10000025519 217
74 3300005345 Ga0070692_10175873 Ga0070692_101758732 217
75 3300005356 Ga0070674_100000034 Ga0070674_10000003417 217
76 3300005365 Ga0070688_100008337 Ga0070688_1000083374 217
77 3300005366 Ga0070659_100000954 Ga0070659_10000095410 217
78 3300005367 Ga0070667_100113221 Ga0070667_1001132212 217
79 3300005435 Ga0070714_100001276 Ga0070714_1000012763 217
80 3300005435 Ga0070714_100045577 Ga0070714_1000455773 217
81 3300005435 Ga0070714_100052229 Ga0070714_1000522294 217
82 3300005436 Ga0070713_100000101 Ga0070713_1000001019 217
83 3300005439 Ga0070711_100165473 Ga0070711_1001654732 217
84 3300005457 Ga0070662_100000001 Ga0070662_100000001257 217
85 3300005458 Ga0070681_10015709 Ga0070681_100157093 217
86 3300005458 Ga0070681_10393981 Ga0070681_103939811 217
87 3300005530 Ga0070679_100000365 Ga0070679_1000003658 217
88 3300005535 Ga0070684_100021460 Ga0070684_1000214603 217
89 3300005544 Ga0070686_100033718 Ga0070686_1000337183 217
90 3300005547 Ga0070693_100001286 Ga0070693_1000012862 217
91 3300005547 Ga0070693_100134450 Ga0070693_1001344502 217
92 3300005577 Ga0068857_100045400 Ga0068857_1000454005 217
93 3300005578 Ga0068854_100000267 Ga0068854_1000002676 217
94 3300005578 Ga0068854_100017154 Ga0068854_1000171543 217
95 3300005614 Ga0068856_100001040 Ga0068856_10000104011 217
96 3300005614 Ga0068856_100026649 Ga0068856_1000266496 217
97 3300005615 Ga0070702_100233551 Ga0070702_1002335512 217
98 3300005616 Ga0068852_100000132 Ga0068852_10000013225 217
99 3300005718 Ga0068866_10000005 Ga0068866_10000005179 217
100 3300005834 Ga0068851_10002447 Ga0068851_100024479 217
101 3300005834 Ga0068851_10004966 Ga0068851_100049662 217
102 3300005841 Ga0068863_100000050 Ga0068863_100000050110 217
103 3300005842 Ga0068858_100000017 Ga0068858_10000001743 217
104 3300005937 Ga0081455_10001231 Ga0081455_100012316 217
105 3300005937 Ga0081455_10051128 Ga0081455_100511283 217
106 3300005983 Ga0081540_1000046 Ga0081540_1000046108 217
107 3300006028 Ga0070717_10000006 Ga0070717_1000000624 217
108 3300006048 Ga0075363_100408192 Ga0075363_1004081921 217
109 3300006175 Ga0070712_100000003 Ga0070712_100000003157 217
110 3300006852 Ga0075433_10020838 Ga0075433_100208382 217
111 3300006852 Ga0075433_10188661 Ga0075433_101886612 217
112 3300006871 Ga0075434_100077172 Ga0075434_1000771724 217
113 3300006881 Ga0068865_100000039 Ga0068865_10000003941 217
114 3300006881 Ga0068865_100540610 Ga0068865_1005406101 217
115 3300007076 Ga0075435_100039664 Ga0075435_1000396642 217
116 3300009093 Ga0105240_10108593 Ga0105240_101085932 217
117 3300009094 Ga0111539_10640010 Ga0111539_106400102 217
118 3300009098 Ga0105245_10000022 Ga0105245_1000002212 217
119 3300009098 Ga0105245_10001911 Ga0105245_100019119 217
120 3300009098 Ga0105245_10025648 Ga0105245_100256485 217
121 3300009098 Ga0105245_10683842 Ga0105245_106838422 217
122 3300009101 Ga0105247_10000832 Ga0105247_1000083220 217
123 3300009174 Ga0105241_10209044 Ga0105241_102090442 217
124 3300009176 Ga0105242_10003703 Ga0105242_100037039 217
125 3300009177 Ga0105248_10000017 Ga0105248_10000017143 217
126 3300009177 Ga0105248_10315184 Ga0105248_103151842 217
127 3300009551 Ga0105238_10000016 Ga0105238_10000016108 217
128 3300009553 Ga0105249_10000054 Ga0105249_1000005473 217
129 3300010375 Ga0105239_10067201 Ga0105239_100672013 217
130 3300013102 Ga0157371_10005762 Ga0157371_100057624 217
131 3300013104 Ga0157370_10018159 Ga0157370_100181592 217
132 3300013105 Ga0157369_10000803 Ga0157369_1000080331 217
133 3300013297 Ga0157378_10003220 Ga0157378_100032204 217
134 3300013297 Ga0157378_10052238 Ga0157378_100522382 217
135 3300013306 Ga0163162_10998599 Ga0163162_109985991 217
136 3300013307 Ga0157372_10000407 Ga0157372_1000040713 217
137 3300013307 Ga0157372_10463320 Ga0157372_104633202 217
138 3300013308 Ga0157375_10000194 Ga0157375_1000019412 217
139 3300013308 Ga0157375_10013139 Ga0157375_100131393 217
140 3300013308 Ga0157375_10258097 Ga0157375_102580972 217
141 3300014325 Ga0163163_10979274 Ga0163163_109792741 217
142 3300014968 Ga0157379_10037859 Ga0157379_100378591 217
143 3300025321 Ga0207656_10000620 Ga0207656_1000062012 217
144 3300025321 Ga0207656_10001698 Ga0207656_100016982 217
145 3300025893 Ga0207682_10000020 Ga0207682_1000002038 217
146 3300025899 Ga0207642_10000005 Ga0207642_10000005384 217
147 3300025900 Ga0207710_10000227 Ga0207710_1000022746 217
148 3300025911 Ga0207654_10025727 Ga0207654_100257272 217
149 3300025912 Ga0207707_10136672 Ga0207707_101366721 217
150 3300025913 Ga0207695_10081727 Ga0207695_100817272 217
151 3300025915 Ga0207693_10000009 Ga0207693_1000000965 217
152 3300025915 Ga0207693_10006350 Ga0207693_100063506 217
153 3300025916 Ga0207663_10263933 Ga0207663_102639332 217
154 3300025916 Ga0207663_10576573 Ga0207663_105765732 217
155 3300025920 Ga0207649_10000015 Ga0207649_10000015108 217
156 3300025921 Ga0207652_10000536 Ga0207652_100005367 217
157 3300025924 Ga0207694_10000012 Ga0207694_10000012313 217
158 3300025927 Ga0207687_10000025 Ga0207687_10000025177 217
159 3300025927 Ga0207687_10000065 Ga0207687_1000006566 217
160 3300025927 Ga0207687_10001642 Ga0207687_1000164212 217
161 3300025928 Ga0207700_10000019 Ga0207700_100000198 217
162 3300025929 Ga0207664_10000060 Ga0207664_1000006082 217
163 3300025929 Ga0207664_10008355 Ga0207664_100083556 217
164 3300025929 Ga0207664_10038748 Ga0207664_100387483 217
165 3300025929 Ga0207664_10042397 Ga0207664_100423974 217
166 3300025933 Ga0207706_10000003 Ga0207706_1000000374 217
167 3300025934 Ga0207686_10001801 Ga0207686_100018015 217
168 3300025934 Ga0207686_10058571 Ga0207686_100585712 217
169 3300025936 Ga0207670_10024168 Ga0207670_100241684 217
170 3300025937 Ga0207669_10000060 Ga0207669_1000006039 217
171 3300025938 Ga0207704_10000165 Ga0207704_1000016522 217
172 3300025941 Ga0207711_10000011 Ga0207711_10000011190 217
173 3300025944 Ga0207661_10009098 Ga0207661_100090983 217
174 3300025944 Ga0207661_10738496 Ga0207661_107384962 217
175 3300025949 Ga0207667_10662091 Ga0207667_106620912 217
176 3300025961 Ga0207712_10000032 Ga0207712_1000003292 217
177 3300025981 Ga0207640_10002975 Ga0207640_100029756 217
178 3300025981 Ga0207640_10012422 Ga0207640_100124225 217
179 3300025986 Ga0207658_10082253 Ga0207658_100822532 217
180 3300026023 Ga0207677_10000163 Ga0207677_1000016352 217
181 3300026035 Ga0207703_10000030 Ga0207703_1000003043 217
182 3300026078 Ga0207702_10000349 Ga0207702_1000034922 217
183 3300026078 Ga0207702_10068076 Ga0207702_100680763 217
184 3300026078 Ga0207702_10313114 Ga0207702_103131142 217
185 3300026088 Ga0207641_10004313 Ga0207641_1000431313 217
186 3300026116 Ga0207674_10092994 Ga0207674_100929943 217
187 3300026142 Ga0207698_10000014 Ga0207698_10000014210 217
188 3300028556 Ga0265337_1002089 Ga0265337_10020898 217
189 3300028558 Ga0265326_10000024 Ga0265326_1000002423 217
190 3300028558 Ga0265326_10000033 Ga0265326_100000335 217
191 3300028563 Ga0265319_1000037 Ga0265319_100003747 217
192 3300028573 Ga0265334_10000078 Ga0265334_1000007847 217
193 3300028653 Ga0265323_10168337 Ga0265323_101683371 217
194 3300028654 Ga0265322_10000017 Ga0265322_1000001743 217
195 3300028666 Ga0265336_10019377 Ga0265336_100193772 217
196 3300028800 Ga0265338_10000051 Ga0265338_10000051148 217
197 3300028800 Ga0265338_10018497 Ga0265338_100184973 217
198 3300029957 Ga0265324_10000479 Ga0265324_100004795 217
199 3300031238 Ga0265332_10028836 Ga0265332_100288362 217
200 3300031239 Ga0265328_10002684 Ga0265328_100026843 217
201 3300031240 Ga0265320_10000010 Ga0265320_100000105 217
202 3300031242 Ga0265329_10045987 Ga0265329_100459872 217
203 3300031250 Ga0265331_10000505 Ga0265331_1000050529 217
204 3300031251 Ga0265327_10000040 Ga0265327_10000040302 217
205 3300031344 Ga0265316_10031948 Ga0265316_100319483 217
206 3300031595 Ga0265313_10042670 Ga0265313_100426703 217
207 3300031711 Ga0265314_10000803 Ga0265314_1000080334 217
208 3300031712 Ga0265342_10079499 Ga0265342_100794992 217
209 3300032133 Ga0316583_10164854 Ga0316583_101648541 217
210 3300035117 Ga0373953_0170355 Ga0373953_0170355_74_757 217
211 3300035410 Ga0373924_0226122 Ga0373924_0226122_124_807 217
212 3300036401 Ga0373937_0047810 Ga0373937_0047810_682_1365 217
213 3300036647 Ga0316582_0416473 Ga0316582_0416473_214_873 217
214 3300039438 Ga0436360_0475298 Ga0436360_0475298_2863_3540 217
215 3300044694 Ga0466963_0000051 Ga0466963_0000051_7287_8030 217
216 3300044694 Ga0466963_0058658 Ga0466963_0058658_131_808 217
217 3300044694 Ga0466963_0140851 Ga0466963_0140851_374_1051 217
218 3300046454 Ga0495592_0366595 Ga0495592_0366595_96_785 217
219 3300046455 Ga0495603_0003294 Ga0495603_0003294_7407_8105 217
220 3300046455 Ga0495603_0017863 Ga0495603_0017863_3228_3899 217
221 3300046459 Ga0495629_0003154 Ga0495629_0003154_1483_2163 217
222 3300046459 Ga0495629_0022365 Ga0495629_0022365_2460_3131 217
223 3300046459 Ga0495629_0042208 Ga0495629_0042208_1713_2402 217
224 3300046461 Ga0495641_0018394 Ga0495641_0018394_2041_2721 217
225 3300046461 Ga0495641_0052780 Ga0495641_0052780_281_961 217
226 3300046462 Ga0495651_0561868 Ga0495651_0561868_12_689 217
227 3300046463 Ga0495653_0112075 Ga0495653_0112075_361_1038 217
228 3300046463 Ga0495653_0155047 Ga0495653_0155047_806_1483 217
229 3300046473 Ga0495582_0000002 Ga0495582_0000002_73246_73959 217
230 3300046476 Ga0495662_0019399 Ga0495662_0019399_2322_2999 217
231 3300046476 Ga0495662_0069045 Ga0495662_0069045_115_816 217
232 3300046499 Ga0495594_0000001 Ga0495594_0000001_183805_184458 217
233 3300046507 Ga0495606_0000886 Ga0495606_0000886_11471_12151 217
234 3300046511 Ga0495608_0000071 Ga0495608_0000071_14450_15127 217
235 3300046511 Ga0495608_0003011 Ga0495608_0003011_5555_6271 217
236 3300046514 Ga0495618_0000051 Ga0495618_0000051_41363_42040 217
237 3300046515 Ga0495620_0000154 Ga0495620_0000154_24861_25646 217
238 3300046516 Ga0495628_0032279 Ga0495628_0032279_1588_2265 217
239 3300046517 Ga0495630_0000027 Ga0495630_0000027_111157_111837 217
240 3300046517 Ga0495630_0000125 Ga0495630_0000125_27502_28185 217
241 3300046529 Ga0495652_0000009 Ga0495652_0000009_70990_71670 217
242 3300046529 Ga0495652_0136895 Ga0495652_0136895_440_1192 217
243 3300046535 Ga0495586_0008656 Ga0495586_0008656_3572_4288 217
244 3300046536 Ga0495587_0001679 Ga0495587_0001679_6770_7471 217
245 3300046543 Ga0495645_0005720 Ga0495645_0005720_29_712 217
246 3300046543 Ga0495645_0029900 Ga0495645_0029900_1500_2252 217
247 3300046557 Ga0495622_0000033 Ga0495622_0000033_95947_96600 217
248 3300046559 Ga0495667_0082351 Ga0495667_0082351_561_1277 217
249 3300046642 Ga0495634_0000728 Ga0495634_0000728_19638_20354 217
250 3300046642 Ga0495634_0001282 Ga0495634_0001282_17818_18555 217
251 3300046642 Ga0495634_0010090 Ga0495634_0010090_841_1512 217
252 3300046663 Ga0495635_0000017 Ga0495635_0000017_68490_69167 217
253 3300046675 Ga0495657_0000096 Ga0495657_0000096_14507_15184 217
254 3300046675 Ga0495657_0017703 Ga0495657_0017703_602_1285 217
255 3300046678 Ga0495599_0102178 Ga0495599_0102178_277_960 217
256 3300046681 Ga0495647_0000707 Ga0495647_0000707_1568_2248 217
257 3300046683 Ga0495658_0000001 Ga0495658_0000001_318309_319022 217
258 3300046683 Ga0495658_0016565 Ga0495658_0016565_720_1391 217
259 3300046684 Ga0495669_0000067 Ga0495669_0000067_25883_26680 217
260 3300046689 Ga0495613_0000067 Ga0495613_0000067_59974_60651 217
261 3300046689 Ga0495613_0000155 Ga0495613_0000155_19264_19944 217
262 3300046689 Ga0495613_0040081 Ga0495613_0040081_2713_3384 217
263 3300046690 Ga0495624_0000200 Ga0495624_0000200_27844_28524 217
264 3300046690 Ga0495624_0353748 Ga0495624_0353748_17_700 217
265 3300046809 Ga0495600_0001022 Ga0495600_0001022_1120_1797 217
266 3300046809 Ga0495600_0132196 Ga0495600_0132196_159_842 217
267 3300047317 Ga0495604_0000252 Ga0495604_0000252_26211_26888 217
268 3300047317 Ga0495604_0004840 Ga0495604_0004840_4077_4757 217
269 3300047320 Ga0495672_0116586 Ga0495672_0116586_473_1198 217
270 3300047321 Ga0495676_0001522 Ga0495676_0001522_8742_9470 217
271 3300047321 Ga0495676_0014385 Ga0495676_0014385_677_1348 217
272 3300047322 Ga0495680_0009313 Ga0495680_0009313_4374_5066 217
273 3300047322 Ga0495680_0268229 Ga0495680_0268229_47_730 217
274 3300047444 Ga0495675_0000036 Ga0495675_0000036_49893_50570 217
275 3300047446 Ga0495679_032643 Ga0495679_032643_626_1303 217
276 3300047471 Ga0495684_0328312 Ga0495684_0328312_375_1058 217
277 3300047673 Ga0495593_0151117 Ga0495593_0151117_11_685 217
278 3300048088 Ga0495602_0000548 Ga0495602_0000548_9076_9756 217
279 3300048088 Ga0495602_0045718 Ga0495602_0045718_40_717 217
280 3300048903 Ga0496100_0000006 Ga0496100_0000006_139171_139968 217
281 3300048904 Ga0496101_0000009 Ga0496101_0000009_139171_139968 217
282 3300048905 Ga0496102_0829426 Ga0496102_0829426_36_713 217
283 3300048907 Ga0496104_0000029 Ga0496104_0000029_36849_37526 217
284 3300048907 Ga0496104_0002134 Ga0496104_0002134_1868_2545 217
285 3300048908 Ga0496105_0000002 Ga0496105_0000002_36849_37526 217
286 3300048908 Ga0496105_0001818 Ga0496105_0001818_12305_12982 217
287 3300048909 Ga0496106_0000072 Ga0496106_0000072_61562_62359 217
288 3300048909 Ga0496106_0001291 Ga0496106_0001291_3851_4528 217
289 3300048909 Ga0496106_0298775 Ga0496106_0298775_213_905 217
290 3300048910 Ga0496107_0000015 Ga0496107_0000015_35399_36196 217
291 3300048910 Ga0496107_0025573 Ga0496107_0025573_165_857 217
292 3300048911 Ga0496108_0000004 Ga0496108_0000004_242429_243154 217
293 3300048911 Ga0496108_0000239 Ga0496108_0000239_3474_4148 217
294 3300048911 Ga0496108_0000904 Ga0496108_0000904_22295_23092 217
295 3300048911 Ga0496108_0016161 Ga0496108_0016161_584_1264 217
296 3300048911 Ga0496108_0589093 Ga0496108_0589093_18_731 217
297 3300048912 Ga0496109_0000011 Ga0496109_0000011_148255_148935 217
298 3300048912 Ga0496109_0000031 Ga0496109_0000031_88642_89367 217
299 3300048912 Ga0496109_0000304 Ga0496109_0000304_32493_33167 217
300 3300048912 Ga0496109_0000369 Ga0496109_0000369_19208_20005 217
301 3300048912 Ga0496109_0009459 Ga0496109_0009459_7517_8230 217
302 3300048913 Ga0496110_0000171 Ga0496110_0000171_32920_33603 217
303 3300048913 Ga0496110_0244054 Ga0496110_0244054_718_1398 217
304 3300048914 Ga0496111_0000020 Ga0496111_0000020_6380_7063 217
305 3300048915 Ga0496112_0000641 Ga0496112_0000641_2609_3286 217
306 3300048915 Ga0496112_0083023 Ga0496112_0083023_2291_3028 217
307 3300048916 Ga0496113_0000002 Ga0496113_0000002_208496_209173 217
308 3300048916 Ga0496113_0406397 Ga0496113_0406397_215_925 217
309 3300048917 Ga0496114_0000003 Ga0496114_0000003_297185_297862 217
310 3300048917 Ga0496114_0112217 Ga0496114_0112217_723_1403 217
311 3300048918 Ga0496115_0000022 Ga0496115_0000022_22033_22710 217
312 3300048918 Ga0496115_0000027 Ga0496115_0000027_23471_24148 217
313 3300048918 Ga0496115_0044379 Ga0496115_0044379_2125_2802 217
314 3300048919 Ga0496116_0000138 Ga0496116_0000138_1538_2236 217
315 3300048920 Ga0496117_0002585 Ga0496117_0002585_577_1293 217
316 3300048921 Ga0496118_0001672 Ga0496118_0001672_12632_13348 217
317 3300048921 Ga0496118_0261894 Ga0496118_0261894_244_942 217
318 3300048922 Ga0496119_0004068 Ga0496119_0004068_1623_2321 217
319 3300048922 Ga0496119_0007922 Ga0496119_0007922_1782_2459 217
320 3300048923 Ga0496120_0001397 Ga0496120_0001397_25259_25975 217
321 3300048929 Ga0496126_0046969 Ga0496126_0046969_37_708 217
322 3300048929 Ga0496126_0094459 Ga0496126_0094459_943_1602 217
323 3300049581 Ga0501047_0138259 Ga0501047_0138259_1273_1950 217
324 3300049586 Ga0501070_0005207 Ga0501070_0005207_4750_5445 217
325 3300049744 Ga0501083_0022284 Ga0501083_0022284_1620_2297 217
326 3300050507 nmdc:mga05p37_472487_c1 nmdc:mga05p37_472487_c1_44_736 217
327 3300050512 nmdc:mga0n895_247189_c1 nmdc:mga0n895_247189_c1_913_1602 217
328 3300050512 nmdc:mga0n895_397584_c1 nmdc:mga0n895_397584_c1_64_756 217
329 3300050513 nmdc:mga0rr50_45221_c1 nmdc:mga0rr50_45221_c1_1545_2237 217
330 3300050514 nmdc:mga08x19_493569_c1 nmdc:mga08x19_493569_c1_108_821 217
331 3300050515 nmdc:mga0a205_560075_c1 nmdc:mga0a205_560075_c1_245_937 217
332 3300050515 nmdc:mga0a205_9195_c1 nmdc:mga0a205_9195_c1_4702_5418 217
333 3300053077 Ga0495601_0000019 Ga0495601_0000019_19345_20025 217
334 3300053077 Ga0495601_0011249 Ga0495601_0011249_3559_4242 217
335 3300053077 Ga0495601_0016446 Ga0495601_0016446_3778_4455 217
336 3300053077 Ga0495601_0068018 Ga0495601_0068018_943_1632 217
337 3300053077 Ga0495601_0266869 Ga0495601_0266869_333_1016 217
338 3300053078 Ga0495612_0010522 Ga0495612_0010522_1908_2588 217
339 3300053078 Ga0495612_0038164 Ga0495612_0038164_856_1539 217
340 3300053078 Ga0495612_0046990 Ga0495612_0046990_798_1481 217
341 3300053078 Ga0495612_0151123 Ga0495612_0151123_58_747 217
342 3300053084 Ga0495595_0000009 Ga0495595_0000009_62056_62733 217
343 3300053084 Ga0495595_0163261 Ga0495595_0163261_147_836 217
344 3300053085 Ga0495619_0000001 Ga0495619_0000001_226570_227286 217
345 3300053085 Ga0495619_0000022 Ga0495619_0000022_62748_63431 217
346 3300053085 Ga0495619_0000124 Ga0495619_0000124_41289_41966 217
347 3300053085 Ga0495619_0000177 Ga0495619_0000177_44684_45376 217
348 3300053085 Ga0495619_0000649 Ga0495619_0000649_20447_21121 217
349 3300053085 Ga0495619_0002165 Ga0495619_0002165_10388_11071 217
350 3300053085 Ga0495619_0007570 Ga0495619_0007570_3770_4453 217
351 3300053085 Ga0495619_0169723 Ga0495619_0169723_732_1415 217
352 3300053085 Ga0495619_0208904 Ga0495619_0208904_545_1219 217

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z09-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.802 1 124
2z09-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.7843 1 124
2z08-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.7842 1 115
3qtb-assembly1.cif.gz_A structure of the universal stress protein from archaeoglobus fulgidus in complex with damp 0.7819 3 95
3fh0-assembly1.cif.gz_A crystal structure of putative universal stress protein kpn_01444 - atpase 0.7815 1 115
ID Description Score Start End Superfamily
af_A0A1D6IXZ9_18_150_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8043 1 99 3.40.50.620
2z09A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.802 1 124 3.40.50.620
af_Q54L57_1_123_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7852 3 124 3.40.50.620
2z09A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7843 1 124 3.40.50.620
af_A0A1P8AST2_6_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7832 1 101 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A538C5W7-F1-model_v4 UspA domain-containing protein 0.9606 1 217
AF-A0A2W6BTD6-F1-model_v4 UspA domain-containing protein 0.9604 1 217
AF-A0A538KMW8-F1-model_v4 UspA domain-containing protein 0.9577 1 217
AF-A0A538C5W7-F1-model_v4 UspA domain-containing protein 0.9563 1 217
AF-A0A2W6BTD6-F1-model_v4 UspA domain-containing protein 0.9561 1 217

Feature Viewer

pLDDT pTM Quality
95.17 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map