F419144

General Info

Members Datasets Scaffolds Average Seq Length
352 183 352 266

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0043584|Ga0495659_0043584_246_1187
Length 313
Sequence MLLLMPASSWAQSGITGIVRDARRATVMTRHIRIEVDSGTARGSTMKRMMAAIAVTVAMLTTLAVAQNLPWNNPGGGQGQAAAPSGPPGPAPTRDISGLWDAGGGGIGARGMQTAPLTPWGEMMGKTHHSGDGARMVPADQINDPLSTLADPGGFPRNLLFELRPFEVVQMPNKMLIVYMFEKRWRVIWTDGRQLPTNPDPRWYGYSVGHWEDDYTFVVNSNGTDERTWLDNAGNPHSDQLKVEERYHRVDRNTMELTVVIDDAKAYTRSWVGRDKLRLTLLPANTDLMEMIPSASEAAAVKSIYAAEAAGKK

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.56
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11636092 3300004798 Bacteria 1431
2 Ga0065707_10001687 3300005295 Bacteria 7616
3 Ga0070690_100168282 3300005330 Bacteria 1507
4 Ga0070690_100310249 3300005330 Unclassified 1134
5 Ga0070670_100035611 3300005331 Unclassified 4285
6 Ga0070670_100753741 3300005331 Unclassified 877
7 Ga0068869_100057291 3300005334 Bacteria 2844
8 Ga0068869_100114098 3300005334 Unclassified 2059
9 Ga0070666_10031567 3300005335 Bacteria 3497
10 Ga0070666_10125837 3300005335 Unclassified 1779
11 Ga0070680_100067623 3300005336 Unclassified 2931
12 Ga0070680_100417301 3300005336 Bacteria 1145
13 Ga0068868_100150216 3300005338 Unclassified 1918
14 Ga0070689_100000911 3300005340 Bacteria 18450
15 Ga0070689_100028152 3300005340 Bacteria 4245
16 Ga0070689_100064730 3300005340 Unclassified 2847
17 Ga0070689_100362598 3300005340 Unclassified 1218
18 Ga0070691_10083290 3300005341 Archaea 1569
19 Ga0070687_100042844 3300005343 Bacteria 2296
20 Ga0070692_10018307 3300005345 Bacteria 3366
21 Ga0070692_10046679 3300005345 Unclassified 2240
22 Ga0070668_100018635 3300005347 Bacteria 5212
23 Ga0070669_100001572 3300005353 Bacteria 16555
24 Ga0070675_100008111 3300005354 Bacteria 8143
25 Ga0070675_100016517 3300005354 Bacteria 5861
26 Ga0070675_100061334 3300005354 Unclassified 3105
27 Ga0070671_100011036 3300005355 Bacteria 7250
28 Ga0070671_100345260 3300005355 Unclassified 1270
29 Ga0070674_100151470 3300005356 Bacteria 1751
30 Ga0070673_100278188 3300005364 Bacteria 1467
31 Ga0070688_100011473 3300005365 Bacteria 4924
32 Ga0070688_100017463 3300005365 Unclassified 4118
33 Ga0070688_100089896 3300005365 Bacteria 2005
34 Ga0070709_10012961 3300005434 Bacteria 4676
35 Ga0070713_100017296 3300005436 Bacteria 5449
36 Ga0070701_10054130 3300005438 Unclassified 2092
37 Ga0070701_10065310 3300005438 Bacteria 1931
38 Ga0070701_10124272 3300005438 Unclassified 1458
39 Ga0070701_10168369 3300005438 Bacteria 1274
40 Ga0070711_100308814 3300005439 Bacteria 1260
41 Ga0070705_100000401 3300005440 Bacteria 25010
42 Ga0070705_100026915 3300005440 Bacteria 3134
43 Ga0070705_100118719 3300005440 Unclassified 1704
44 Ga0070700_100074744 3300005441 Unclassified 2172
45 Ga0070700_100340041 3300005441 Bacteria 1109
46 Ga0070700_100513082 3300005441 Bacteria 924
47 Ga0070694_100001431 3300005444 Bacteria 13985
48 Ga0070694_100016370 3300005444 Bacteria 4666
49 Ga0070694_100323492 3300005444 Bacteria 1187
50 Ga0070708_100229157 3300005445 Unclassified 1743
51 Ga0070708_100309881 3300005445 Bacteria 1487
52 Ga0070678_100311859 3300005456 Unclassified 1341
53 Ga0070662_100182068 3300005457 Bacteria 1657
54 Ga0070662_100254856 3300005457 Unclassified 1412
55 Ga0070681_10008760 3300005458 Bacteria 9929
56 Ga0068867_100112459 3300005459 Unclassified 2094
57 Ga0070706_100045183 3300005467 Bacteria 4069
58 Ga0070706_100163619 3300005467 Unclassified 2078
59 Ga0070706_100334141 3300005467 Unclassified 1413
60 Ga0070707_100062318 3300005468 Unclassified 3578
61 Ga0070698_100019867 3300005471 Bacteria 7047
62 Ga0070698_100170866 3300005471 Unclassified 2115
63 Ga0070699_100007592 3300005518 Bacteria 9428
64 Ga0070699_100042672 3300005518 Bacteria 3925
65 Ga0070679_100319438 3300005530 Bacteria 1502
66 Ga0070684_100132062 3300005535 Bacteria 2253
67 Ga0070697_100444869 3300005536 Bacteria 1128
68 Ga0070672_100010223 3300005543 Bacteria 6500
69 Ga0070672_100081281 3300005543 Unclassified 2598
70 Ga0070672_100098191 3300005543 Unclassified 2372
71 Ga0070672_100156645 3300005543 Bacteria 1887
72 Ga0070686_100153457 3300005544 Bacteria 1615
73 Ga0070695_100005835 3300005545 Bacteria 7262
74 Ga0070695_100042257 3300005545 Unclassified 2893
75 Ga0070695_100065079 3300005545 Bacteria 2373
76 Ga0070696_100016928 3300005546 Bacteria 4917
77 Ga0070696_100041750 3300005546 Bacteria 3169
78 Ga0070696_100209893 3300005546 Bacteria 1457
79 Ga0070696_100420167 3300005546 Bacteria 1049
80 Ga0070665_100005462 3300005548 Bacteria 13103
81 Ga0070704_100000141 3300005549 Bacteria 27191
82 Ga0070704_100022170 3300005549 Bacteria 4129
83 Ga0070704_100332394 3300005549 Bacteria 1277
84 Ga0070704_100623253 3300005549 Bacteria 950
85 Ga0070664_100259686 3300005564 Bacteria 1563
86 Ga0070664_100265363 3300005564 Unclassified 1545
87 Ga0068857_100038929 3300005577 Bacteria 4210
88 Ga0068857_100378150 3300005577 Bacteria 1315
89 Ga0070702_100006682 3300005615 Bacteria 5479
90 Ga0068859_100025622 3300005617 Bacteria 5916
91 Ga0068859_100049301 3300005617 Unclassified 4229
92 Ga0068859_100096125 3300005617 Unclassified 3015
93 Ga0068859_100224307 3300005617 Unclassified 1967
94 Ga0068859_100425234 3300005617 Unclassified 1425
95 Ga0068864_100100242 3300005618 Bacteria 2567
96 Ga0068864_100177658 3300005618 Bacteria 1944
97 Ga0068861_100001612 3300005719 Bacteria 14373
98 Ga0068870_10000883 3300005840 Bacteria 11715
99 Ga0068858_100010481 3300005842 Bacteria 8781
100 Ga0068858_100016310 3300005842 Bacteria 6979
101 Ga0068858_100036363 3300005842 Bacteria 4566
102 Ga0068858_100171961 3300005842 Bacteria 2043
103 Ga0068860_100041226 3300005843 Unclassified 4410
104 Ga0068860_100137268 3300005843 Unclassified 2349
105 Ga0068860_100206552 3300005843 Unclassified 1905
106 Ga0068862_100000793 3300005844 Bacteria 31302
107 Ga0068862_100277897 3300005844 Bacteria 1534
108 Ga0081455_10082630 3300005937 Unclassified 2627
109 Ga0070717_10046021 3300006028 Bacteria 3569
110 Ga0070715_10108650 3300006163 Bacteria 1305
111 Ga0070716_100177854 3300006173 Unclassified 1394
112 Ga0097621_100072902 3300006237 Unclassified 2841
113 Ga0097621_100086201 3300006237 Unclassified 2620
114 Ga0097621_100300385 3300006237 Bacteria 1418
115 Ga0097621_100614671 3300006237 Bacteria 994
116 Ga0068871_100011829 3300006358 Bacteria 6415
117 Ga0068871_100023847 3300006358 Unclassified 4739
118 Ga0068871_100058172 3300006358 Bacteria 3147
119 Ga0075428_100009105 3300006844 Bacteria 11017
120 Ga0075428_100212064 3300006844 Unclassified 2093
121 Ga0075428_100214021 3300006844 Bacteria 2082
122 Ga0075428_100231174 3300006844 Unclassified 1995
123 Ga0075433_10023077 3300006852 Bacteria 5233
124 Ga0075433_10095005 3300006852 Unclassified 2638
125 Ga0075433_10107423 3300006852 Bacteria 2474
126 Ga0075433_10488220 3300006852 Unclassified 1085
127 Ga0075434_100001407 3300006871 Bacteria 20216
128 Ga0075434_100011654 3300006871 Bacteria 8303
129 Ga0075434_100023694 3300006871 Bacteria 5987
130 Ga0075434_100096561 3300006871 Unclassified 2960
131 Ga0075434_100716403 3300006871 Bacteria 1018
132 Ga0075429_100363312 3300006880 Bacteria 1267
133 Ga0068865_100098615 3300006881 Bacteria 2135
134 Ga0068865_100260856 3300006881 Unclassified 1372
135 Ga0075436_100353176 3300006914 Bacteria 1060
136 Ga0097620_100025620 3300006931 Bacteria 5916
137 Ga0097620_100049300 3300006931 Unclassified 4229
138 Ga0097620_100096138 3300006931 Unclassified 3015
139 Ga0097620_100224320 3300006931 Unclassified 1967
140 Ga0097620_100425235 3300006931 Unclassified 1425
141 Ga0075435_100016609 3300007076 Bacteria 5551
142 Ga0075435_100044764 3300007076 Unclassified 3545
143 Ga0075435_100066551 3300007076 Bacteria 2932
144 Ga0075435_100076084 3300007076 Unclassified 2750
145 Ga0111539_10020131 3300009094 Bacteria 8221
146 Ga0111539_10555063 3300009094 Unclassified 1338
147 Ga0105245_10042900 3300009098 Bacteria 4035
148 Ga0105245_10228470 3300009098 Unclassified 1799
149 Ga0105247_10010889 3300009101 Bacteria 5494
150 Ga0105247_10121705 3300009101 Bacteria 1691
151 Ga0105247_10127174 3300009101 Bacteria 1657
152 Ga0114129_10002771 3300009147 Bacteria 24412
153 Ga0114129_10063553 3300009147 Bacteria 5154
154 Ga0114129_10313311 3300009147 Bacteria 2088
155 Ga0114129_10557499 3300009147 Bacteria 1489
156 Ga0105243_10251286 3300009148 Bacteria 1579
157 Ga0105243_10252534 3300009148 Unclassified 1575
158 Ga0105242_10046386 3300009176 Bacteria 3525
159 Ga0105242_10305617 3300009176 Unclassified 1453
160 Ga0105248_10777455 3300009177 Bacteria 1081
161 Ga0105249_10005533 3300009553 Bacteria 10916
162 Ga0105249_10016411 3300009553 Bacteria 6570
163 Ga0105239_10453522 3300010375 Unclassified 1455
164 Ga0105246_10129235 3300011119 Bacteria 1884
165 Ga0157374_10616693 3300013296 Unclassified 1095
166 Ga0157378_10254589 3300013297 Unclassified 1682
167 Ga0157378_10639101 3300013297 Unclassified 1079
168 Ga0163162_10036273 3300013306 Unclassified 4912
169 Ga0163162_10038637 3300013306 Bacteria 4763
170 Ga0157375_10043010 3300013308 Unclassified 4378
171 Ga0157375_10164658 3300013308 Unclassified 2362
172 Ga0157375_10176513 3300013308 Bacteria 2286
173 Ga0157375_10404029 3300013308 Unclassified 1532
174 Ga0163163_10226208 3300014325 Bacteria 1920
175 Ga0163163_10329599 3300014325 Bacteria 1581
176 Ga0157380_10064918 3300014326 Bacteria 2932
177 Ga0157380_10080860 3300014326 Unclassified 2656
178 Ga0157380_10230602 3300014326 Bacteria 1663
179 Ga0157377_10014466 3300014745 Bacteria 4016
180 Ga0157377_10038489 3300014745 Unclassified 2641
181 Ga0157377_10233565 3300014745 Bacteria 1184
182 Ga0157379_10044843 3300014968 Bacteria 3947
183 Ga0157379_10147297 3300014968 Bacteria 2123
184 Ga0157379_10299751 3300014968 Unclassified 1465
185 Ga0157379_10317548 3300014968 Unclassified 1422
186 Ga0157376_10014304 3300014969 Bacteria 5951
187 Ga0157376_10207008 3300014969 Bacteria 1809
188 Ga0157376_10450623 3300014969 Unclassified 1255
189 Ga0163161_10123958 3300017792 Unclassified 1944
190 Ga0207710_10111731 3300025900 Bacteria 1298
191 Ga0207680_10046425 3300025903 Bacteria 2568
192 Ga0207699_10381508 3300025906 Unclassified 1000
193 Ga0207643_10001498 3300025908 Bacteria 13376
194 Ga0207684_10476959 3300025910 Bacteria 1070
195 Ga0207707_10080618 3300025912 Bacteria 2842
196 Ga0207660_10033842 3300025917 Unclassified 3538
197 Ga0207660_10047331 3300025917 Unclassified 3040
198 Ga0207660_10340198 3300025917 Unclassified 1201
199 Ga0207662_10023467 3300025918 Bacteria 3544
200 Ga0207662_10055674 3300025918 Unclassified 2360
201 Ga0207662_10080835 3300025918 Bacteria 1983
202 Ga0207652_10358791 3300025921 Bacteria 1316
203 Ga0207646_10068063 3300025922 Unclassified 3180
204 Ga0207646_10155953 3300025922 Bacteria 2059
205 Ga0207646_10310795 3300025922 Bacteria 1424
206 Ga0207646_10314868 3300025922 Bacteria 1414
207 Ga0207646_10572276 3300025922 Bacteria 1015
208 Ga0207681_10000184 3300025923 Bacteria 50507
209 Ga0207650_10145429 3300025925 Unclassified 1867
210 Ga0207650_10291129 3300025925 Unclassified 1332
211 Ga0207659_10403051 3300025926 Bacteria 1144
212 Ga0207687_10006034 3300025927 Bacteria 8016
213 Ga0207644_10121632 3300025931 Unclassified 1988
214 Ga0207706_10029585 3300025933 Unclassified 4888
215 Ga0207706_10248175 3300025933 Unclassified 1555
216 Ga0207686_10039322 3300025934 Unclassified 2870
217 Ga0207686_10086725 3300025934 Bacteria 2057
218 Ga0207709_10150092 3300025935 Unclassified 1613
219 Ga0207709_10318895 3300025935 Unclassified 1162
220 Ga0207670_10033824 3300025936 Bacteria 3297
221 Ga0207670_10051452 3300025936 Unclassified 2766
222 Ga0207670_10226929 3300025936 Unclassified 1432
223 Ga0207669_10231388 3300025937 Bacteria 1364
224 Ga0207669_10323696 3300025937 Unclassified 1181
225 Ga0207704_10019069 3300025938 Bacteria 3595
226 Ga0207704_10068456 3300025938 Bacteria 2238
227 Ga0207665_10225078 3300025939 Unclassified 1376
228 Ga0207691_10014750 3300025940 Bacteria 7448
229 Ga0207691_10080884 3300025940 Unclassified 2921
230 Ga0207691_10089305 3300025940 Bacteria 2764
231 Ga0207691_10115395 3300025940 Unclassified 2385
232 Ga0207711_10519450 3300025941 Bacteria 1110
233 Ga0207689_10061369 3300025942 Bacteria 3091
234 Ga0207689_10648551 3300025942 Unclassified 889
235 Ga0207679_10160925 3300025945 Bacteria 1838
236 Ga0207712_10065481 3300025961 Unclassified 2594
237 Ga0207668_10016572 3300025972 Bacteria 4601
238 Ga0207658_10414118 3300025986 Unclassified 1187
239 Ga0207677_10170561 3300026023 Unclassified 1701
240 Ga0207677_10416429 3300026023 Bacteria 1143
241 Ga0207703_10029890 3300026035 Bacteria 4302
242 Ga0207703_10081395 3300026035 Bacteria 2699
243 Ga0207708_10019505 3300026075 Bacteria 5113
244 Ga0207708_10287852 3300026075 Unclassified 1333
245 Ga0207648_10002611 3300026089 Bacteria 19311
246 Ga0207648_10055234 3300026089 Bacteria 3467
247 Ga0207648_10258360 3300026089 Bacteria 1554
248 Ga0207648_10478196 3300026089 Unclassified 1137
249 Ga0207676_10033043 3300026095 Bacteria 3906
250 Ga0207676_10067142 3300026095 Bacteria 2864
251 Ga0207674_10010264 3300026116 Bacteria 10626
252 Ga0207675_100002432 3300026118 Bacteria 18448
253 Ga0207675_100044139 3300026118 Bacteria 4164
254 Ga0207683_10141365 3300026121 Bacteria 2169
255 Ga0207683_10214928 3300026121 Bacteria 1751
256 Ga0207428_10001435 3300027907 Bacteria 25041
257 Ga0268266_10069858 3300028379 Bacteria 3044
258 Ga0268266_10531940 3300028379 Bacteria 1125
259 Ga0268265_10000188 3300028380 Bacteria 73548
260 Ga0268264_10014019 3300028381 Bacteria 6591
261 Ga0373944_0021371 3300035089 Bacteria 1873
262 Ga0373939_0144635 3300035114 Unclassified 860
263 Ga0373945_0044971 3300035116 Unclassified 1607
264 Ga0373954_0070222 3300035118 Unclassified 1664
265 Ga0373957_0078047 3300035120 Unclassified 1304
266 Ga0373960_0013230 3300035121 Bacteria 2066
267 Ga0373943_0029160 3300035170 Unclassified 2606
268 Ga0373924_0009742 3300035410 Unclassified 3528
269 Ga0373931_0322530 3300035691 Unclassified 960
270 Ga0373947_0421434 3300035725 Unclassified 902
271 Ga0373937_0671411 3300036401 Bacteria 982
272 Ga0373925_0011118 3300037068 Bacteria 6528
273 Ga0451577_0123565 3300042876 Bacteria 2319
274 Ga0451576_0008541 3300045051 Bacteria 12008
275 Ga0451576_0073056 3300045051 Unclassified 3569
276 Ga0451576_0086635 3300045051 Unclassified 3257
277 Ga0451576_0147918 3300045051 Bacteria 2449
278 Ga0451576_0197445 3300045051 Bacteria 2102
279 Ga0495603_0034919 3300046455 Bacteria 3022
280 Ga0495603_0073533 3300046455 Unclassified 2008
281 Ga0495629_0029160 3300046459 Bacteria 3916
282 Ga0495584_0068227 3300046491 Bacteria 1786
283 Ga0495584_0167924 3300046491 Unclassified 1115
284 Ga0495594_0004088 3300046499 Bacteria 7501
285 Ga0495628_0048796 3300046516 Unclassified 3354
286 Ga0495630_0097693 3300046517 Unclassified 2221
287 Ga0495644_0083067 3300046523 Bacteria 1208
288 Ga0495663_0006982 3300046525 Unclassified 3114
289 Ga0495663_0076719 3300046525 Bacteria 1071
290 Ga0495652_0039424 3300046529 Unclassified 4085
291 Ga0495665_0127435 3300046531 Unclassified 1333
292 Ga0495609_0036064 3300046538 Bacteria 2235
293 Ga0495621_0004411 3300046539 Bacteria 3954
294 Ga0495621_0042246 3300046539 Bacteria 1604
295 Ga0495621_0076881 3300046539 Bacteria 1239
296 Ga0495621_0111601 3300046539 Bacteria 1049
297 Ga0495645_0051985 3300046543 Unclassified 2981
298 Ga0495633_0122634 3300046558 Unclassified 1204
299 Ga0495667_0025717 3300046559 Unclassified 3965
300 Ga0495659_0001404 3300046664 Bacteria 8201
301 Ga0495659_0008764 3300046664 Unclassified 3219
302 Ga0495659_0011174 3300046664 Unclassified 2893
303 Ga0495659_0015135 3300046664 Bacteria 2534
304 Ga0495659_0015192 3300046664 Unclassified 2529
305 Ga0495659_0028868 3300046664 Bacteria 1922
306 Ga0495659_0043584 3300046664 Unclassified 1610
307 Ga0495659_0070621 3300046664 Bacteria 1307
308 Ga0495659_0099965 3300046664 Unclassified 1122
309 Ga0495659_0147935 3300046664 Unclassified 941
310 Ga0495588_0114745 3300046674 Unclassified 1419
311 Ga0495658_0042609 3300046683 Unclassified 2535
312 Ga0495658_0199825 3300046683 Unclassified 1246
313 Ga0495669_0012920 3300046684 Unclassified 3556
314 Ga0495613_0002397 3300046689 Bacteria 14191
315 Ga0495636_0008735 3300047318 Bacteria 3993
316 Ga0495676_0122926 3300047321 Unclassified 1885
317 Ga0495675_0082135 3300047444 Bacteria 2029
318 Ga0495685_052420 3300047447 Bacteria 1382
319 Ga0495684_0000117 3300047471 Bacteria 57879
320 Ga0496100_0001556 3300048903 Bacteria 11280
321 Ga0496101_0000139 3300048904 Bacteria 63989
322 Ga0496102_0144376 3300048905 Unclassified 2233
323 Ga0496104_0032711 3300048907 Bacteria 4841
324 Ga0496105_0037486 3300048908 Unclassified 3992
325 Ga0496106_0189139 3300048909 Unclassified 1636
326 Ga0496110_0520818 3300048913 Bacteria 1082
327 Ga0496114_0000577 3300048917 Bacteria 27102
328 Ga0496114_0220676 3300048917 Unclassified 1664
329 nmdc:mga05p37_22946_c1 3300050507 Bacteria 5693
330 nmdc:mga05p37_382458_c1 3300050507 Bacteria 1649
331 nmdc:mga05p37_477061_c1 3300050507 Bacteria 1438
332 nmdc:mga05p37_53448_c1 3300050507 Bacteria 4967
333 nmdc:mga05p37_90802_c1 3300050507 Unclassified 3764
334 nmdc:mga0qj67_149535_c1 3300050509 Unclassified 1894
335 nmdc:mga08y16_703750_c1 3300050511 Unclassified 1010
336 nmdc:mga08y16_724942_c1 3300050511 Unclassified 992
337 nmdc:mga08y16_92247_c1 3300050511 Bacteria 3156
338 nmdc:mga08y16_991_c1 3300050511 Bacteria 27687
339 nmdc:mga0n895_133673_c1 3300050512 Bacteria 2507
340 nmdc:mga0n895_45868_c1 3300050512 Bacteria 4267
341 nmdc:mga0n895_6313_c1 3300050512 Bacteria 10051
342 nmdc:mga0n895_7790_c1 3300050512 Bacteria 9229
343 nmdc:mga0rr50_359200_c1 3300050513 Unclassified 1226
344 nmdc:mga0rr50_370320_c1 3300050513 Bacteria 1207
345 nmdc:mga0rr50_3761_c1 3300050513 Bacteria 5216
346 nmdc:mga0rr50_42204_c1 3300050513 Unclassified 3329
347 nmdc:mga0a205_225722_c1 3300050515 Bacteria 1758
348 nmdc:mga0a205_263039_c1 3300050515 Bacteria 1603
349 nmdc:mga0a205_4881_c1 3300050515 Bacteria 12065
350 nmdc:mga0a205_540563_c1 3300050515 Unclassified 1021
351 Ga0495619_0000356 3300053085 Bacteria 31805
352 Ga0495619_0055534 3300053085 Bacteria 2623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025906 Ga0207699_10381508 Ga0207699_103815081 197
2 3300006173 Ga0070716_100177854 Ga0070716_1001778542 246
3 3300025939 Ga0207665_10225078 Ga0207665_102250781 246
4 3300013296 Ga0157374_10616693 Ga0157374_106166931 248
5 3300046491 Ga0495584_0068227 Ga0495584_0068227_100_855 250
6 3300046664 Ga0495659_0070621 Ga0495659_0070621_529_1284 250
7 3300050511 nmdc:mga08y16_703750_c1 nmdc:mga08y16_703750_c1_75_872 252
8 3300005445 Ga0070708_100229157 Ga0070708_1002291572 254
9 3300006844 Ga0075428_100009105 Ga0075428_1000091054 254
10 3300006844 Ga0075428_100212064 Ga0075428_1002120643 254
11 3300006852 Ga0075433_10023077 Ga0075433_100230773 254
12 3300006871 Ga0075434_100023694 Ga0075434_1000236944 254
13 3300006880 Ga0075429_100363312 Ga0075429_1003633122 254
14 3300007076 Ga0075435_100016609 Ga0075435_1000166093 254
15 3300009098 Ga0105245_10042900 Ga0105245_100429003 254
16 3300009101 Ga0105247_10121705 Ga0105247_101217052 254
17 3300009147 Ga0114129_10557499 Ga0114129_105574992 254
18 3300026089 Ga0207648_10478196 Ga0207648_104781962 254
19 3300035114 Ga0373939_0144635 Ga0373939_0144635_49_825 254
20 3300050511 nmdc:mga08y16_92247_c1 nmdc:mga08y16_92247_c1_2208_2990 254
21 3300050512 nmdc:mga0n895_7790_c1 nmdc:mga0n895_7790_c1_2995_3780 254
22 3300050513 nmdc:mga0rr50_3761_c1 nmdc:mga0rr50_3761_c1_882_1667 254
23 3300050515 nmdc:mga0a205_4881_c1 nmdc:mga0a205_4881_c1_8278_9063 254
24 3300013297 Ga0157378_10254589 Ga0157378_102545892 255
25 3300045051 Ga0451576_0008541 Ga0451576_0008541_11050_11832 255
26 3300005335 Ga0070666_10125837 Ga0070666_101258371 256
27 3300005842 Ga0068858_100016310 Ga0068858_1000163104 256
28 3300005842 Ga0068858_100171961 Ga0068858_1001719612 256
29 3300009101 Ga0105247_10010889 Ga0105247_100108893 256
30 3300009101 Ga0105247_10127174 Ga0105247_101271742 256
31 3300009177 Ga0105248_10777455 Ga0105248_107774552 256
32 3300013308 Ga0157375_10404029 Ga0157375_104040291 256
33 3300014325 Ga0163163_10329599 Ga0163163_103295992 256
34 3300014968 Ga0157379_10044843 Ga0157379_100448434 256
35 3300026035 Ga0207703_10029890 Ga0207703_100298902 256
36 3300026089 Ga0207648_10258360 Ga0207648_102583602 256
37 3300028379 Ga0268266_10531940 Ga0268266_105319402 256
38 3300035725 Ga0373947_0421434 Ga0373947_0421434_46_840 256
39 3300046499 Ga0495594_0004088 Ga0495594_0004088_5804_6622 256
40 3300046664 Ga0495659_0015135 Ga0495659_0015135_512_1330 256
41 3300048917 Ga0496114_0220676 Ga0496114_0220676_470_1264 256
42 3300050509 nmdc:mga0qj67_149535_c1 nmdc:mga0qj67_149535_c1_227_1036 256
43 3300005330 Ga0070690_100168282 Ga0070690_1001682822 257
44 3300005334 Ga0068869_100057291 Ga0068869_1000572913 257
45 3300005335 Ga0070666_10031567 Ga0070666_100315672 257
46 3300005355 Ga0070671_100345260 Ga0070671_1003452602 257
47 3300005356 Ga0070674_100151470 Ga0070674_1001514702 257
48 3300005441 Ga0070700_100340041 Ga0070700_1003400411 257
49 3300005456 Ga0070678_100311859 Ga0070678_1003118591 257
50 3300005548 Ga0070665_100005462 Ga0070665_1000054624 257
51 3300005617 Ga0068859_100425234 Ga0068859_1004252341 257
52 3300005843 Ga0068860_100206552 Ga0068860_1002065521 257
53 3300005844 Ga0068862_100277897 Ga0068862_1002778972 257
54 3300006163 Ga0070715_10108650 Ga0070715_101086502 257
55 3300006237 Ga0097621_100072902 Ga0097621_1000729022 257
56 3300006237 Ga0097621_100614671 Ga0097621_1006146711 257
57 3300006358 Ga0068871_100011829 Ga0068871_1000118296 257
58 3300006358 Ga0068871_100023847 Ga0068871_1000238472 257
59 3300006931 Ga0097620_100425235 Ga0097620_1004252351 257
60 3300009147 Ga0114129_10063553 Ga0114129_100635535 257
61 3300009148 Ga0105243_10251286 Ga0105243_102512862 257
62 3300009176 Ga0105242_10046386 Ga0105242_100463863 257
63 3300009176 Ga0105242_10305617 Ga0105242_103056172 257
64 3300013308 Ga0157375_10164658 Ga0157375_101646583 257
65 3300013308 Ga0157375_10176513 Ga0157375_101765132 257
66 3300014325 Ga0163163_10226208 Ga0163163_102262081 257
67 3300014745 Ga0157377_10014466 Ga0157377_100144662 257
68 3300014968 Ga0157379_10147297 Ga0157379_101472972 257
69 3300014968 Ga0157379_10299751 Ga0157379_102997511 257
70 3300014969 Ga0157376_10014304 Ga0157376_100143043 257
71 3300014969 Ga0157376_10450623 Ga0157376_104506232 257
72 3300017792 Ga0163161_10123958 Ga0163161_101239583 257
73 3300025903 Ga0207680_10046425 Ga0207680_100464252 257
74 3300025926 Ga0207659_10403051 Ga0207659_104030511 257
75 3300025927 Ga0207687_10006034 Ga0207687_100060345 257
76 3300025931 Ga0207644_10121632 Ga0207644_101216322 257
77 3300025934 Ga0207686_10039322 Ga0207686_100393223 257
78 3300025934 Ga0207686_10086725 Ga0207686_100867252 257
79 3300025937 Ga0207669_10323696 Ga0207669_103236962 257
80 3300025938 Ga0207704_10019069 Ga0207704_100190693 257
81 3300025942 Ga0207689_10061369 Ga0207689_100613692 257
82 3300026023 Ga0207677_10416429 Ga0207677_104164292 257
83 3300026075 Ga0207708_10287852 Ga0207708_102878522 257
84 3300026089 Ga0207648_10055234 Ga0207648_100552343 257
85 3300026121 Ga0207683_10214928 Ga0207683_102149283 257
86 3300028379 Ga0268266_10069858 Ga0268266_100698583 257
87 3300035120 Ga0373957_0078047 Ga0373957_0078047_13_813 257
88 3300036401 Ga0373937_0671411 Ga0373937_0671411_109_909 257
89 3300046539 Ga0495621_0111601 Ga0495621_0111601_95_886 257
90 3300046664 Ga0495659_0028868 Ga0495659_0028868_710_1507 257
91 3300048903 Ga0496100_0001556 Ga0496100_0001556_162_962 257
92 3300048904 Ga0496101_0000139 Ga0496101_0000139_23284_24084 257
93 3300048905 Ga0496102_0144376 Ga0496102_0144376_744_1544 257
94 3300048907 Ga0496104_0032711 Ga0496104_0032711_1247_2047 257
95 3300048908 Ga0496105_0037486 Ga0496105_0037486_1182_1982 257
96 3300048909 Ga0496106_0189139 Ga0496106_0189139_769_1569 257
97 3300048913 Ga0496110_0520818 Ga0496110_0520818_84_884 257
98 3300048917 Ga0496114_0000577 Ga0496114_0000577_11876_12676 257
99 3300050507 nmdc:mga05p37_53448_c1 nmdc:mga05p37_53448_c1_2894_3685 257
100 3300053085 Ga0495619_0055534 Ga0495619_0055534_692_1492 257
101 3300006871 Ga0075434_100001407 Ga0075434_10000140716 258
102 3300014326 Ga0157380_10064918 Ga0157380_100649182 258
103 3300050512 nmdc:mga0n895_6313_c1 nmdc:mga0n895_6313_c1_2442_3236 258
104 3300005295 Ga0065707_10001687 Ga0065707_100016876 259
105 3300005434 Ga0070709_10012961 Ga0070709_100129616 259
106 3300005436 Ga0070713_100017296 Ga0070713_1000172964 259
107 3300005439 Ga0070711_100308814 Ga0070711_1003088142 259
108 3300006028 Ga0070717_10046021 Ga0070717_100460213 259
109 3300011119 Ga0105246_10129235 Ga0105246_101292352 259
110 3300014745 Ga0157377_10038489 Ga0157377_100384894 259
111 3300025922 Ga0207646_10572276 Ga0207646_105722762 259
112 3300035121 Ga0373960_0013230 Ga0373960_0013230_537_1334 259
113 3300035691 Ga0373931_0322530 Ga0373931_0322530_82_879 259
114 3300045051 Ga0451576_0197445 Ga0451576_0197445_173_970 259
115 3300046664 Ga0495659_0015192 Ga0495659_0015192_1372_2169 259
116 3300046684 Ga0495669_0012920 Ga0495669_0012920_1599_2405 259
117 3300005440 Ga0070705_100118719 Ga0070705_1001187192 260
118 3300005441 Ga0070700_100513082 Ga0070700_1005130821 260
119 3300005467 Ga0070706_100163619 Ga0070706_1001636192 260
120 3300005545 Ga0070695_100065079 Ga0070695_1000650792 260
121 3300005546 Ga0070696_100209893 Ga0070696_1002098932 260
122 3300005549 Ga0070704_100332394 Ga0070704_1003323942 260
123 3300005549 Ga0070704_100623253 Ga0070704_1006232531 260
124 3300005937 Ga0081455_10082630 Ga0081455_100826302 260
125 3300025910 Ga0207684_10476959 Ga0207684_104769592 260
126 3300035089 Ga0373944_0021371 Ga0373944_0021371_921_1730 260
127 3300035116 Ga0373945_0044971 Ga0373945_0044971_502_1311 260
128 3300035118 Ga0373954_0070222 Ga0373954_0070222_399_1208 260
129 3300035170 Ga0373943_0029160 Ga0373943_0029160_1332_2141 260
130 3300035410 Ga0373924_0009742 Ga0373924_0009742_1456_2265 260
131 3300037068 Ga0373925_0011118 Ga0373925_0011118_3432_4241 260
132 3300046516 Ga0495628_0048796 Ga0495628_0048796_822_1631 260
133 3300046517 Ga0495630_0097693 Ga0495630_0097693_707_1516 260
134 3300046529 Ga0495652_0039424 Ga0495652_0039424_1682_2491 260
135 3300046531 Ga0495665_0127435 Ga0495665_0127435_469_1278 260
136 3300046543 Ga0495645_0051985 Ga0495645_0051985_1351_2160 260
137 3300046559 Ga0495667_0025717 Ga0495667_0025717_904_1713 260
138 3300046683 Ga0495658_0199825 Ga0495658_0199825_24_833 260
139 3300046689 Ga0495613_0002397 Ga0495613_0002397_3978_4787 260
140 3300047444 Ga0495675_0082135 Ga0495675_0082135_1186_1995 260
141 3300047471 Ga0495684_0000117 Ga0495684_0000117_7035_7844 260
142 3300053085 Ga0495619_0000356 Ga0495619_0000356_1885_2694 260
143 3300005330 Ga0070690_100310249 Ga0070690_1003102492 261
144 3300005336 Ga0070680_100417301 Ga0070680_1004173011 261
145 3300005338 Ga0068868_100150216 Ga0068868_1001502162 261
146 3300005340 Ga0070689_100028152 Ga0070689_1000281522 261
147 3300005340 Ga0070689_100064730 Ga0070689_1000647303 261
148 3300005343 Ga0070687_100042844 Ga0070687_1000428442 261
149 3300005345 Ga0070692_10046679 Ga0070692_100466792 261
150 3300005347 Ga0070668_100018635 Ga0070668_1000186354 261
151 3300005353 Ga0070669_100001572 Ga0070669_10000157211 261
152 3300005354 Ga0070675_100016517 Ga0070675_1000165171 261
153 3300005354 Ga0070675_100061334 Ga0070675_1000613344 261
154 3300005365 Ga0070688_100011473 Ga0070688_1000114732 261
155 3300005365 Ga0070688_100017463 Ga0070688_1000174635 261
156 3300005441 Ga0070700_100074744 Ga0070700_1000747443 261
157 3300005457 Ga0070662_100182068 Ga0070662_1001820682 261
158 3300005459 Ga0068867_100112459 Ga0068867_1001124592 261
159 3300005471 Ga0070698_100170866 Ga0070698_1001708662 261
160 3300005543 Ga0070672_100010223 Ga0070672_1000102233 261
161 3300005543 Ga0070672_100081281 Ga0070672_1000812814 261
162 3300005543 Ga0070672_100156645 Ga0070672_1001566452 261
163 3300005544 Ga0070686_100153457 Ga0070686_1001534572 261
164 3300005549 Ga0070704_100000141 Ga0070704_10000014112 261
165 3300005577 Ga0068857_100038929 Ga0068857_1000389292 261
166 3300005617 Ga0068859_100025622 Ga0068859_1000256221 261
167 3300005617 Ga0068859_100049301 Ga0068859_1000493012 261
168 3300005618 Ga0068864_100177658 Ga0068864_1001776582 261
169 3300005719 Ga0068861_100001612 Ga0068861_10000161210 261
170 3300005840 Ga0068870_10000883 Ga0068870_1000088313 261
171 3300005842 Ga0068858_100036363 Ga0068858_1000363632 261
172 3300005843 Ga0068860_100137268 Ga0068860_1001372682 261
173 3300005844 Ga0068862_100000793 Ga0068862_10000079313 261
174 3300006844 Ga0075428_100231174 Ga0075428_1002311742 261
175 3300006881 Ga0068865_100260856 Ga0068865_1002608562 261
176 3300006931 Ga0097620_100025620 Ga0097620_1000256205 261
177 3300006931 Ga0097620_100049300 Ga0097620_1000493005 261
178 3300007076 Ga0075435_100044764 Ga0075435_1000447642 261
179 3300009094 Ga0111539_10020131 Ga0111539_100201316 261
180 3300009098 Ga0105245_10228470 Ga0105245_102284702 261
181 3300009553 Ga0105249_10016411 Ga0105249_100164115 261
182 3300010375 Ga0105239_10453522 Ga0105239_104535222 261
183 3300013297 Ga0157378_10639101 Ga0157378_106391011 261
184 3300013306 Ga0163162_10038637 Ga0163162_100386373 261
185 3300013308 Ga0157375_10043010 Ga0157375_100430105 261
186 3300014326 Ga0157380_10080860 Ga0157380_100808602 261
187 3300025900 Ga0207710_10111731 Ga0207710_101117312 261
188 3300025908 Ga0207643_10001498 Ga0207643_100014982 261
189 3300025917 Ga0207660_10340198 Ga0207660_103401982 261
190 3300025918 Ga0207662_10023467 Ga0207662_100234672 261
191 3300025918 Ga0207662_10055674 Ga0207662_100556742 261
192 3300025923 Ga0207681_10000184 Ga0207681_1000018420 261
193 3300025933 Ga0207706_10029585 Ga0207706_100295852 261
194 3300025935 Ga0207709_10150092 Ga0207709_101500922 261
195 3300025936 Ga0207670_10033824 Ga0207670_100338242 261
196 3300025936 Ga0207670_10051452 Ga0207670_100514523 261
197 3300025940 Ga0207691_10014750 Ga0207691_100147508 261
198 3300025940 Ga0207691_10080884 Ga0207691_100808842 261
199 3300025940 Ga0207691_10089305 Ga0207691_100893053 261
200 3300025961 Ga0207712_10065481 Ga0207712_100654814 261
201 3300025972 Ga0207668_10016572 Ga0207668_100165722 261
202 3300026023 Ga0207677_10170561 Ga0207677_101705612 261
203 3300026075 Ga0207708_10019505 Ga0207708_100195055 261
204 3300026089 Ga0207648_10002611 Ga0207648_1000261111 261
205 3300026095 Ga0207676_10033043 Ga0207676_100330432 261
206 3300026116 Ga0207674_10010264 Ga0207674_100102642 261
207 3300026118 Ga0207675_100002432 Ga0207675_1000024325 261
208 3300026121 Ga0207683_10141365 Ga0207683_101413652 261
209 3300027907 Ga0207428_10001435 Ga0207428_100014355 261
210 3300028380 Ga0268265_10000188 Ga0268265_1000018851 261
211 3300046539 Ga0495621_0004411 Ga0495621_0004411_3052_3840 261
212 3300050511 nmdc:mga08y16_991_c1 nmdc:mga08y16_991_c1_16611_17414 261
213 3300050513 nmdc:mga0rr50_42204_c1 nmdc:mga0rr50_42204_c1_14_814 261
214 3300005536 Ga0070697_100444869 Ga0070697_1004448691 262
215 3300005546 Ga0070696_100041750 Ga0070696_1000417502 262
216 3300005618 Ga0068864_100100242 Ga0068864_1001002422 262
217 3300006871 Ga0075434_100716403 Ga0075434_1007164032 262
218 3300025922 Ga0207646_10155953 Ga0207646_101559532 262
219 3300026095 Ga0207676_10067142 Ga0207676_100671422 262
220 3300046455 Ga0495603_0034919 Ga0495603_0034919_1236_2045 262
221 3300046459 Ga0495629_0029160 Ga0495629_0029160_2634_3443 262
222 3300046664 Ga0495659_0011174 Ga0495659_0011174_1778_2584 262
223 3300046683 Ga0495658_0042609 Ga0495658_0042609_475_1284 262
224 3300047321 Ga0495676_0122926 Ga0495676_0122926_712_1521 262
225 3300050513 nmdc:mga0rr50_370320_c1 nmdc:mga0rr50_370320_c1_395_1183 262
226 3300005331 Ga0070670_100753741 Ga0070670_1007537411 263
227 3300005341 Ga0070691_10083290 Ga0070691_100832902 263
228 3300005345 Ga0070692_10018307 Ga0070692_100183074 263
229 3300005364 Ga0070673_100278188 Ga0070673_1002781882 263
230 3300005438 Ga0070701_10054130 Ga0070701_100541302 263
231 3300005438 Ga0070701_10168369 Ga0070701_101683692 263
232 3300005440 Ga0070705_100000401 Ga0070705_10000040120 263
233 3300005444 Ga0070694_100001431 Ga0070694_1000014318 263
234 3300005445 Ga0070708_100309881 Ga0070708_1003098811 263
235 3300005457 Ga0070662_100254856 Ga0070662_1002548562 263
236 3300005458 Ga0070681_10008760 Ga0070681_100087602 263
237 3300005467 Ga0070706_100334141 Ga0070706_1003341412 263
238 3300005468 Ga0070707_100062318 Ga0070707_1000623182 263
239 3300005518 Ga0070699_100007592 Ga0070699_1000075925 263
240 3300005530 Ga0070679_100319438 Ga0070679_1003194382 263
241 3300005545 Ga0070695_100005835 Ga0070695_1000058356 263
242 3300005545 Ga0070695_100042257 Ga0070695_1000422573 263
243 3300005546 Ga0070696_100016928 Ga0070696_1000169283 263
244 3300005546 Ga0070696_100420167 Ga0070696_1004201671 263
245 3300005549 Ga0070704_100022170 Ga0070704_1000221702 263
246 3300005615 Ga0070702_100006682 Ga0070702_1000066822 263
247 3300006852 Ga0075433_10107423 Ga0075433_101074232 263
248 3300006914 Ga0075436_100353176 Ga0075436_1003531761 263
249 3300009147 Ga0114129_10002771 Ga0114129_100027716 263
250 3300025912 Ga0207707_10080618 Ga0207707_100806182 263
251 3300025917 Ga0207660_10047331 Ga0207660_100473314 263
252 3300025921 Ga0207652_10358791 Ga0207652_103587912 263
253 3300025922 Ga0207646_10068063 Ga0207646_100680632 263
254 3300025922 Ga0207646_10314868 Ga0207646_103148682 263
255 3300025925 Ga0207650_10145429 Ga0207650_101454292 263
256 3300025933 Ga0207706_10248175 Ga0207706_102481752 263
257 3300045051 Ga0451576_0073056 Ga0451576_0073056_2615_3424 263
258 3300045051 Ga0451576_0086635 Ga0451576_0086635_256_1065 263
259 3300046523 Ga0495644_0083067 Ga0495644_0083067_12_806 263
260 3300046664 Ga0495659_0043584 Ga0495659_0043584_246_1187 263
261 3300046664 Ga0495659_0147935 Ga0495659_0147935_80_874 263
262 3300047318 Ga0495636_0008735 Ga0495636_0008735_2929_3723 263
263 3300050507 nmdc:mga05p37_477061_c1 nmdc:mga05p37_477061_c1_97_891 263
264 3300050515 nmdc:mga0a205_263039_c1 nmdc:mga0a205_263039_c1_550_1344 263
265 3300005444 Ga0070694_100323492 Ga0070694_1003234922 264
266 3300006871 Ga0075434_100011654 Ga0075434_10001165410 264
267 3300007076 Ga0075435_100066551 Ga0075435_1000665512 264
268 3300042876 Ga0451577_0123565 Ga0451577_0123565_1382_2179 264
269 3300045051 Ga0451576_0147918 Ga0451576_0147918_828_1625 264
270 3300046538 Ga0495609_0036064 Ga0495609_0036064_272_1066 264
271 3300046539 Ga0495621_0076881 Ga0495621_0076881_11_805 264
272 3300046664 Ga0495659_0099965 Ga0495659_0099965_267_1061 264
273 3300050512 nmdc:mga0n895_45868_c1 nmdc:mga0n895_45868_c1_2336_3133 264
274 3300004798 Ga0058859_11636092 Ga0058859_116360922 265
275 3300005331 Ga0070670_100035611 Ga0070670_1000356112 265
276 3300005334 Ga0068869_100114098 Ga0068869_1001140981 265
277 3300005336 Ga0070680_100067623 Ga0070680_1000676234 265
278 3300005340 Ga0070689_100000911 Ga0070689_10000091121 265
279 3300005340 Ga0070689_100362598 Ga0070689_1003625981 265
280 3300005354 Ga0070675_100008111 Ga0070675_1000081113 265
281 3300005355 Ga0070671_100011036 Ga0070671_1000110366 265
282 3300005365 Ga0070688_100089896 Ga0070688_1000898962 265
283 3300005438 Ga0070701_10065310 Ga0070701_100653102 265
284 3300005438 Ga0070701_10124272 Ga0070701_101242721 265
285 3300005440 Ga0070705_100026915 Ga0070705_1000269154 265
286 3300005444 Ga0070694_100016370 Ga0070694_1000163703 265
287 3300005467 Ga0070706_100045183 Ga0070706_1000451834 265
288 3300005471 Ga0070698_100019867 Ga0070698_1000198673 265
289 3300005518 Ga0070699_100042672 Ga0070699_1000426723 265
290 3300005535 Ga0070684_100132062 Ga0070684_1001320622 265
291 3300005543 Ga0070672_100098191 Ga0070672_1000981912 265
292 3300005564 Ga0070664_100259686 Ga0070664_1002596862 265
293 3300005564 Ga0070664_100265363 Ga0070664_1002653633 265
294 3300005577 Ga0068857_100378150 Ga0068857_1003781502 265
295 3300005617 Ga0068859_100096125 Ga0068859_1000961252 265
296 3300005617 Ga0068859_100224307 Ga0068859_1002243072 265
297 3300005842 Ga0068858_100010481 Ga0068858_1000104812 265
298 3300005843 Ga0068860_100041226 Ga0068860_1000412264 265
299 3300006237 Ga0097621_100086201 Ga0097621_1000862013 265
300 3300006237 Ga0097621_100300385 Ga0097621_1003003852 265
301 3300006358 Ga0068871_100058172 Ga0068871_1000581722 265
302 3300006844 Ga0075428_100214021 Ga0075428_1002140212 265
303 3300006852 Ga0075433_10095005 Ga0075433_100950053 265
304 3300006852 Ga0075433_10488220 Ga0075433_104882202 265
305 3300006871 Ga0075434_100096561 Ga0075434_1000965612 265
306 3300006881 Ga0068865_100098615 Ga0068865_1000986153 265
307 3300006931 Ga0097620_100096138 Ga0097620_1000961382 265
308 3300006931 Ga0097620_100224320 Ga0097620_1002243202 265
309 3300007076 Ga0075435_100076084 Ga0075435_1000760842 265
310 3300009094 Ga0111539_10555063 Ga0111539_105550631 265
311 3300009147 Ga0114129_10313311 Ga0114129_103133113 265
312 3300009148 Ga0105243_10252534 Ga0105243_102525343 265
313 3300009553 Ga0105249_10005533 Ga0105249_100055334 265
314 3300013306 Ga0163162_10036273 Ga0163162_100362731 265
315 3300014326 Ga0157380_10230602 Ga0157380_102306022 265
316 3300014745 Ga0157377_10233565 Ga0157377_102335652 265
317 3300014968 Ga0157379_10317548 Ga0157379_103175482 265
318 3300014969 Ga0157376_10207008 Ga0157376_102070082 265
319 3300025917 Ga0207660_10033842 Ga0207660_100338422 265
320 3300025918 Ga0207662_10080835 Ga0207662_100808351 265
321 3300025922 Ga0207646_10310795 Ga0207646_103107951 265
322 3300025925 Ga0207650_10291129 Ga0207650_102911292 265
323 3300025935 Ga0207709_10318895 Ga0207709_103188951 265
324 3300025936 Ga0207670_10226929 Ga0207670_102269292 265
325 3300025937 Ga0207669_10231388 Ga0207669_102313881 265
326 3300025938 Ga0207704_10068456 Ga0207704_100684561 265
327 3300025940 Ga0207691_10115395 Ga0207691_101153952 265
328 3300025941 Ga0207711_10519450 Ga0207711_105194502 265
329 3300025942 Ga0207689_10648551 Ga0207689_106485511 265
330 3300025945 Ga0207679_10160925 Ga0207679_101609252 265
331 3300025986 Ga0207658_10414118 Ga0207658_104141181 265
332 3300026035 Ga0207703_10081395 Ga0207703_100813952 265
333 3300026118 Ga0207675_100044139 Ga0207675_1000441394 265
334 3300028381 Ga0268264_10014019 Ga0268264_100140192 265
335 3300046455 Ga0495603_0073533 Ga0495603_0073533_159_956 265
336 3300046491 Ga0495584_0167924 Ga0495584_0167924_111_908 265
337 3300046525 Ga0495663_0006982 Ga0495663_0006982_815_1612 265
338 3300046525 Ga0495663_0076719 Ga0495663_0076719_215_1012 265
339 3300046539 Ga0495621_0042246 Ga0495621_0042246_684_1481 265
340 3300046558 Ga0495633_0122634 Ga0495633_0122634_26_823 265
341 3300046664 Ga0495659_0001404 Ga0495659_0001404_2578_3375 265
342 3300046664 Ga0495659_0008764 Ga0495659_0008764_1474_2271 265
343 3300046674 Ga0495588_0114745 Ga0495588_0114745_208_1005 265
344 3300047447 Ga0495685_052420 Ga0495685_052420_34_831 265
345 3300050507 nmdc:mga05p37_22946_c1 nmdc:mga05p37_22946_c1_3266_4066 265
346 3300050507 nmdc:mga05p37_382458_c1 nmdc:mga05p37_382458_c1_470_1267 265
347 3300050507 nmdc:mga05p37_90802_c1 nmdc:mga05p37_90802_c1_2124_3005 265
348 3300050511 nmdc:mga08y16_724942_c1 nmdc:mga08y16_724942_c1_87_884 265
349 3300050512 nmdc:mga0n895_133673_c1 nmdc:mga0n895_133673_c1_1517_2398 265
350 3300050513 nmdc:mga0rr50_359200_c1 nmdc:mga0rr50_359200_c1_232_1029 265
351 3300050515 nmdc:mga0a205_225722_c1 nmdc:mga0a205_225722_c1_557_1354 265
352 3300050515 nmdc:mga0a205_540563_c1 nmdc:mga0a205_540563_c1_170_967 265

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cn1-assembly4.cif.gz_D crystal structure of yeast gga1_gae domain-p21 0.7525 194 216
6xux-assembly1.cif.gz_A crystal structure of megabody mb-nb207-cygjk_no 0.7369 168 216
7ubx-assembly1.cif.gz_A structure of a pore forming fragment of clostridium difficile toxin a in complex with vhh aa6 0.6866 158 183
3wje-assembly1.cif.gz_A crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana 0.6585 160 225
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.6456 158 176
ID Description Score Start End Superfamily
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7966 194 216 2.60.40.200
2czrA01 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1;TBP-interacting protein, N-terminal domain 0.7878 119 149 3.40.1350.70
af_Q54XZ0_160_288_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7238 188 236 3.10.129.10
af_Q869W9_940_1212_3.10.129.110 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.6897 194 238 3.10.129.110
af_P21893_327_456_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.6728 158 176 3.10.310.30
ID Description Score Start End GO Terms
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.9218 119 238
AF-A0A2V8IWV6-F1-model_v4 Uncharacterized protein 0.9137 119 243
AF-A0A2V8XMB4-F1-model_v4 Uncharacterized protein 0.9094 119 243
AF-A0A2V8ID39-F1-model_v4 Uncharacterized protein 0.8914 118 250
AF-A0A1F2S5M9-F1-model_v4 Uncharacterized protein 0.8858 119 248

Feature Viewer

pLDDT pTM Quality
75.86 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map