F419144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 352 | 183 | 352 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300046664|Ga0495659_0043584|Ga0495659_0043584_246_1187 |
| Length | 313 |
| Sequence | MLLLMPASSWAQSGITGIVRDARRATVMTRHIRIEVDSGTARGSTMKRMMAAIAVTVAMLTTLAVAQNLPWNNPGGGQGQAAAPSGPPGPAPTRDISGLWDAGGGGIGARGMQTAPLTPWGEMMGKTHHSGDGARMVPADQINDPLSTLADPGGFPRNLLFELRPFEVVQMPNKMLIVYMFEKRWRVIWTDGRQLPTNPDPRWYGYSVGHWEDDYTFVVNSNGTDERTWLDNAGNPHSDQLKVEERYHRVDRNTMELTVVIDDAKAYTRSWVGRDKLRLTLLPANTDLMEMIPSASEAAAVKSIYAAEAAGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 132 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 135 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 97.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11636092 | 3300004798 | Bacteria | 1431 |
| 2 | Ga0065707_10001687 | 3300005295 | Bacteria | 7616 |
| 3 | Ga0070690_100168282 | 3300005330 | Bacteria | 1507 |
| 4 | Ga0070690_100310249 | 3300005330 | Unclassified | 1134 |
| 5 | Ga0070670_100035611 | 3300005331 | Unclassified | 4285 |
| 6 | Ga0070670_100753741 | 3300005331 | Unclassified | 877 |
| 7 | Ga0068869_100057291 | 3300005334 | Bacteria | 2844 |
| 8 | Ga0068869_100114098 | 3300005334 | Unclassified | 2059 |
| 9 | Ga0070666_10031567 | 3300005335 | Bacteria | 3497 |
| 10 | Ga0070666_10125837 | 3300005335 | Unclassified | 1779 |
| 11 | Ga0070680_100067623 | 3300005336 | Unclassified | 2931 |
| 12 | Ga0070680_100417301 | 3300005336 | Bacteria | 1145 |
| 13 | Ga0068868_100150216 | 3300005338 | Unclassified | 1918 |
| 14 | Ga0070689_100000911 | 3300005340 | Bacteria | 18450 |
| 15 | Ga0070689_100028152 | 3300005340 | Bacteria | 4245 |
| 16 | Ga0070689_100064730 | 3300005340 | Unclassified | 2847 |
| 17 | Ga0070689_100362598 | 3300005340 | Unclassified | 1218 |
| 18 | Ga0070691_10083290 | 3300005341 | Archaea | 1569 |
| 19 | Ga0070687_100042844 | 3300005343 | Bacteria | 2296 |
| 20 | Ga0070692_10018307 | 3300005345 | Bacteria | 3366 |
| 21 | Ga0070692_10046679 | 3300005345 | Unclassified | 2240 |
| 22 | Ga0070668_100018635 | 3300005347 | Bacteria | 5212 |
| 23 | Ga0070669_100001572 | 3300005353 | Bacteria | 16555 |
| 24 | Ga0070675_100008111 | 3300005354 | Bacteria | 8143 |
| 25 | Ga0070675_100016517 | 3300005354 | Bacteria | 5861 |
| 26 | Ga0070675_100061334 | 3300005354 | Unclassified | 3105 |
| 27 | Ga0070671_100011036 | 3300005355 | Bacteria | 7250 |
| 28 | Ga0070671_100345260 | 3300005355 | Unclassified | 1270 |
| 29 | Ga0070674_100151470 | 3300005356 | Bacteria | 1751 |
| 30 | Ga0070673_100278188 | 3300005364 | Bacteria | 1467 |
| 31 | Ga0070688_100011473 | 3300005365 | Bacteria | 4924 |
| 32 | Ga0070688_100017463 | 3300005365 | Unclassified | 4118 |
| 33 | Ga0070688_100089896 | 3300005365 | Bacteria | 2005 |
| 34 | Ga0070709_10012961 | 3300005434 | Bacteria | 4676 |
| 35 | Ga0070713_100017296 | 3300005436 | Bacteria | 5449 |
| 36 | Ga0070701_10054130 | 3300005438 | Unclassified | 2092 |
| 37 | Ga0070701_10065310 | 3300005438 | Bacteria | 1931 |
| 38 | Ga0070701_10124272 | 3300005438 | Unclassified | 1458 |
| 39 | Ga0070701_10168369 | 3300005438 | Bacteria | 1274 |
| 40 | Ga0070711_100308814 | 3300005439 | Bacteria | 1260 |
| 41 | Ga0070705_100000401 | 3300005440 | Bacteria | 25010 |
| 42 | Ga0070705_100026915 | 3300005440 | Bacteria | 3134 |
| 43 | Ga0070705_100118719 | 3300005440 | Unclassified | 1704 |
| 44 | Ga0070700_100074744 | 3300005441 | Unclassified | 2172 |
| 45 | Ga0070700_100340041 | 3300005441 | Bacteria | 1109 |
| 46 | Ga0070700_100513082 | 3300005441 | Bacteria | 924 |
| 47 | Ga0070694_100001431 | 3300005444 | Bacteria | 13985 |
| 48 | Ga0070694_100016370 | 3300005444 | Bacteria | 4666 |
| 49 | Ga0070694_100323492 | 3300005444 | Bacteria | 1187 |
| 50 | Ga0070708_100229157 | 3300005445 | Unclassified | 1743 |
| 51 | Ga0070708_100309881 | 3300005445 | Bacteria | 1487 |
| 52 | Ga0070678_100311859 | 3300005456 | Unclassified | 1341 |
| 53 | Ga0070662_100182068 | 3300005457 | Bacteria | 1657 |
| 54 | Ga0070662_100254856 | 3300005457 | Unclassified | 1412 |
| 55 | Ga0070681_10008760 | 3300005458 | Bacteria | 9929 |
| 56 | Ga0068867_100112459 | 3300005459 | Unclassified | 2094 |
| 57 | Ga0070706_100045183 | 3300005467 | Bacteria | 4069 |
| 58 | Ga0070706_100163619 | 3300005467 | Unclassified | 2078 |
| 59 | Ga0070706_100334141 | 3300005467 | Unclassified | 1413 |
| 60 | Ga0070707_100062318 | 3300005468 | Unclassified | 3578 |
| 61 | Ga0070698_100019867 | 3300005471 | Bacteria | 7047 |
| 62 | Ga0070698_100170866 | 3300005471 | Unclassified | 2115 |
| 63 | Ga0070699_100007592 | 3300005518 | Bacteria | 9428 |
| 64 | Ga0070699_100042672 | 3300005518 | Bacteria | 3925 |
| 65 | Ga0070679_100319438 | 3300005530 | Bacteria | 1502 |
| 66 | Ga0070684_100132062 | 3300005535 | Bacteria | 2253 |
| 67 | Ga0070697_100444869 | 3300005536 | Bacteria | 1128 |
| 68 | Ga0070672_100010223 | 3300005543 | Bacteria | 6500 |
| 69 | Ga0070672_100081281 | 3300005543 | Unclassified | 2598 |
| 70 | Ga0070672_100098191 | 3300005543 | Unclassified | 2372 |
| 71 | Ga0070672_100156645 | 3300005543 | Bacteria | 1887 |
| 72 | Ga0070686_100153457 | 3300005544 | Bacteria | 1615 |
| 73 | Ga0070695_100005835 | 3300005545 | Bacteria | 7262 |
| 74 | Ga0070695_100042257 | 3300005545 | Unclassified | 2893 |
| 75 | Ga0070695_100065079 | 3300005545 | Bacteria | 2373 |
| 76 | Ga0070696_100016928 | 3300005546 | Bacteria | 4917 |
| 77 | Ga0070696_100041750 | 3300005546 | Bacteria | 3169 |
| 78 | Ga0070696_100209893 | 3300005546 | Bacteria | 1457 |
| 79 | Ga0070696_100420167 | 3300005546 | Bacteria | 1049 |
| 80 | Ga0070665_100005462 | 3300005548 | Bacteria | 13103 |
| 81 | Ga0070704_100000141 | 3300005549 | Bacteria | 27191 |
| 82 | Ga0070704_100022170 | 3300005549 | Bacteria | 4129 |
| 83 | Ga0070704_100332394 | 3300005549 | Bacteria | 1277 |
| 84 | Ga0070704_100623253 | 3300005549 | Bacteria | 950 |
| 85 | Ga0070664_100259686 | 3300005564 | Bacteria | 1563 |
| 86 | Ga0070664_100265363 | 3300005564 | Unclassified | 1545 |
| 87 | Ga0068857_100038929 | 3300005577 | Bacteria | 4210 |
| 88 | Ga0068857_100378150 | 3300005577 | Bacteria | 1315 |
| 89 | Ga0070702_100006682 | 3300005615 | Bacteria | 5479 |
| 90 | Ga0068859_100025622 | 3300005617 | Bacteria | 5916 |
| 91 | Ga0068859_100049301 | 3300005617 | Unclassified | 4229 |
| 92 | Ga0068859_100096125 | 3300005617 | Unclassified | 3015 |
| 93 | Ga0068859_100224307 | 3300005617 | Unclassified | 1967 |
| 94 | Ga0068859_100425234 | 3300005617 | Unclassified | 1425 |
| 95 | Ga0068864_100100242 | 3300005618 | Bacteria | 2567 |
| 96 | Ga0068864_100177658 | 3300005618 | Bacteria | 1944 |
| 97 | Ga0068861_100001612 | 3300005719 | Bacteria | 14373 |
| 98 | Ga0068870_10000883 | 3300005840 | Bacteria | 11715 |
| 99 | Ga0068858_100010481 | 3300005842 | Bacteria | 8781 |
| 100 | Ga0068858_100016310 | 3300005842 | Bacteria | 6979 |
| 101 | Ga0068858_100036363 | 3300005842 | Bacteria | 4566 |
| 102 | Ga0068858_100171961 | 3300005842 | Bacteria | 2043 |
| 103 | Ga0068860_100041226 | 3300005843 | Unclassified | 4410 |
| 104 | Ga0068860_100137268 | 3300005843 | Unclassified | 2349 |
| 105 | Ga0068860_100206552 | 3300005843 | Unclassified | 1905 |
| 106 | Ga0068862_100000793 | 3300005844 | Bacteria | 31302 |
| 107 | Ga0068862_100277897 | 3300005844 | Bacteria | 1534 |
| 108 | Ga0081455_10082630 | 3300005937 | Unclassified | 2627 |
| 109 | Ga0070717_10046021 | 3300006028 | Bacteria | 3569 |
| 110 | Ga0070715_10108650 | 3300006163 | Bacteria | 1305 |
| 111 | Ga0070716_100177854 | 3300006173 | Unclassified | 1394 |
| 112 | Ga0097621_100072902 | 3300006237 | Unclassified | 2841 |
| 113 | Ga0097621_100086201 | 3300006237 | Unclassified | 2620 |
| 114 | Ga0097621_100300385 | 3300006237 | Bacteria | 1418 |
| 115 | Ga0097621_100614671 | 3300006237 | Bacteria | 994 |
| 116 | Ga0068871_100011829 | 3300006358 | Bacteria | 6415 |
| 117 | Ga0068871_100023847 | 3300006358 | Unclassified | 4739 |
| 118 | Ga0068871_100058172 | 3300006358 | Bacteria | 3147 |
| 119 | Ga0075428_100009105 | 3300006844 | Bacteria | 11017 |
| 120 | Ga0075428_100212064 | 3300006844 | Unclassified | 2093 |
| 121 | Ga0075428_100214021 | 3300006844 | Bacteria | 2082 |
| 122 | Ga0075428_100231174 | 3300006844 | Unclassified | 1995 |
| 123 | Ga0075433_10023077 | 3300006852 | Bacteria | 5233 |
| 124 | Ga0075433_10095005 | 3300006852 | Unclassified | 2638 |
| 125 | Ga0075433_10107423 | 3300006852 | Bacteria | 2474 |
| 126 | Ga0075433_10488220 | 3300006852 | Unclassified | 1085 |
| 127 | Ga0075434_100001407 | 3300006871 | Bacteria | 20216 |
| 128 | Ga0075434_100011654 | 3300006871 | Bacteria | 8303 |
| 129 | Ga0075434_100023694 | 3300006871 | Bacteria | 5987 |
| 130 | Ga0075434_100096561 | 3300006871 | Unclassified | 2960 |
| 131 | Ga0075434_100716403 | 3300006871 | Bacteria | 1018 |
| 132 | Ga0075429_100363312 | 3300006880 | Bacteria | 1267 |
| 133 | Ga0068865_100098615 | 3300006881 | Bacteria | 2135 |
| 134 | Ga0068865_100260856 | 3300006881 | Unclassified | 1372 |
| 135 | Ga0075436_100353176 | 3300006914 | Bacteria | 1060 |
| 136 | Ga0097620_100025620 | 3300006931 | Bacteria | 5916 |
| 137 | Ga0097620_100049300 | 3300006931 | Unclassified | 4229 |
| 138 | Ga0097620_100096138 | 3300006931 | Unclassified | 3015 |
| 139 | Ga0097620_100224320 | 3300006931 | Unclassified | 1967 |
| 140 | Ga0097620_100425235 | 3300006931 | Unclassified | 1425 |
| 141 | Ga0075435_100016609 | 3300007076 | Bacteria | 5551 |
| 142 | Ga0075435_100044764 | 3300007076 | Unclassified | 3545 |
| 143 | Ga0075435_100066551 | 3300007076 | Bacteria | 2932 |
| 144 | Ga0075435_100076084 | 3300007076 | Unclassified | 2750 |
| 145 | Ga0111539_10020131 | 3300009094 | Bacteria | 8221 |
| 146 | Ga0111539_10555063 | 3300009094 | Unclassified | 1338 |
| 147 | Ga0105245_10042900 | 3300009098 | Bacteria | 4035 |
| 148 | Ga0105245_10228470 | 3300009098 | Unclassified | 1799 |
| 149 | Ga0105247_10010889 | 3300009101 | Bacteria | 5494 |
| 150 | Ga0105247_10121705 | 3300009101 | Bacteria | 1691 |
| 151 | Ga0105247_10127174 | 3300009101 | Bacteria | 1657 |
| 152 | Ga0114129_10002771 | 3300009147 | Bacteria | 24412 |
| 153 | Ga0114129_10063553 | 3300009147 | Bacteria | 5154 |
| 154 | Ga0114129_10313311 | 3300009147 | Bacteria | 2088 |
| 155 | Ga0114129_10557499 | 3300009147 | Bacteria | 1489 |
| 156 | Ga0105243_10251286 | 3300009148 | Bacteria | 1579 |
| 157 | Ga0105243_10252534 | 3300009148 | Unclassified | 1575 |
| 158 | Ga0105242_10046386 | 3300009176 | Bacteria | 3525 |
| 159 | Ga0105242_10305617 | 3300009176 | Unclassified | 1453 |
| 160 | Ga0105248_10777455 | 3300009177 | Bacteria | 1081 |
| 161 | Ga0105249_10005533 | 3300009553 | Bacteria | 10916 |
| 162 | Ga0105249_10016411 | 3300009553 | Bacteria | 6570 |
| 163 | Ga0105239_10453522 | 3300010375 | Unclassified | 1455 |
| 164 | Ga0105246_10129235 | 3300011119 | Bacteria | 1884 |
| 165 | Ga0157374_10616693 | 3300013296 | Unclassified | 1095 |
| 166 | Ga0157378_10254589 | 3300013297 | Unclassified | 1682 |
| 167 | Ga0157378_10639101 | 3300013297 | Unclassified | 1079 |
| 168 | Ga0163162_10036273 | 3300013306 | Unclassified | 4912 |
| 169 | Ga0163162_10038637 | 3300013306 | Bacteria | 4763 |
| 170 | Ga0157375_10043010 | 3300013308 | Unclassified | 4378 |
| 171 | Ga0157375_10164658 | 3300013308 | Unclassified | 2362 |
| 172 | Ga0157375_10176513 | 3300013308 | Bacteria | 2286 |
| 173 | Ga0157375_10404029 | 3300013308 | Unclassified | 1532 |
| 174 | Ga0163163_10226208 | 3300014325 | Bacteria | 1920 |
| 175 | Ga0163163_10329599 | 3300014325 | Bacteria | 1581 |
| 176 | Ga0157380_10064918 | 3300014326 | Bacteria | 2932 |
| 177 | Ga0157380_10080860 | 3300014326 | Unclassified | 2656 |
| 178 | Ga0157380_10230602 | 3300014326 | Bacteria | 1663 |
| 179 | Ga0157377_10014466 | 3300014745 | Bacteria | 4016 |
| 180 | Ga0157377_10038489 | 3300014745 | Unclassified | 2641 |
| 181 | Ga0157377_10233565 | 3300014745 | Bacteria | 1184 |
| 182 | Ga0157379_10044843 | 3300014968 | Bacteria | 3947 |
| 183 | Ga0157379_10147297 | 3300014968 | Bacteria | 2123 |
| 184 | Ga0157379_10299751 | 3300014968 | Unclassified | 1465 |
| 185 | Ga0157379_10317548 | 3300014968 | Unclassified | 1422 |
| 186 | Ga0157376_10014304 | 3300014969 | Bacteria | 5951 |
| 187 | Ga0157376_10207008 | 3300014969 | Bacteria | 1809 |
| 188 | Ga0157376_10450623 | 3300014969 | Unclassified | 1255 |
| 189 | Ga0163161_10123958 | 3300017792 | Unclassified | 1944 |
| 190 | Ga0207710_10111731 | 3300025900 | Bacteria | 1298 |
| 191 | Ga0207680_10046425 | 3300025903 | Bacteria | 2568 |
| 192 | Ga0207699_10381508 | 3300025906 | Unclassified | 1000 |
| 193 | Ga0207643_10001498 | 3300025908 | Bacteria | 13376 |
| 194 | Ga0207684_10476959 | 3300025910 | Bacteria | 1070 |
| 195 | Ga0207707_10080618 | 3300025912 | Bacteria | 2842 |
| 196 | Ga0207660_10033842 | 3300025917 | Unclassified | 3538 |
| 197 | Ga0207660_10047331 | 3300025917 | Unclassified | 3040 |
| 198 | Ga0207660_10340198 | 3300025917 | Unclassified | 1201 |
| 199 | Ga0207662_10023467 | 3300025918 | Bacteria | 3544 |
| 200 | Ga0207662_10055674 | 3300025918 | Unclassified | 2360 |
| 201 | Ga0207662_10080835 | 3300025918 | Bacteria | 1983 |
| 202 | Ga0207652_10358791 | 3300025921 | Bacteria | 1316 |
| 203 | Ga0207646_10068063 | 3300025922 | Unclassified | 3180 |
| 204 | Ga0207646_10155953 | 3300025922 | Bacteria | 2059 |
| 205 | Ga0207646_10310795 | 3300025922 | Bacteria | 1424 |
| 206 | Ga0207646_10314868 | 3300025922 | Bacteria | 1414 |
| 207 | Ga0207646_10572276 | 3300025922 | Bacteria | 1015 |
| 208 | Ga0207681_10000184 | 3300025923 | Bacteria | 50507 |
| 209 | Ga0207650_10145429 | 3300025925 | Unclassified | 1867 |
| 210 | Ga0207650_10291129 | 3300025925 | Unclassified | 1332 |
| 211 | Ga0207659_10403051 | 3300025926 | Bacteria | 1144 |
| 212 | Ga0207687_10006034 | 3300025927 | Bacteria | 8016 |
| 213 | Ga0207644_10121632 | 3300025931 | Unclassified | 1988 |
| 214 | Ga0207706_10029585 | 3300025933 | Unclassified | 4888 |
| 215 | Ga0207706_10248175 | 3300025933 | Unclassified | 1555 |
| 216 | Ga0207686_10039322 | 3300025934 | Unclassified | 2870 |
| 217 | Ga0207686_10086725 | 3300025934 | Bacteria | 2057 |
| 218 | Ga0207709_10150092 | 3300025935 | Unclassified | 1613 |
| 219 | Ga0207709_10318895 | 3300025935 | Unclassified | 1162 |
| 220 | Ga0207670_10033824 | 3300025936 | Bacteria | 3297 |
| 221 | Ga0207670_10051452 | 3300025936 | Unclassified | 2766 |
| 222 | Ga0207670_10226929 | 3300025936 | Unclassified | 1432 |
| 223 | Ga0207669_10231388 | 3300025937 | Bacteria | 1364 |
| 224 | Ga0207669_10323696 | 3300025937 | Unclassified | 1181 |
| 225 | Ga0207704_10019069 | 3300025938 | Bacteria | 3595 |
| 226 | Ga0207704_10068456 | 3300025938 | Bacteria | 2238 |
| 227 | Ga0207665_10225078 | 3300025939 | Unclassified | 1376 |
| 228 | Ga0207691_10014750 | 3300025940 | Bacteria | 7448 |
| 229 | Ga0207691_10080884 | 3300025940 | Unclassified | 2921 |
| 230 | Ga0207691_10089305 | 3300025940 | Bacteria | 2764 |
| 231 | Ga0207691_10115395 | 3300025940 | Unclassified | 2385 |
| 232 | Ga0207711_10519450 | 3300025941 | Bacteria | 1110 |
| 233 | Ga0207689_10061369 | 3300025942 | Bacteria | 3091 |
| 234 | Ga0207689_10648551 | 3300025942 | Unclassified | 889 |
| 235 | Ga0207679_10160925 | 3300025945 | Bacteria | 1838 |
| 236 | Ga0207712_10065481 | 3300025961 | Unclassified | 2594 |
| 237 | Ga0207668_10016572 | 3300025972 | Bacteria | 4601 |
| 238 | Ga0207658_10414118 | 3300025986 | Unclassified | 1187 |
| 239 | Ga0207677_10170561 | 3300026023 | Unclassified | 1701 |
| 240 | Ga0207677_10416429 | 3300026023 | Bacteria | 1143 |
| 241 | Ga0207703_10029890 | 3300026035 | Bacteria | 4302 |
| 242 | Ga0207703_10081395 | 3300026035 | Bacteria | 2699 |
| 243 | Ga0207708_10019505 | 3300026075 | Bacteria | 5113 |
| 244 | Ga0207708_10287852 | 3300026075 | Unclassified | 1333 |
| 245 | Ga0207648_10002611 | 3300026089 | Bacteria | 19311 |
| 246 | Ga0207648_10055234 | 3300026089 | Bacteria | 3467 |
| 247 | Ga0207648_10258360 | 3300026089 | Bacteria | 1554 |
| 248 | Ga0207648_10478196 | 3300026089 | Unclassified | 1137 |
| 249 | Ga0207676_10033043 | 3300026095 | Bacteria | 3906 |
| 250 | Ga0207676_10067142 | 3300026095 | Bacteria | 2864 |
| 251 | Ga0207674_10010264 | 3300026116 | Bacteria | 10626 |
| 252 | Ga0207675_100002432 | 3300026118 | Bacteria | 18448 |
| 253 | Ga0207675_100044139 | 3300026118 | Bacteria | 4164 |
| 254 | Ga0207683_10141365 | 3300026121 | Bacteria | 2169 |
| 255 | Ga0207683_10214928 | 3300026121 | Bacteria | 1751 |
| 256 | Ga0207428_10001435 | 3300027907 | Bacteria | 25041 |
| 257 | Ga0268266_10069858 | 3300028379 | Bacteria | 3044 |
| 258 | Ga0268266_10531940 | 3300028379 | Bacteria | 1125 |
| 259 | Ga0268265_10000188 | 3300028380 | Bacteria | 73548 |
| 260 | Ga0268264_10014019 | 3300028381 | Bacteria | 6591 |
| 261 | Ga0373944_0021371 | 3300035089 | Bacteria | 1873 |
| 262 | Ga0373939_0144635 | 3300035114 | Unclassified | 860 |
| 263 | Ga0373945_0044971 | 3300035116 | Unclassified | 1607 |
| 264 | Ga0373954_0070222 | 3300035118 | Unclassified | 1664 |
| 265 | Ga0373957_0078047 | 3300035120 | Unclassified | 1304 |
| 266 | Ga0373960_0013230 | 3300035121 | Bacteria | 2066 |
| 267 | Ga0373943_0029160 | 3300035170 | Unclassified | 2606 |
| 268 | Ga0373924_0009742 | 3300035410 | Unclassified | 3528 |
| 269 | Ga0373931_0322530 | 3300035691 | Unclassified | 960 |
| 270 | Ga0373947_0421434 | 3300035725 | Unclassified | 902 |
| 271 | Ga0373937_0671411 | 3300036401 | Bacteria | 982 |
| 272 | Ga0373925_0011118 | 3300037068 | Bacteria | 6528 |
| 273 | Ga0451577_0123565 | 3300042876 | Bacteria | 2319 |
| 274 | Ga0451576_0008541 | 3300045051 | Bacteria | 12008 |
| 275 | Ga0451576_0073056 | 3300045051 | Unclassified | 3569 |
| 276 | Ga0451576_0086635 | 3300045051 | Unclassified | 3257 |
| 277 | Ga0451576_0147918 | 3300045051 | Bacteria | 2449 |
| 278 | Ga0451576_0197445 | 3300045051 | Bacteria | 2102 |
| 279 | Ga0495603_0034919 | 3300046455 | Bacteria | 3022 |
| 280 | Ga0495603_0073533 | 3300046455 | Unclassified | 2008 |
| 281 | Ga0495629_0029160 | 3300046459 | Bacteria | 3916 |
| 282 | Ga0495584_0068227 | 3300046491 | Bacteria | 1786 |
| 283 | Ga0495584_0167924 | 3300046491 | Unclassified | 1115 |
| 284 | Ga0495594_0004088 | 3300046499 | Bacteria | 7501 |
| 285 | Ga0495628_0048796 | 3300046516 | Unclassified | 3354 |
| 286 | Ga0495630_0097693 | 3300046517 | Unclassified | 2221 |
| 287 | Ga0495644_0083067 | 3300046523 | Bacteria | 1208 |
| 288 | Ga0495663_0006982 | 3300046525 | Unclassified | 3114 |
| 289 | Ga0495663_0076719 | 3300046525 | Bacteria | 1071 |
| 290 | Ga0495652_0039424 | 3300046529 | Unclassified | 4085 |
| 291 | Ga0495665_0127435 | 3300046531 | Unclassified | 1333 |
| 292 | Ga0495609_0036064 | 3300046538 | Bacteria | 2235 |
| 293 | Ga0495621_0004411 | 3300046539 | Bacteria | 3954 |
| 294 | Ga0495621_0042246 | 3300046539 | Bacteria | 1604 |
| 295 | Ga0495621_0076881 | 3300046539 | Bacteria | 1239 |
| 296 | Ga0495621_0111601 | 3300046539 | Bacteria | 1049 |
| 297 | Ga0495645_0051985 | 3300046543 | Unclassified | 2981 |
| 298 | Ga0495633_0122634 | 3300046558 | Unclassified | 1204 |
| 299 | Ga0495667_0025717 | 3300046559 | Unclassified | 3965 |
| 300 | Ga0495659_0001404 | 3300046664 | Bacteria | 8201 |
| 301 | Ga0495659_0008764 | 3300046664 | Unclassified | 3219 |
| 302 | Ga0495659_0011174 | 3300046664 | Unclassified | 2893 |
| 303 | Ga0495659_0015135 | 3300046664 | Bacteria | 2534 |
| 304 | Ga0495659_0015192 | 3300046664 | Unclassified | 2529 |
| 305 | Ga0495659_0028868 | 3300046664 | Bacteria | 1922 |
| 306 | Ga0495659_0043584 | 3300046664 | Unclassified | 1610 |
| 307 | Ga0495659_0070621 | 3300046664 | Bacteria | 1307 |
| 308 | Ga0495659_0099965 | 3300046664 | Unclassified | 1122 |
| 309 | Ga0495659_0147935 | 3300046664 | Unclassified | 941 |
| 310 | Ga0495588_0114745 | 3300046674 | Unclassified | 1419 |
| 311 | Ga0495658_0042609 | 3300046683 | Unclassified | 2535 |
| 312 | Ga0495658_0199825 | 3300046683 | Unclassified | 1246 |
| 313 | Ga0495669_0012920 | 3300046684 | Unclassified | 3556 |
| 314 | Ga0495613_0002397 | 3300046689 | Bacteria | 14191 |
| 315 | Ga0495636_0008735 | 3300047318 | Bacteria | 3993 |
| 316 | Ga0495676_0122926 | 3300047321 | Unclassified | 1885 |
| 317 | Ga0495675_0082135 | 3300047444 | Bacteria | 2029 |
| 318 | Ga0495685_052420 | 3300047447 | Bacteria | 1382 |
| 319 | Ga0495684_0000117 | 3300047471 | Bacteria | 57879 |
| 320 | Ga0496100_0001556 | 3300048903 | Bacteria | 11280 |
| 321 | Ga0496101_0000139 | 3300048904 | Bacteria | 63989 |
| 322 | Ga0496102_0144376 | 3300048905 | Unclassified | 2233 |
| 323 | Ga0496104_0032711 | 3300048907 | Bacteria | 4841 |
| 324 | Ga0496105_0037486 | 3300048908 | Unclassified | 3992 |
| 325 | Ga0496106_0189139 | 3300048909 | Unclassified | 1636 |
| 326 | Ga0496110_0520818 | 3300048913 | Bacteria | 1082 |
| 327 | Ga0496114_0000577 | 3300048917 | Bacteria | 27102 |
| 328 | Ga0496114_0220676 | 3300048917 | Unclassified | 1664 |
| 329 | nmdc:mga05p37_22946_c1 | 3300050507 | Bacteria | 5693 |
| 330 | nmdc:mga05p37_382458_c1 | 3300050507 | Bacteria | 1649 |
| 331 | nmdc:mga05p37_477061_c1 | 3300050507 | Bacteria | 1438 |
| 332 | nmdc:mga05p37_53448_c1 | 3300050507 | Bacteria | 4967 |
| 333 | nmdc:mga05p37_90802_c1 | 3300050507 | Unclassified | 3764 |
| 334 | nmdc:mga0qj67_149535_c1 | 3300050509 | Unclassified | 1894 |
| 335 | nmdc:mga08y16_703750_c1 | 3300050511 | Unclassified | 1010 |
| 336 | nmdc:mga08y16_724942_c1 | 3300050511 | Unclassified | 992 |
| 337 | nmdc:mga08y16_92247_c1 | 3300050511 | Bacteria | 3156 |
| 338 | nmdc:mga08y16_991_c1 | 3300050511 | Bacteria | 27687 |
| 339 | nmdc:mga0n895_133673_c1 | 3300050512 | Bacteria | 2507 |
| 340 | nmdc:mga0n895_45868_c1 | 3300050512 | Bacteria | 4267 |
| 341 | nmdc:mga0n895_6313_c1 | 3300050512 | Bacteria | 10051 |
| 342 | nmdc:mga0n895_7790_c1 | 3300050512 | Bacteria | 9229 |
| 343 | nmdc:mga0rr50_359200_c1 | 3300050513 | Unclassified | 1226 |
| 344 | nmdc:mga0rr50_370320_c1 | 3300050513 | Bacteria | 1207 |
| 345 | nmdc:mga0rr50_3761_c1 | 3300050513 | Bacteria | 5216 |
| 346 | nmdc:mga0rr50_42204_c1 | 3300050513 | Unclassified | 3329 |
| 347 | nmdc:mga0a205_225722_c1 | 3300050515 | Bacteria | 1758 |
| 348 | nmdc:mga0a205_263039_c1 | 3300050515 | Bacteria | 1603 |
| 349 | nmdc:mga0a205_4881_c1 | 3300050515 | Bacteria | 12065 |
| 350 | nmdc:mga0a205_540563_c1 | 3300050515 | Unclassified | 1021 |
| 351 | Ga0495619_0000356 | 3300053085 | Bacteria | 31805 |
| 352 | Ga0495619_0055534 | 3300053085 | Bacteria | 2623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025906 | Ga0207699_10381508 | Ga0207699_103815081 | 197 |
| 2 | 3300006173 | Ga0070716_100177854 | Ga0070716_1001778542 | 246 |
| 3 | 3300025939 | Ga0207665_10225078 | Ga0207665_102250781 | 246 |
| 4 | 3300013296 | Ga0157374_10616693 | Ga0157374_106166931 | 248 |
| 5 | 3300046491 | Ga0495584_0068227 | Ga0495584_0068227_100_855 | 250 |
| 6 | 3300046664 | Ga0495659_0070621 | Ga0495659_0070621_529_1284 | 250 |
| 7 | 3300050511 | nmdc:mga08y16_703750_c1 | nmdc:mga08y16_703750_c1_75_872 | 252 |
| 8 | 3300005445 | Ga0070708_100229157 | Ga0070708_1002291572 | 254 |
| 9 | 3300006844 | Ga0075428_100009105 | Ga0075428_1000091054 | 254 |
| 10 | 3300006844 | Ga0075428_100212064 | Ga0075428_1002120643 | 254 |
| 11 | 3300006852 | Ga0075433_10023077 | Ga0075433_100230773 | 254 |
| 12 | 3300006871 | Ga0075434_100023694 | Ga0075434_1000236944 | 254 |
| 13 | 3300006880 | Ga0075429_100363312 | Ga0075429_1003633122 | 254 |
| 14 | 3300007076 | Ga0075435_100016609 | Ga0075435_1000166093 | 254 |
| 15 | 3300009098 | Ga0105245_10042900 | Ga0105245_100429003 | 254 |
| 16 | 3300009101 | Ga0105247_10121705 | Ga0105247_101217052 | 254 |
| 17 | 3300009147 | Ga0114129_10557499 | Ga0114129_105574992 | 254 |
| 18 | 3300026089 | Ga0207648_10478196 | Ga0207648_104781962 | 254 |
| 19 | 3300035114 | Ga0373939_0144635 | Ga0373939_0144635_49_825 | 254 |
| 20 | 3300050511 | nmdc:mga08y16_92247_c1 | nmdc:mga08y16_92247_c1_2208_2990 | 254 |
| 21 | 3300050512 | nmdc:mga0n895_7790_c1 | nmdc:mga0n895_7790_c1_2995_3780 | 254 |
| 22 | 3300050513 | nmdc:mga0rr50_3761_c1 | nmdc:mga0rr50_3761_c1_882_1667 | 254 |
| 23 | 3300050515 | nmdc:mga0a205_4881_c1 | nmdc:mga0a205_4881_c1_8278_9063 | 254 |
| 24 | 3300013297 | Ga0157378_10254589 | Ga0157378_102545892 | 255 |
| 25 | 3300045051 | Ga0451576_0008541 | Ga0451576_0008541_11050_11832 | 255 |
| 26 | 3300005335 | Ga0070666_10125837 | Ga0070666_101258371 | 256 |
| 27 | 3300005842 | Ga0068858_100016310 | Ga0068858_1000163104 | 256 |
| 28 | 3300005842 | Ga0068858_100171961 | Ga0068858_1001719612 | 256 |
| 29 | 3300009101 | Ga0105247_10010889 | Ga0105247_100108893 | 256 |
| 30 | 3300009101 | Ga0105247_10127174 | Ga0105247_101271742 | 256 |
| 31 | 3300009177 | Ga0105248_10777455 | Ga0105248_107774552 | 256 |
| 32 | 3300013308 | Ga0157375_10404029 | Ga0157375_104040291 | 256 |
| 33 | 3300014325 | Ga0163163_10329599 | Ga0163163_103295992 | 256 |
| 34 | 3300014968 | Ga0157379_10044843 | Ga0157379_100448434 | 256 |
| 35 | 3300026035 | Ga0207703_10029890 | Ga0207703_100298902 | 256 |
| 36 | 3300026089 | Ga0207648_10258360 | Ga0207648_102583602 | 256 |
| 37 | 3300028379 | Ga0268266_10531940 | Ga0268266_105319402 | 256 |
| 38 | 3300035725 | Ga0373947_0421434 | Ga0373947_0421434_46_840 | 256 |
| 39 | 3300046499 | Ga0495594_0004088 | Ga0495594_0004088_5804_6622 | 256 |
| 40 | 3300046664 | Ga0495659_0015135 | Ga0495659_0015135_512_1330 | 256 |
| 41 | 3300048917 | Ga0496114_0220676 | Ga0496114_0220676_470_1264 | 256 |
| 42 | 3300050509 | nmdc:mga0qj67_149535_c1 | nmdc:mga0qj67_149535_c1_227_1036 | 256 |
| 43 | 3300005330 | Ga0070690_100168282 | Ga0070690_1001682822 | 257 |
| 44 | 3300005334 | Ga0068869_100057291 | Ga0068869_1000572913 | 257 |
| 45 | 3300005335 | Ga0070666_10031567 | Ga0070666_100315672 | 257 |
| 46 | 3300005355 | Ga0070671_100345260 | Ga0070671_1003452602 | 257 |
| 47 | 3300005356 | Ga0070674_100151470 | Ga0070674_1001514702 | 257 |
| 48 | 3300005441 | Ga0070700_100340041 | Ga0070700_1003400411 | 257 |
| 49 | 3300005456 | Ga0070678_100311859 | Ga0070678_1003118591 | 257 |
| 50 | 3300005548 | Ga0070665_100005462 | Ga0070665_1000054624 | 257 |
| 51 | 3300005617 | Ga0068859_100425234 | Ga0068859_1004252341 | 257 |
| 52 | 3300005843 | Ga0068860_100206552 | Ga0068860_1002065521 | 257 |
| 53 | 3300005844 | Ga0068862_100277897 | Ga0068862_1002778972 | 257 |
| 54 | 3300006163 | Ga0070715_10108650 | Ga0070715_101086502 | 257 |
| 55 | 3300006237 | Ga0097621_100072902 | Ga0097621_1000729022 | 257 |
| 56 | 3300006237 | Ga0097621_100614671 | Ga0097621_1006146711 | 257 |
| 57 | 3300006358 | Ga0068871_100011829 | Ga0068871_1000118296 | 257 |
| 58 | 3300006358 | Ga0068871_100023847 | Ga0068871_1000238472 | 257 |
| 59 | 3300006931 | Ga0097620_100425235 | Ga0097620_1004252351 | 257 |
| 60 | 3300009147 | Ga0114129_10063553 | Ga0114129_100635535 | 257 |
| 61 | 3300009148 | Ga0105243_10251286 | Ga0105243_102512862 | 257 |
| 62 | 3300009176 | Ga0105242_10046386 | Ga0105242_100463863 | 257 |
| 63 | 3300009176 | Ga0105242_10305617 | Ga0105242_103056172 | 257 |
| 64 | 3300013308 | Ga0157375_10164658 | Ga0157375_101646583 | 257 |
| 65 | 3300013308 | Ga0157375_10176513 | Ga0157375_101765132 | 257 |
| 66 | 3300014325 | Ga0163163_10226208 | Ga0163163_102262081 | 257 |
| 67 | 3300014745 | Ga0157377_10014466 | Ga0157377_100144662 | 257 |
| 68 | 3300014968 | Ga0157379_10147297 | Ga0157379_101472972 | 257 |
| 69 | 3300014968 | Ga0157379_10299751 | Ga0157379_102997511 | 257 |
| 70 | 3300014969 | Ga0157376_10014304 | Ga0157376_100143043 | 257 |
| 71 | 3300014969 | Ga0157376_10450623 | Ga0157376_104506232 | 257 |
| 72 | 3300017792 | Ga0163161_10123958 | Ga0163161_101239583 | 257 |
| 73 | 3300025903 | Ga0207680_10046425 | Ga0207680_100464252 | 257 |
| 74 | 3300025926 | Ga0207659_10403051 | Ga0207659_104030511 | 257 |
| 75 | 3300025927 | Ga0207687_10006034 | Ga0207687_100060345 | 257 |
| 76 | 3300025931 | Ga0207644_10121632 | Ga0207644_101216322 | 257 |
| 77 | 3300025934 | Ga0207686_10039322 | Ga0207686_100393223 | 257 |
| 78 | 3300025934 | Ga0207686_10086725 | Ga0207686_100867252 | 257 |
| 79 | 3300025937 | Ga0207669_10323696 | Ga0207669_103236962 | 257 |
| 80 | 3300025938 | Ga0207704_10019069 | Ga0207704_100190693 | 257 |
| 81 | 3300025942 | Ga0207689_10061369 | Ga0207689_100613692 | 257 |
| 82 | 3300026023 | Ga0207677_10416429 | Ga0207677_104164292 | 257 |
| 83 | 3300026075 | Ga0207708_10287852 | Ga0207708_102878522 | 257 |
| 84 | 3300026089 | Ga0207648_10055234 | Ga0207648_100552343 | 257 |
| 85 | 3300026121 | Ga0207683_10214928 | Ga0207683_102149283 | 257 |
| 86 | 3300028379 | Ga0268266_10069858 | Ga0268266_100698583 | 257 |
| 87 | 3300035120 | Ga0373957_0078047 | Ga0373957_0078047_13_813 | 257 |
| 88 | 3300036401 | Ga0373937_0671411 | Ga0373937_0671411_109_909 | 257 |
| 89 | 3300046539 | Ga0495621_0111601 | Ga0495621_0111601_95_886 | 257 |
| 90 | 3300046664 | Ga0495659_0028868 | Ga0495659_0028868_710_1507 | 257 |
| 91 | 3300048903 | Ga0496100_0001556 | Ga0496100_0001556_162_962 | 257 |
| 92 | 3300048904 | Ga0496101_0000139 | Ga0496101_0000139_23284_24084 | 257 |
| 93 | 3300048905 | Ga0496102_0144376 | Ga0496102_0144376_744_1544 | 257 |
| 94 | 3300048907 | Ga0496104_0032711 | Ga0496104_0032711_1247_2047 | 257 |
| 95 | 3300048908 | Ga0496105_0037486 | Ga0496105_0037486_1182_1982 | 257 |
| 96 | 3300048909 | Ga0496106_0189139 | Ga0496106_0189139_769_1569 | 257 |
| 97 | 3300048913 | Ga0496110_0520818 | Ga0496110_0520818_84_884 | 257 |
| 98 | 3300048917 | Ga0496114_0000577 | Ga0496114_0000577_11876_12676 | 257 |
| 99 | 3300050507 | nmdc:mga05p37_53448_c1 | nmdc:mga05p37_53448_c1_2894_3685 | 257 |
| 100 | 3300053085 | Ga0495619_0055534 | Ga0495619_0055534_692_1492 | 257 |
| 101 | 3300006871 | Ga0075434_100001407 | Ga0075434_10000140716 | 258 |
| 102 | 3300014326 | Ga0157380_10064918 | Ga0157380_100649182 | 258 |
| 103 | 3300050512 | nmdc:mga0n895_6313_c1 | nmdc:mga0n895_6313_c1_2442_3236 | 258 |
| 104 | 3300005295 | Ga0065707_10001687 | Ga0065707_100016876 | 259 |
| 105 | 3300005434 | Ga0070709_10012961 | Ga0070709_100129616 | 259 |
| 106 | 3300005436 | Ga0070713_100017296 | Ga0070713_1000172964 | 259 |
| 107 | 3300005439 | Ga0070711_100308814 | Ga0070711_1003088142 | 259 |
| 108 | 3300006028 | Ga0070717_10046021 | Ga0070717_100460213 | 259 |
| 109 | 3300011119 | Ga0105246_10129235 | Ga0105246_101292352 | 259 |
| 110 | 3300014745 | Ga0157377_10038489 | Ga0157377_100384894 | 259 |
| 111 | 3300025922 | Ga0207646_10572276 | Ga0207646_105722762 | 259 |
| 112 | 3300035121 | Ga0373960_0013230 | Ga0373960_0013230_537_1334 | 259 |
| 113 | 3300035691 | Ga0373931_0322530 | Ga0373931_0322530_82_879 | 259 |
| 114 | 3300045051 | Ga0451576_0197445 | Ga0451576_0197445_173_970 | 259 |
| 115 | 3300046664 | Ga0495659_0015192 | Ga0495659_0015192_1372_2169 | 259 |
| 116 | 3300046684 | Ga0495669_0012920 | Ga0495669_0012920_1599_2405 | 259 |
| 117 | 3300005440 | Ga0070705_100118719 | Ga0070705_1001187192 | 260 |
| 118 | 3300005441 | Ga0070700_100513082 | Ga0070700_1005130821 | 260 |
| 119 | 3300005467 | Ga0070706_100163619 | Ga0070706_1001636192 | 260 |
| 120 | 3300005545 | Ga0070695_100065079 | Ga0070695_1000650792 | 260 |
| 121 | 3300005546 | Ga0070696_100209893 | Ga0070696_1002098932 | 260 |
| 122 | 3300005549 | Ga0070704_100332394 | Ga0070704_1003323942 | 260 |
| 123 | 3300005549 | Ga0070704_100623253 | Ga0070704_1006232531 | 260 |
| 124 | 3300005937 | Ga0081455_10082630 | Ga0081455_100826302 | 260 |
| 125 | 3300025910 | Ga0207684_10476959 | Ga0207684_104769592 | 260 |
| 126 | 3300035089 | Ga0373944_0021371 | Ga0373944_0021371_921_1730 | 260 |
| 127 | 3300035116 | Ga0373945_0044971 | Ga0373945_0044971_502_1311 | 260 |
| 128 | 3300035118 | Ga0373954_0070222 | Ga0373954_0070222_399_1208 | 260 |
| 129 | 3300035170 | Ga0373943_0029160 | Ga0373943_0029160_1332_2141 | 260 |
| 130 | 3300035410 | Ga0373924_0009742 | Ga0373924_0009742_1456_2265 | 260 |
| 131 | 3300037068 | Ga0373925_0011118 | Ga0373925_0011118_3432_4241 | 260 |
| 132 | 3300046516 | Ga0495628_0048796 | Ga0495628_0048796_822_1631 | 260 |
| 133 | 3300046517 | Ga0495630_0097693 | Ga0495630_0097693_707_1516 | 260 |
| 134 | 3300046529 | Ga0495652_0039424 | Ga0495652_0039424_1682_2491 | 260 |
| 135 | 3300046531 | Ga0495665_0127435 | Ga0495665_0127435_469_1278 | 260 |
| 136 | 3300046543 | Ga0495645_0051985 | Ga0495645_0051985_1351_2160 | 260 |
| 137 | 3300046559 | Ga0495667_0025717 | Ga0495667_0025717_904_1713 | 260 |
| 138 | 3300046683 | Ga0495658_0199825 | Ga0495658_0199825_24_833 | 260 |
| 139 | 3300046689 | Ga0495613_0002397 | Ga0495613_0002397_3978_4787 | 260 |
| 140 | 3300047444 | Ga0495675_0082135 | Ga0495675_0082135_1186_1995 | 260 |
| 141 | 3300047471 | Ga0495684_0000117 | Ga0495684_0000117_7035_7844 | 260 |
| 142 | 3300053085 | Ga0495619_0000356 | Ga0495619_0000356_1885_2694 | 260 |
| 143 | 3300005330 | Ga0070690_100310249 | Ga0070690_1003102492 | 261 |
| 144 | 3300005336 | Ga0070680_100417301 | Ga0070680_1004173011 | 261 |
| 145 | 3300005338 | Ga0068868_100150216 | Ga0068868_1001502162 | 261 |
| 146 | 3300005340 | Ga0070689_100028152 | Ga0070689_1000281522 | 261 |
| 147 | 3300005340 | Ga0070689_100064730 | Ga0070689_1000647303 | 261 |
| 148 | 3300005343 | Ga0070687_100042844 | Ga0070687_1000428442 | 261 |
| 149 | 3300005345 | Ga0070692_10046679 | Ga0070692_100466792 | 261 |
| 150 | 3300005347 | Ga0070668_100018635 | Ga0070668_1000186354 | 261 |
| 151 | 3300005353 | Ga0070669_100001572 | Ga0070669_10000157211 | 261 |
| 152 | 3300005354 | Ga0070675_100016517 | Ga0070675_1000165171 | 261 |
| 153 | 3300005354 | Ga0070675_100061334 | Ga0070675_1000613344 | 261 |
| 154 | 3300005365 | Ga0070688_100011473 | Ga0070688_1000114732 | 261 |
| 155 | 3300005365 | Ga0070688_100017463 | Ga0070688_1000174635 | 261 |
| 156 | 3300005441 | Ga0070700_100074744 | Ga0070700_1000747443 | 261 |
| 157 | 3300005457 | Ga0070662_100182068 | Ga0070662_1001820682 | 261 |
| 158 | 3300005459 | Ga0068867_100112459 | Ga0068867_1001124592 | 261 |
| 159 | 3300005471 | Ga0070698_100170866 | Ga0070698_1001708662 | 261 |
| 160 | 3300005543 | Ga0070672_100010223 | Ga0070672_1000102233 | 261 |
| 161 | 3300005543 | Ga0070672_100081281 | Ga0070672_1000812814 | 261 |
| 162 | 3300005543 | Ga0070672_100156645 | Ga0070672_1001566452 | 261 |
| 163 | 3300005544 | Ga0070686_100153457 | Ga0070686_1001534572 | 261 |
| 164 | 3300005549 | Ga0070704_100000141 | Ga0070704_10000014112 | 261 |
| 165 | 3300005577 | Ga0068857_100038929 | Ga0068857_1000389292 | 261 |
| 166 | 3300005617 | Ga0068859_100025622 | Ga0068859_1000256221 | 261 |
| 167 | 3300005617 | Ga0068859_100049301 | Ga0068859_1000493012 | 261 |
| 168 | 3300005618 | Ga0068864_100177658 | Ga0068864_1001776582 | 261 |
| 169 | 3300005719 | Ga0068861_100001612 | Ga0068861_10000161210 | 261 |
| 170 | 3300005840 | Ga0068870_10000883 | Ga0068870_1000088313 | 261 |
| 171 | 3300005842 | Ga0068858_100036363 | Ga0068858_1000363632 | 261 |
| 172 | 3300005843 | Ga0068860_100137268 | Ga0068860_1001372682 | 261 |
| 173 | 3300005844 | Ga0068862_100000793 | Ga0068862_10000079313 | 261 |
| 174 | 3300006844 | Ga0075428_100231174 | Ga0075428_1002311742 | 261 |
| 175 | 3300006881 | Ga0068865_100260856 | Ga0068865_1002608562 | 261 |
| 176 | 3300006931 | Ga0097620_100025620 | Ga0097620_1000256205 | 261 |
| 177 | 3300006931 | Ga0097620_100049300 | Ga0097620_1000493005 | 261 |
| 178 | 3300007076 | Ga0075435_100044764 | Ga0075435_1000447642 | 261 |
| 179 | 3300009094 | Ga0111539_10020131 | Ga0111539_100201316 | 261 |
| 180 | 3300009098 | Ga0105245_10228470 | Ga0105245_102284702 | 261 |
| 181 | 3300009553 | Ga0105249_10016411 | Ga0105249_100164115 | 261 |
| 182 | 3300010375 | Ga0105239_10453522 | Ga0105239_104535222 | 261 |
| 183 | 3300013297 | Ga0157378_10639101 | Ga0157378_106391011 | 261 |
| 184 | 3300013306 | Ga0163162_10038637 | Ga0163162_100386373 | 261 |
| 185 | 3300013308 | Ga0157375_10043010 | Ga0157375_100430105 | 261 |
| 186 | 3300014326 | Ga0157380_10080860 | Ga0157380_100808602 | 261 |
| 187 | 3300025900 | Ga0207710_10111731 | Ga0207710_101117312 | 261 |
| 188 | 3300025908 | Ga0207643_10001498 | Ga0207643_100014982 | 261 |
| 189 | 3300025917 | Ga0207660_10340198 | Ga0207660_103401982 | 261 |
| 190 | 3300025918 | Ga0207662_10023467 | Ga0207662_100234672 | 261 |
| 191 | 3300025918 | Ga0207662_10055674 | Ga0207662_100556742 | 261 |
| 192 | 3300025923 | Ga0207681_10000184 | Ga0207681_1000018420 | 261 |
| 193 | 3300025933 | Ga0207706_10029585 | Ga0207706_100295852 | 261 |
| 194 | 3300025935 | Ga0207709_10150092 | Ga0207709_101500922 | 261 |
| 195 | 3300025936 | Ga0207670_10033824 | Ga0207670_100338242 | 261 |
| 196 | 3300025936 | Ga0207670_10051452 | Ga0207670_100514523 | 261 |
| 197 | 3300025940 | Ga0207691_10014750 | Ga0207691_100147508 | 261 |
| 198 | 3300025940 | Ga0207691_10080884 | Ga0207691_100808842 | 261 |
| 199 | 3300025940 | Ga0207691_10089305 | Ga0207691_100893053 | 261 |
| 200 | 3300025961 | Ga0207712_10065481 | Ga0207712_100654814 | 261 |
| 201 | 3300025972 | Ga0207668_10016572 | Ga0207668_100165722 | 261 |
| 202 | 3300026023 | Ga0207677_10170561 | Ga0207677_101705612 | 261 |
| 203 | 3300026075 | Ga0207708_10019505 | Ga0207708_100195055 | 261 |
| 204 | 3300026089 | Ga0207648_10002611 | Ga0207648_1000261111 | 261 |
| 205 | 3300026095 | Ga0207676_10033043 | Ga0207676_100330432 | 261 |
| 206 | 3300026116 | Ga0207674_10010264 | Ga0207674_100102642 | 261 |
| 207 | 3300026118 | Ga0207675_100002432 | Ga0207675_1000024325 | 261 |
| 208 | 3300026121 | Ga0207683_10141365 | Ga0207683_101413652 | 261 |
| 209 | 3300027907 | Ga0207428_10001435 | Ga0207428_100014355 | 261 |
| 210 | 3300028380 | Ga0268265_10000188 | Ga0268265_1000018851 | 261 |
| 211 | 3300046539 | Ga0495621_0004411 | Ga0495621_0004411_3052_3840 | 261 |
| 212 | 3300050511 | nmdc:mga08y16_991_c1 | nmdc:mga08y16_991_c1_16611_17414 | 261 |
| 213 | 3300050513 | nmdc:mga0rr50_42204_c1 | nmdc:mga0rr50_42204_c1_14_814 | 261 |
| 214 | 3300005536 | Ga0070697_100444869 | Ga0070697_1004448691 | 262 |
| 215 | 3300005546 | Ga0070696_100041750 | Ga0070696_1000417502 | 262 |
| 216 | 3300005618 | Ga0068864_100100242 | Ga0068864_1001002422 | 262 |
| 217 | 3300006871 | Ga0075434_100716403 | Ga0075434_1007164032 | 262 |
| 218 | 3300025922 | Ga0207646_10155953 | Ga0207646_101559532 | 262 |
| 219 | 3300026095 | Ga0207676_10067142 | Ga0207676_100671422 | 262 |
| 220 | 3300046455 | Ga0495603_0034919 | Ga0495603_0034919_1236_2045 | 262 |
| 221 | 3300046459 | Ga0495629_0029160 | Ga0495629_0029160_2634_3443 | 262 |
| 222 | 3300046664 | Ga0495659_0011174 | Ga0495659_0011174_1778_2584 | 262 |
| 223 | 3300046683 | Ga0495658_0042609 | Ga0495658_0042609_475_1284 | 262 |
| 224 | 3300047321 | Ga0495676_0122926 | Ga0495676_0122926_712_1521 | 262 |
| 225 | 3300050513 | nmdc:mga0rr50_370320_c1 | nmdc:mga0rr50_370320_c1_395_1183 | 262 |
| 226 | 3300005331 | Ga0070670_100753741 | Ga0070670_1007537411 | 263 |
| 227 | 3300005341 | Ga0070691_10083290 | Ga0070691_100832902 | 263 |
| 228 | 3300005345 | Ga0070692_10018307 | Ga0070692_100183074 | 263 |
| 229 | 3300005364 | Ga0070673_100278188 | Ga0070673_1002781882 | 263 |
| 230 | 3300005438 | Ga0070701_10054130 | Ga0070701_100541302 | 263 |
| 231 | 3300005438 | Ga0070701_10168369 | Ga0070701_101683692 | 263 |
| 232 | 3300005440 | Ga0070705_100000401 | Ga0070705_10000040120 | 263 |
| 233 | 3300005444 | Ga0070694_100001431 | Ga0070694_1000014318 | 263 |
| 234 | 3300005445 | Ga0070708_100309881 | Ga0070708_1003098811 | 263 |
| 235 | 3300005457 | Ga0070662_100254856 | Ga0070662_1002548562 | 263 |
| 236 | 3300005458 | Ga0070681_10008760 | Ga0070681_100087602 | 263 |
| 237 | 3300005467 | Ga0070706_100334141 | Ga0070706_1003341412 | 263 |
| 238 | 3300005468 | Ga0070707_100062318 | Ga0070707_1000623182 | 263 |
| 239 | 3300005518 | Ga0070699_100007592 | Ga0070699_1000075925 | 263 |
| 240 | 3300005530 | Ga0070679_100319438 | Ga0070679_1003194382 | 263 |
| 241 | 3300005545 | Ga0070695_100005835 | Ga0070695_1000058356 | 263 |
| 242 | 3300005545 | Ga0070695_100042257 | Ga0070695_1000422573 | 263 |
| 243 | 3300005546 | Ga0070696_100016928 | Ga0070696_1000169283 | 263 |
| 244 | 3300005546 | Ga0070696_100420167 | Ga0070696_1004201671 | 263 |
| 245 | 3300005549 | Ga0070704_100022170 | Ga0070704_1000221702 | 263 |
| 246 | 3300005615 | Ga0070702_100006682 | Ga0070702_1000066822 | 263 |
| 247 | 3300006852 | Ga0075433_10107423 | Ga0075433_101074232 | 263 |
| 248 | 3300006914 | Ga0075436_100353176 | Ga0075436_1003531761 | 263 |
| 249 | 3300009147 | Ga0114129_10002771 | Ga0114129_100027716 | 263 |
| 250 | 3300025912 | Ga0207707_10080618 | Ga0207707_100806182 | 263 |
| 251 | 3300025917 | Ga0207660_10047331 | Ga0207660_100473314 | 263 |
| 252 | 3300025921 | Ga0207652_10358791 | Ga0207652_103587912 | 263 |
| 253 | 3300025922 | Ga0207646_10068063 | Ga0207646_100680632 | 263 |
| 254 | 3300025922 | Ga0207646_10314868 | Ga0207646_103148682 | 263 |
| 255 | 3300025925 | Ga0207650_10145429 | Ga0207650_101454292 | 263 |
| 256 | 3300025933 | Ga0207706_10248175 | Ga0207706_102481752 | 263 |
| 257 | 3300045051 | Ga0451576_0073056 | Ga0451576_0073056_2615_3424 | 263 |
| 258 | 3300045051 | Ga0451576_0086635 | Ga0451576_0086635_256_1065 | 263 |
| 259 | 3300046523 | Ga0495644_0083067 | Ga0495644_0083067_12_806 | 263 |
| 260 | 3300046664 | Ga0495659_0043584 | Ga0495659_0043584_246_1187 | 263 |
| 261 | 3300046664 | Ga0495659_0147935 | Ga0495659_0147935_80_874 | 263 |
| 262 | 3300047318 | Ga0495636_0008735 | Ga0495636_0008735_2929_3723 | 263 |
| 263 | 3300050507 | nmdc:mga05p37_477061_c1 | nmdc:mga05p37_477061_c1_97_891 | 263 |
| 264 | 3300050515 | nmdc:mga0a205_263039_c1 | nmdc:mga0a205_263039_c1_550_1344 | 263 |
| 265 | 3300005444 | Ga0070694_100323492 | Ga0070694_1003234922 | 264 |
| 266 | 3300006871 | Ga0075434_100011654 | Ga0075434_10001165410 | 264 |
| 267 | 3300007076 | Ga0075435_100066551 | Ga0075435_1000665512 | 264 |
| 268 | 3300042876 | Ga0451577_0123565 | Ga0451577_0123565_1382_2179 | 264 |
| 269 | 3300045051 | Ga0451576_0147918 | Ga0451576_0147918_828_1625 | 264 |
| 270 | 3300046538 | Ga0495609_0036064 | Ga0495609_0036064_272_1066 | 264 |
| 271 | 3300046539 | Ga0495621_0076881 | Ga0495621_0076881_11_805 | 264 |
| 272 | 3300046664 | Ga0495659_0099965 | Ga0495659_0099965_267_1061 | 264 |
| 273 | 3300050512 | nmdc:mga0n895_45868_c1 | nmdc:mga0n895_45868_c1_2336_3133 | 264 |
| 274 | 3300004798 | Ga0058859_11636092 | Ga0058859_116360922 | 265 |
| 275 | 3300005331 | Ga0070670_100035611 | Ga0070670_1000356112 | 265 |
| 276 | 3300005334 | Ga0068869_100114098 | Ga0068869_1001140981 | 265 |
| 277 | 3300005336 | Ga0070680_100067623 | Ga0070680_1000676234 | 265 |
| 278 | 3300005340 | Ga0070689_100000911 | Ga0070689_10000091121 | 265 |
| 279 | 3300005340 | Ga0070689_100362598 | Ga0070689_1003625981 | 265 |
| 280 | 3300005354 | Ga0070675_100008111 | Ga0070675_1000081113 | 265 |
| 281 | 3300005355 | Ga0070671_100011036 | Ga0070671_1000110366 | 265 |
| 282 | 3300005365 | Ga0070688_100089896 | Ga0070688_1000898962 | 265 |
| 283 | 3300005438 | Ga0070701_10065310 | Ga0070701_100653102 | 265 |
| 284 | 3300005438 | Ga0070701_10124272 | Ga0070701_101242721 | 265 |
| 285 | 3300005440 | Ga0070705_100026915 | Ga0070705_1000269154 | 265 |
| 286 | 3300005444 | Ga0070694_100016370 | Ga0070694_1000163703 | 265 |
| 287 | 3300005467 | Ga0070706_100045183 | Ga0070706_1000451834 | 265 |
| 288 | 3300005471 | Ga0070698_100019867 | Ga0070698_1000198673 | 265 |
| 289 | 3300005518 | Ga0070699_100042672 | Ga0070699_1000426723 | 265 |
| 290 | 3300005535 | Ga0070684_100132062 | Ga0070684_1001320622 | 265 |
| 291 | 3300005543 | Ga0070672_100098191 | Ga0070672_1000981912 | 265 |
| 292 | 3300005564 | Ga0070664_100259686 | Ga0070664_1002596862 | 265 |
| 293 | 3300005564 | Ga0070664_100265363 | Ga0070664_1002653633 | 265 |
| 294 | 3300005577 | Ga0068857_100378150 | Ga0068857_1003781502 | 265 |
| 295 | 3300005617 | Ga0068859_100096125 | Ga0068859_1000961252 | 265 |
| 296 | 3300005617 | Ga0068859_100224307 | Ga0068859_1002243072 | 265 |
| 297 | 3300005842 | Ga0068858_100010481 | Ga0068858_1000104812 | 265 |
| 298 | 3300005843 | Ga0068860_100041226 | Ga0068860_1000412264 | 265 |
| 299 | 3300006237 | Ga0097621_100086201 | Ga0097621_1000862013 | 265 |
| 300 | 3300006237 | Ga0097621_100300385 | Ga0097621_1003003852 | 265 |
| 301 | 3300006358 | Ga0068871_100058172 | Ga0068871_1000581722 | 265 |
| 302 | 3300006844 | Ga0075428_100214021 | Ga0075428_1002140212 | 265 |
| 303 | 3300006852 | Ga0075433_10095005 | Ga0075433_100950053 | 265 |
| 304 | 3300006852 | Ga0075433_10488220 | Ga0075433_104882202 | 265 |
| 305 | 3300006871 | Ga0075434_100096561 | Ga0075434_1000965612 | 265 |
| 306 | 3300006881 | Ga0068865_100098615 | Ga0068865_1000986153 | 265 |
| 307 | 3300006931 | Ga0097620_100096138 | Ga0097620_1000961382 | 265 |
| 308 | 3300006931 | Ga0097620_100224320 | Ga0097620_1002243202 | 265 |
| 309 | 3300007076 | Ga0075435_100076084 | Ga0075435_1000760842 | 265 |
| 310 | 3300009094 | Ga0111539_10555063 | Ga0111539_105550631 | 265 |
| 311 | 3300009147 | Ga0114129_10313311 | Ga0114129_103133113 | 265 |
| 312 | 3300009148 | Ga0105243_10252534 | Ga0105243_102525343 | 265 |
| 313 | 3300009553 | Ga0105249_10005533 | Ga0105249_100055334 | 265 |
| 314 | 3300013306 | Ga0163162_10036273 | Ga0163162_100362731 | 265 |
| 315 | 3300014326 | Ga0157380_10230602 | Ga0157380_102306022 | 265 |
| 316 | 3300014745 | Ga0157377_10233565 | Ga0157377_102335652 | 265 |
| 317 | 3300014968 | Ga0157379_10317548 | Ga0157379_103175482 | 265 |
| 318 | 3300014969 | Ga0157376_10207008 | Ga0157376_102070082 | 265 |
| 319 | 3300025917 | Ga0207660_10033842 | Ga0207660_100338422 | 265 |
| 320 | 3300025918 | Ga0207662_10080835 | Ga0207662_100808351 | 265 |
| 321 | 3300025922 | Ga0207646_10310795 | Ga0207646_103107951 | 265 |
| 322 | 3300025925 | Ga0207650_10291129 | Ga0207650_102911292 | 265 |
| 323 | 3300025935 | Ga0207709_10318895 | Ga0207709_103188951 | 265 |
| 324 | 3300025936 | Ga0207670_10226929 | Ga0207670_102269292 | 265 |
| 325 | 3300025937 | Ga0207669_10231388 | Ga0207669_102313881 | 265 |
| 326 | 3300025938 | Ga0207704_10068456 | Ga0207704_100684561 | 265 |
| 327 | 3300025940 | Ga0207691_10115395 | Ga0207691_101153952 | 265 |
| 328 | 3300025941 | Ga0207711_10519450 | Ga0207711_105194502 | 265 |
| 329 | 3300025942 | Ga0207689_10648551 | Ga0207689_106485511 | 265 |
| 330 | 3300025945 | Ga0207679_10160925 | Ga0207679_101609252 | 265 |
| 331 | 3300025986 | Ga0207658_10414118 | Ga0207658_104141181 | 265 |
| 332 | 3300026035 | Ga0207703_10081395 | Ga0207703_100813952 | 265 |
| 333 | 3300026118 | Ga0207675_100044139 | Ga0207675_1000441394 | 265 |
| 334 | 3300028381 | Ga0268264_10014019 | Ga0268264_100140192 | 265 |
| 335 | 3300046455 | Ga0495603_0073533 | Ga0495603_0073533_159_956 | 265 |
| 336 | 3300046491 | Ga0495584_0167924 | Ga0495584_0167924_111_908 | 265 |
| 337 | 3300046525 | Ga0495663_0006982 | Ga0495663_0006982_815_1612 | 265 |
| 338 | 3300046525 | Ga0495663_0076719 | Ga0495663_0076719_215_1012 | 265 |
| 339 | 3300046539 | Ga0495621_0042246 | Ga0495621_0042246_684_1481 | 265 |
| 340 | 3300046558 | Ga0495633_0122634 | Ga0495633_0122634_26_823 | 265 |
| 341 | 3300046664 | Ga0495659_0001404 | Ga0495659_0001404_2578_3375 | 265 |
| 342 | 3300046664 | Ga0495659_0008764 | Ga0495659_0008764_1474_2271 | 265 |
| 343 | 3300046674 | Ga0495588_0114745 | Ga0495588_0114745_208_1005 | 265 |
| 344 | 3300047447 | Ga0495685_052420 | Ga0495685_052420_34_831 | 265 |
| 345 | 3300050507 | nmdc:mga05p37_22946_c1 | nmdc:mga05p37_22946_c1_3266_4066 | 265 |
| 346 | 3300050507 | nmdc:mga05p37_382458_c1 | nmdc:mga05p37_382458_c1_470_1267 | 265 |
| 347 | 3300050507 | nmdc:mga05p37_90802_c1 | nmdc:mga05p37_90802_c1_2124_3005 | 265 |
| 348 | 3300050511 | nmdc:mga08y16_724942_c1 | nmdc:mga08y16_724942_c1_87_884 | 265 |
| 349 | 3300050512 | nmdc:mga0n895_133673_c1 | nmdc:mga0n895_133673_c1_1517_2398 | 265 |
| 350 | 3300050513 | nmdc:mga0rr50_359200_c1 | nmdc:mga0rr50_359200_c1_232_1029 | 265 |
| 351 | 3300050515 | nmdc:mga0a205_225722_c1 | nmdc:mga0a205_225722_c1_557_1354 | 265 |
| 352 | 3300050515 | nmdc:mga0a205_540563_c1 | nmdc:mga0a205_540563_c1_170_967 | 265 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cn1-assembly4.cif.gz_D | crystal structure of yeast gga1_gae domain-p21 | 0.7525 | 194 | 216 |
| 6xux-assembly1.cif.gz_A | crystal structure of megabody mb-nb207-cygjk_no | 0.7369 | 168 | 216 |
| 7ubx-assembly1.cif.gz_A | structure of a pore forming fragment of clostridium difficile toxin a in complex with vhh aa6 | 0.6866 | 158 | 183 |
| 3wje-assembly1.cif.gz_A | crystal structure of mutant nitrobindin m75w/h76l/q96c/m148l/h158l (nb6) from arabidopsis thaliana | 0.6585 | 160 | 225 |
| 5o4z-assembly1.cif.gz_A | structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa | 0.6456 | 158 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7XTY9_163_289_2.60.40.200 | Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain | 0.7966 | 194 | 216 | 2.60.40.200 |
| 2czrA01 | Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1;TBP-interacting protein, N-terminal domain | 0.7878 | 119 | 149 | 3.40.1350.70 |
| af_Q54XZ0_160_288_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.7238 | 188 | 236 | 3.10.129.10 |
| af_Q869W9_940_1212_3.10.129.110 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase | 0.6897 | 194 | 238 | 3.10.129.110 |
| af_P21893_327_456_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.6728 | 158 | 176 | 3.10.310.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8Y1Z9-F1-model_v4 | Uncharacterized protein | 0.9218 | 119 | 238 |
|
| AF-A0A2V8IWV6-F1-model_v4 | Uncharacterized protein | 0.9137 | 119 | 243 |
|
| AF-A0A2V8XMB4-F1-model_v4 | Uncharacterized protein | 0.9094 | 119 | 243 |
|
| AF-A0A2V8ID39-F1-model_v4 | Uncharacterized protein | 0.8914 | 118 | 250 |
|
| AF-A0A1F2S5M9-F1-model_v4 | Uncharacterized protein | 0.8858 | 119 | 248 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar