F419127

General Info

Members Datasets Scaffolds Average Seq Length
352 198 704 325

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_000175|Ga0495627_000175_37788_38828
Length 346
Sequence MREAPVSLTPRDFAESVAHKAFAAMAVGWLLAVAPVFAAPQPELTLLSEHPVDGMVGGNLSGLAVCNGQLWAISDRDDNILYRMDTAQTALQAHPVAIDVPPAPESDLPVNLRSLAKLSSFVRGGSLDFEGISCDAQGNKYVVSEAHAEVLKVPVDGAPVWLKLPAELVAQARAQGMLQHFNAIFEGLAVSPQGDRLWLAAERDQRGLLVVSLDKDAWRCKGSCVLRTEPGKEVLPPQVGGQSVSRDFADLSLFNGKLYTLERSAYRLCRRTLETGKTEQCWSFAKEALKPSRLYDQRFGLTEALVVDETGAWLGVDNNFGERADGEKRPIVWRFAAPAGGWGVSQ

Samples

Sample ID Description Type Environment
1 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
32 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
33 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
34 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
35 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
36 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
37 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
38 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
44 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
45 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
46 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
47 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
48 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
49 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
50 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
51 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
52 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
53 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
54 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
55 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
56 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
57 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
58 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
59 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
60 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
73 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
74 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
109 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
132 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
133 2511231006 Pseudomonas sp. GM17 Isolate Nodule
134 2511231018 Pseudomonas sp. GM60 Isolate Nodule
135 2511231019 Pseudomonas sp. GM67 Isolate Nodule
136 2511231020 Pseudomonas sp. GM74 Isolate Nodule
137 2511231021 Pseudomonas sp. GM78 Isolate Nodule
138 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
139 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
140 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
141 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
142 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
143 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
144 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
145 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
146 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
147 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
148 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
149 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
150 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
151 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
152 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
153 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
154 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
155 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
156 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
157 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
158 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
159 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
160 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
161 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
162 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
163 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
164 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
165 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
166 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
167 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
168 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
169 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
170 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
171 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
172 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
173 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
174 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
175 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
176 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
177 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
178 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
179 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
180 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
181 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
182 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
183 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
184 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
185 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
186 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
187 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
188 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
189 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
190 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
191 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
192 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
193 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
194 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
195 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
196 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
197 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
198 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.25
Metatranscriptomes 0
Isolates 18.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 1.99
Rhizoplane 5.11
Rhizosphere 76.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495627_000175 3300046453 Bacteria 72658
2 MRS1b_contig_7023920 2162886011 Bacteria 1667
3 Ga0055536_1000236 3300003781 Bacteria 44432
4 Ga0055530_10000613 3300003791 Bacteria 30974
5 Ga0065714_10002845 3300005288 Bacteria 15187
6 Ga0065714_10012738 3300005288 Bacteria 2074
7 Ga0065714_10074178 3300005288 Bacteria 3074
8 Ga0065712_10067752 3300005290 Bacteria 56880
9 Ga0070670_100068751 3300005331 Bacteria 3040
10 Ga0070665_100262865 3300005548 Bacteria 1727
11 Ga0075364_10134371 3300006051 Bacteria 1661
12 Ga0079104_1000674 3300006946 Bacteria 31878
13 Ga0105251_10000104 3300009011 Bacteria 83894
14 Ga0105251_10000451 3300009011 Bacteria 39602
15 Ga0105251_10019215 3300009011 Bacteria 3615
16 Ga0105251_10043680 3300009011 Bacteria 2169
17 Ga0105251_10047094 3300009011 Bacteria 2073
18 Ga0105244_10000133 3300009036 Bacteria 76114
19 Ga0105244_10009150 3300009036 Bacteria 6112
20 Ga0105244_10045659 3300009036 Bacteria 2253
21 Ga0105244_10088615 3300009036 Bacteria 1524
22 Ga0105250_10000361 3300009092 Bacteria 34547
23 Ga0105250_10041389 3300009092 Bacteria 1847
24 Ga0105246_10001162 3300011119 Bacteria 15286
25 Ga0157373_10089733 3300013100 Bacteria 2165
26 Ga0157373_10138134 3300013100 Bacteria 1714
27 Ga0157371_10000233 3300013102 Bacteria 79696
28 Ga0157372_10005864 3300013307 Bacteria 13075
29 Ga0182008_10050194 3300014497 Bacteria 2071
30 Ga0182008_10068511 3300014497 Bacteria 1746
31 Ga0182008_10152353 3300014497 Bacteria 1160
32 Ga0182006_1018062 3300015261 Bacteria 2986
33 Ga0182007_10036090 3300015262 Bacteria 1664
34 Ga0182005_1026700 3300015265 Bacteria 1575
35 Ga0163161_10301465 3300017792 Bacteria 1262
36 Ga0207696_1000217 3300025711 Bacteria 83568
37 Ga0207655_1000014 3300025728 Bacteria 607124
38 Ga0207655_1000867 3300025728 Bacteria 32135
39 Ga0207655_1004225 3300025728 Bacteria 10291
40 Ga0207655_1024833 3300025728 Bacteria 2926
41 Ga0207713_1000031 3300025735 Bacteria 283971
42 Ga0207713_1000197 3300025735 Bacteria 83940
43 Ga0207713_1018592 3300025735 Bacteria 3435
44 Ga0209984_1003256 3300027424 Bacteria 1853
45 Ga0209995_1002635 3300027471 Bacteria 2841
46 Ga0209983_1001939 3300027665 Bacteria 4588
47 Ga0268266_10284162 3300028379 Bacteria 1539
48 Ga0307517_10096613 3300028786 Bacteria 2365
49 Ga0307511_10033012 3300030521 Bacteria 4582
50 Ga0316177_1202404 3300030731 Bacteria 3957
51 Ga0316183_1137429 3300030742 Bacteria 3663
52 Ga0316181_1068006 3300030744 Bacteria 6457
53 Ga0307408_100166841 3300031548 Bacteria 1754
54 Ga0307405_10110758 3300031731 Bacteria 1859
55 Ga0307405_10125899 3300031731 Bacteria 1761
56 Ga0307405_10146743 3300031731 Bacteria 1653
57 Ga0307406_10121756 3300031901 Bacteria 1815
58 Ga0307407_10113002 3300031903 Bacteria 1708
59 Ga0307412_10040555 3300031911 Bacteria 3012
60 Ga0307412_10170302 3300031911 Bacteria 1627
61 Ga0307416_100383617 3300032002 Bacteria 1436
62 Ga0307414_10035164 3300032004 Bacteria 3331
63 Ga0307411_10275885 3300032005 Bacteria 1335
64 Ga0439438_022473 3300041405 Bacteria 1748
65 Ga0439438_026764 3300041405 Bacteria 1561
66 Ga0439447_002310 3300041407 Bacteria 6979
67 Ga0439466_0002649 3300041411 Bacteria 6995
68 Ga0439466_0023715 3300041411 Bacteria 2156
69 Ga0439466_0026358 3300041411 Bacteria 2022
70 Ga0439432_015552 3300042006 Bacteria 2566
71 Ga0439432_048687 3300042006 Bacteria 1326
72 Ga0439456_000398 3300042013 Bacteria 9734
73 Ga0439456_007281 3300042013 Bacteria 2267
74 Ga0439456_013370 3300042013 Bacteria 1707
75 Ga0439463_000024 3300042016 Bacteria 33011
76 Ga0439463_001205 3300042016 Bacteria 6906
77 Ga0439463_018345 3300042016 Bacteria 1741
78 Ga0450891_001869 3300042129 Bacteria 2162
79 Ga0450903_008990 3300042138 Bacteria 1631
80 Ga0450904_002631 3300042139 Bacteria 2081
81 Ga0450905_008338 3300042142 Bacteria 1418
82 Ga0450907_000124 3300042146 Bacteria 29178
83 Ga0439446_0010629 3300042156 Bacteria 2483
84 Ga0450909_017761 3300042185 Bacteria 1054
85 Ga0439434_0001360 3300042435 Bacteria 7043
86 Ga0439460_0014234 3300042461 Bacteria 2089
87 Ga0450901_001775 3300042533 Bacteria 2420
88 Ga0439440_0006947 3300042993 Bacteria 2290
89 Ga0439440_0007972 3300042993 Bacteria 2163
90 Ga0495617_064913 3300046452 Bacteria 1204
91 Ga0495627_011911 3300046453 Bacteria 3101
92 Ga0495627_022586 3300046453 Bacteria 2068
93 Ga0495592_0152249 3300046454 Bacteria 1598
94 Ga0495591_000161 3300046458 Bacteria 71199
95 Ga0495591_005579 3300046458 Bacteria 5783
96 Ga0495591_006363 3300046458 Bacteria 5237
97 Ga0495591_009985 3300046458 Bacteria 3723
98 Ga0495591_010205 3300046458 Bacteria 3658
99 Ga0495591_019599 3300046458 Bacteria 2258
100 Ga0495638_0045227 3300046460 Bacteria 2770
101 Ga0495653_0024884 3300046463 Bacteria 4817
102 Ga0495650_0000626 3300046471 Bacteria 47586
103 Ga0495650_0009255 3300046471 Bacteria 5628
104 Ga0495650_0028194 3300046471 Bacteria 2582
105 Ga0495650_0031212 3300046471 Bacteria 2401
106 Ga0495605_0000062 3300046474 Bacteria 143176
107 Ga0495605_0000388 3300046474 Bacteria 40603
108 Ga0495605_0000507 3300046474 Bacteria 33437
109 Ga0495605_0001585 3300046474 Bacteria 14736
110 Ga0495605_0011668 3300046474 Bacteria 4889
111 Ga0495605_0044954 3300046474 Bacteria 2180
112 Ga0495605_0066514 3300046474 Bacteria 1712
113 Ga0495605_0070223 3300046474 Bacteria 1657
114 Ga0495605_0082227 3300046474 Bacteria 1505
115 Ga0495584_0000577 3300046491 Bacteria 24773
116 Ga0495585_0000557 3300046492 Bacteria 35226
117 Ga0495594_0003276 3300046499 Bacteria 8381
118 Ga0495596_0023163 3300046500 Bacteria 2521
119 Ga0495596_0057383 3300046500 Bacteria 1519
120 Ga0495607_0000534 3300046501 Bacteria 37333
121 Ga0495607_0000578 3300046501 Bacteria 35660
122 Ga0495607_0000620 3300046501 Bacteria 34430
123 Ga0495607_0000732 3300046501 Bacteria 31512
124 Ga0495607_0008047 3300046501 Bacteria 7239
125 Ga0495607_0021909 3300046501 Bacteria 4019
126 Ga0495607_0025325 3300046501 Bacteria 3691
127 Ga0495607_0033400 3300046501 Bacteria 3130
128 Ga0495607_0041558 3300046501 Bacteria 2730
129 Ga0495607_0051532 3300046501 Bacteria 2389
130 Ga0495607_0082324 3300046501 Bacteria 1766
131 Ga0495607_0091896 3300046501 Bacteria 1643
132 Ga0495583_0000015 3300046506 Bacteria 316392
133 Ga0495583_0000899 3300046506 Bacteria 35446
134 Ga0495583_0005349 3300046506 Bacteria 8751
135 Ga0495583_0050567 3300046506 Bacteria 1898
136 Ga0495583_0062169 3300046506 Bacteria 1663
137 Ga0495606_0000352 3300046507 Bacteria 78743
138 Ga0495606_0001099 3300046507 Bacteria 38715
139 Ga0495606_0034675 3300046507 Bacteria 3461
140 Ga0495606_0110981 3300046507 Bacteria 1654
141 Ga0495610_0003012 3300046512 Bacteria 13513
142 Ga0495610_0052518 3300046512 Bacteria 1978
143 Ga0495610_0121134 3300046512 Bacteria 1146
144 Ga0495616_0021933 3300046513 Bacteria 3452
145 Ga0495616_0071807 3300046513 Bacteria 1672
146 Ga0495616_0078158 3300046513 Bacteria 1587
147 Ga0495620_0000050 3300046515 Bacteria 105651
148 Ga0495620_0004494 3300046515 Bacteria 7847
149 Ga0495620_0028010 3300046515 Bacteria 2626
150 Ga0495620_0056884 3300046515 Bacteria 1643
151 Ga0495631_0011798 3300046518 Bacteria 4285
152 Ga0495631_0020217 3300046518 Bacteria 3113
153 Ga0495631_0021649 3300046518 Bacteria 2993
154 Ga0495631_0040057 3300046518 Bacteria 2076
155 Ga0495632_0004504 3300046519 Bacteria 9442
156 Ga0495632_0023250 3300046519 Bacteria 3312
157 Ga0495632_0031569 3300046519 Bacteria 2736
158 Ga0495637_0000020 3300046520 Bacteria 181611
159 Ga0495637_0001123 3300046520 Bacteria 16388
160 Ga0495637_0034687 3300046520 Bacteria 2207
161 Ga0495637_0041421 3300046520 Bacteria 1975
162 Ga0495637_0066832 3300046520 Bacteria 1460
163 Ga0495643_0024246 3300046522 Bacteria 3443
164 Ga0495643_0039993 3300046522 Bacteria 2562
165 Ga0495644_0010727 3300046523 Bacteria 3530
166 Ga0495648_0002060 3300046524 Bacteria 19023
167 Ga0495648_0009495 3300046524 Bacteria 7524
168 Ga0495648_0026934 3300046524 Bacteria 3858
169 Ga0495666_0150694 3300046526 Bacteria 1081
170 Ga0495654_0001205 3300046530 Bacteria 18406
171 Ga0495654_0003950 3300046530 Bacteria 8947
172 Ga0495654_0004366 3300046530 Bacteria 8414
173 Ga0495654_0019233 3300046530 Bacteria 3573
174 Ga0495654_0072689 3300046530 Bacteria 1627
175 Ga0495609_0000165 3300046538 Bacteria 69573
176 Ga0495609_0000264 3300046538 Bacteria 49333
177 Ga0495609_0000290 3300046538 Bacteria 46264
178 Ga0495609_0019466 3300046538 Bacteria 3141
179 Ga0495609_0057333 3300046538 Bacteria 1724
180 Ga0495597_0000124 3300046542 Bacteria 69872
181 Ga0495597_0005387 3300046542 Bacteria 6782
182 Ga0495597_0040570 3300046542 Bacteria 2080
183 Ga0495597_0061809 3300046542 Bacteria 1631
184 Ga0495645_0250217 3300046543 Bacteria 1178
185 Ga0495622_0071392 3300046557 Bacteria 1602
186 Ga0495622_0161168 3300046557 Bacteria 1011
187 Ga0495633_0000084 3300046558 Bacteria 124972
188 Ga0495668_0007486 3300046616 Bacteria 6972
189 Ga0495668_0049213 3300046616 Bacteria 2337
190 Ga0495668_0066349 3300046616 Bacteria 1986
191 Ga0495668_0124685 3300046616 Bacteria 1409
192 Ga0495634_0094098 3300046642 Bacteria 1942
193 Ga0495611_0004467 3300046648 Bacteria 6055
194 Ga0495611_0037491 3300046648 Bacteria 2154
195 Ga0495611_0153630 3300046648 Bacteria 1074
196 Ga0495625_0000133 3300046660 Bacteria 115381
197 Ga0495625_0104542 3300046660 Bacteria 1941
198 Ga0495661_0000065 3300046665 Bacteria 129298
199 Ga0495661_0000370 3300046665 Bacteria 48701
200 Ga0495661_0000387 3300046665 Bacteria 47232
201 Ga0495661_0080911 3300046665 Bacteria 1873
202 Ga0495661_0081303 3300046665 Bacteria 1867
203 Ga0495646_0016248 3300046680 Bacteria 4724
204 Ga0495613_0053953 3300046689 Bacteria 2955
205 Ga0495624_0017341 3300046690 Bacteria 4835
206 Ga0495670_0005711 3300046691 Bacteria 6101
207 Ga0495670_0080702 3300046691 Bacteria 1657
208 Ga0495671_0011798 3300046692 Bacteria 4790
209 Ga0495671_0049424 3300046692 Bacteria 2096
210 Ga0495671_0055645 3300046692 Bacteria 1959
211 Ga0495649_0122587 3300046694 Bacteria 1374
212 Ga0495649_0178647 3300046694 Bacteria 1108
213 Ga0495589_0001973 3300046794 Bacteria 11611
214 Ga0495660_0000430 3300046810 Bacteria 35274
215 Ga0495660_0003627 3300046810 Bacteria 9504
216 Ga0495660_0025369 3300046810 Bacteria 3367
217 Ga0495660_0061691 3300046810 Bacteria 2011
218 Ga0495660_0078336 3300046810 Bacteria 1737
219 Ga0495672_0017277 3300047320 Bacteria 4829
220 Ga0495672_0039260 3300047320 Bacteria 2879
221 Ga0495672_0039926 3300047320 Bacteria 2850
222 Ga0495672_0071970 3300047320 Bacteria 1954
223 Ga0495672_0074919 3300047320 Bacteria 1904
224 Ga0495672_0084040 3300047320 Bacteria 1766
225 Ga0495676_0000202 3300047321 Bacteria 46973
226 Ga0495676_0017971 3300047321 Bacteria 6240
227 Ga0495680_0215805 3300047322 Bacteria 1371
228 Ga0495683_0000109 3300047323 Bacteria 84488
229 Ga0495675_0160777 3300047444 Bacteria 1383
230 Ga0495679_000643 3300047446 Bacteria 23429
231 Ga0495679_000997 3300047446 Bacteria 17427
232 Ga0495673_0010555 3300047469 Bacteria 5013
233 Ga0495673_0020515 3300047469 Bacteria 3287
234 Ga0495673_0020663 3300047469 Bacteria 3274
235 Ga0495673_0022687 3300047469 Bacteria 3071
236 Ga0495673_0040037 3300047469 Bacteria 2121
237 Ga0495673_0056232 3300047469 Bacteria 1703
238 Ga0495673_0068629 3300047469 Bacteria 1497
239 Ga0495681_0007827 3300047470 Bacteria 6766
240 Ga0495681_0016374 3300047470 Bacteria 4157
241 Ga0495681_0030365 3300047470 Bacteria 2752
242 Ga0495681_0083069 3300047470 Bacteria 1426
243 Ga0495684_0308618 3300047471 Bacteria 1134
244 Ga0495686_0059782 3300047472 Bacteria 2371
245 Ga0495686_0087385 3300047472 Bacteria 1896
246 Ga0495593_0021210 3300047673 Bacteria 3631
247 Ga0495602_0030647 3300048088 Bacteria 5098
248 Ga0495626_0000371 3300048091 Bacteria 46963
249 Ga0496102_0151353 3300048905 Bacteria 2180
250 Ga0496116_0000567 3300048919 Bacteria 49501
251 Ga0496116_0049029 3300048919 Bacteria 2828
252 Ga0496117_0005023 3300048920 Bacteria 14183
253 Ga0496117_0086225 3300048920 Bacteria 2041
254 Ga0496118_0097296 3300048921 Bacteria 2003
255 Ga0496118_0110524 3300048921 Bacteria 1825
256 Ga0496118_0121122 3300048921 Bacteria 1705
257 Ga0496118_0125477 3300048921 Bacteria 1662
258 Ga0496118_0140289 3300048921 Bacteria 1533
259 Ga0496119_0000448 3300048922 Bacteria 56340
260 Ga0496120_0011575 3300048923 Bacteria 6059
261 Ga0496121_0002566 3300048924 Bacteria 27498
262 Ga0496121_0019527 3300048924 Bacteria 6768
263 Ga0496122_0007075 3300048925 Bacteria 12602
264 Ga0496122_0013010 3300048925 Bacteria 8201
265 Ga0496122_0098023 3300048925 Bacteria 1970
266 Ga0496122_0154661 3300048925 Bacteria 1409
267 Ga0496123_0000921 3300048926 Bacteria 46120
268 Ga0496123_0007596 3300048926 Bacteria 10156
269 Ga0496123_0058117 3300048926 Bacteria 2512
270 Ga0496123_0069072 3300048926 Bacteria 2221
271 Ga0496124_0000819 3300048927 Bacteria 50577
272 Ga0496124_0008908 3300048927 Bacteria 10401
273 Ga0496124_0059470 3300048927 Bacteria 3210
274 Ga0496124_0114283 3300048927 Bacteria 2168
275 Ga0496125_0014953 3300048928 Bacteria 7536
276 Ga0496125_0052637 3300048928 Bacteria 3346
277 Ga0495678_000017 3300049459 Bacteria 282592
278 Ga0495678_007238 3300049459 Bacteria 5780
279 Ga0495678_012788 3300049459 Bacteria 3964
280 Ga0495678_041403 3300049459 Bacteria 1843
281 Ga0495682_0000335 3300049460 Bacteria 34883
282 Ga0495682_0001724 3300049460 Bacteria 11092
283 Ga0501222_008776 3300049662 Bacteria 1340
284 nmdc:mga00v17_383583_c1 3300050491 Bacteria 913
285 Ga0500573_0068504 3300053140 Bacteria 2026
286 Ga0500586_048298 3300053145 Bacteria 1463
287 2511263372 2511231006 Bacteria 6794709
288 2511337835 2511231018 Bacteria 6436256
289 2511344597 2511231019 Bacteria 6520662
290 2511349177 2511231020 Bacteria 6115223
291 2511358646 2511231021 Bacteria 7302637
292 2555667494 2554235341 Bacteria 6867980
293 2597855723 2597489887 Bacteria 6666321
294 2597861730 2597489888 Bacteria 6179543
295 2597867455 2597489889 Bacteria 6297495
296 2599327300 2599185155 Bacteria 5827168
297 2599485625 2599185185 Bacteria 6652270
298 2599806755 2599185257 Bacteria 6492581
299 2599944650 2599185302 Bacteria 5954930
300 2599957603 2599185304 Bacteria 5951361
301 2599973028 2599185307 Bacteria 6194719
302 2599983226 2599185309 Bacteria 5969593
303 2599991608 2599185310 Bacteria 6014457
304 2599994771 2599185311 Bacteria 6354990
305 2600000969 2599185312 Bacteria 5912071
306 2600027276 2599185316 Bacteria 6320029
307 2600036788 2599185318 Bacteria 6961590
308 2600048229 2599185320 Bacteria 5963263
309 2600077740 2599185325 Bacteria 6324919
310 2600364817 2600254931 Bacteria 6734225
311 2601627114 2600255283 Bacteria 6061572
312 2621302116 2619619299 Bacteria 6649820
313 2643841056 2643221565 Bacteria 6216018
314 2643872555 2643221571 Bacteria 6228673
315 2671772406 2671180172 Bacteria 6495783
316 2678261065 2675903515 Bacteria 6580491
317 2738674149 2738541265 Bacteria 6594665
318 2738687515 2738541271 Bacteria 5657310
319 2738752542 2738541282 Bacteria 6593925
320 2738861583 2738541303 Bacteria 6591772
321 2739263136 2738543016 Bacteria 5657564
322 2743735142 2740892503 Bacteria 6855563
323 2745006376 2744054620 Bacteria 6551379
324 2808955944 2808606382 Bacteria 6841132
325 2809218049 2808606445 Bacteria 6057339
326 2812370284 2811994881 Bacteria 6298475
327 2817488475 2816332298 Bacteria 6852809
328 2826586198 2826581358 Bacteria 5963467
329 2834032147 2834028612 Bacteria 6354979
330 2842817830 2842815866 Bacteria 5947510
331 2842851778 2842849001 Bacteria 5924277
332 2917071245 2917070673 Bacteria 6868303
333 2919157657 2919155634 Bacteria 4860545
334 2923154138 2923153595 Bacteria 6870622
335 2923524372 2923519811 Bacteria 6298479
336 2929144889 2929144301 Bacteria 6622272
337 2931371772 2931369376 Bacteria 6847892
338 2935359072 2935353572 Unclassified 6955622
339 2939655367 2939651529 Bacteria 5895393
340 2945967658 2945961074 Bacteria 7342064
341 2946012441 2946006987 Bacteria 6705746
342 2947235238 2947233263 Bacteria 6439278
343 2988732283 2988728565 Bacteria 6124362
344 3007399690 3007395558 Bacteria 6755444
345 3007517988 3007511990 Bacteria 6481491
346 3007621974 3007619802 Bacteria 6411688
347 3007870778 3007866637 Bacteria 5899198
348 8054287706 8054285046 Bacteria 6919322
349 8054350067 8054347763 Bacteria 5901107
350 8054504039 8054503363 Bacteria 6101651
351 8055879905 8055878733 Bacteria 5907058
352 8056573362 8056569372 Bacteria 5997322
353 Ga0495627_000175
354 MRS1b_contig_7023920
355 Ga0055536_1000236
356 Ga0055530_10000613
357 Ga0065714_10002845
358 Ga0065714_10012738
359 Ga0065714_10074178
360 Ga0065712_10067752
361 Ga0070670_100068751
362 Ga0070665_100262865
363 Ga0075364_10134371
364 Ga0079104_1000674
365 Ga0105251_10000104
366 Ga0105251_10000451
367 Ga0105251_10019215
368 Ga0105251_10043680
369 Ga0105251_10047094
370 Ga0105244_10000133
371 Ga0105244_10009150
372 Ga0105244_10045659
373 Ga0105244_10088615
374 Ga0105250_10000361
375 Ga0105250_10041389
376 Ga0105246_10001162
377 Ga0157373_10089733
378 Ga0157373_10138134
379 Ga0157371_10000233
380 Ga0157372_10005864
381 Ga0182008_10050194
382 Ga0182008_10068511
383 Ga0182008_10152353
384 Ga0182006_1018062
385 Ga0182007_10036090
386 Ga0182005_1026700
387 Ga0163161_10301465
388 Ga0207696_1000217
389 Ga0207655_1000014
390 Ga0207655_1000867
391 Ga0207655_1004225
392 Ga0207655_1024833
393 Ga0207713_1000031
394 Ga0207713_1000197
395 Ga0207713_1018592
396 Ga0209984_1003256
397 Ga0209995_1002635
398 Ga0209983_1001939
399 Ga0268266_10284162
400 Ga0307517_10096613
401 Ga0307511_10033012
402 Ga0316177_1202404
403 Ga0316183_1137429
404 Ga0316181_1068006
405 Ga0307408_100166841
406 Ga0307405_10110758
407 Ga0307405_10125899
408 Ga0307405_10146743
409 Ga0307406_10121756
410 Ga0307407_10113002
411 Ga0307412_10040555
412 Ga0307412_10170302
413 Ga0307416_100383617
414 Ga0307414_10035164
415 Ga0307411_10275885
416 Ga0439438_022473
417 Ga0439438_026764
418 Ga0439447_002310
419 Ga0439466_0002649
420 Ga0439466_0023715
421 Ga0439466_0026358
422 Ga0439432_015552
423 Ga0439432_048687
424 Ga0439456_000398
425 Ga0439456_007281
426 Ga0439456_013370
427 Ga0439463_000024
428 Ga0439463_001205
429 Ga0439463_018345
430 Ga0450891_001869
431 Ga0450903_008990
432 Ga0450904_002631
433 Ga0450905_008338
434 Ga0450907_000124
435 Ga0439446_0010629
436 Ga0450909_017761
437 Ga0439434_0001360
438 Ga0439460_0014234
439 Ga0450901_001775
440 Ga0439440_0006947
441 Ga0439440_0007972
442 Ga0495617_064913
443 Ga0495627_011911
444 Ga0495627_022586
445 Ga0495592_0152249
446 Ga0495591_000161
447 Ga0495591_005579
448 Ga0495591_006363
449 Ga0495591_009985
450 Ga0495591_010205
451 Ga0495591_019599
452 Ga0495638_0045227
453 Ga0495653_0024884
454 Ga0495650_0000626
455 Ga0495650_0009255
456 Ga0495650_0028194
457 Ga0495650_0031212
458 Ga0495605_0000062
459 Ga0495605_0000388
460 Ga0495605_0000507
461 Ga0495605_0001585
462 Ga0495605_0011668
463 Ga0495605_0044954
464 Ga0495605_0066514
465 Ga0495605_0070223
466 Ga0495605_0082227
467 Ga0495584_0000577
468 Ga0495585_0000557
469 Ga0495594_0003276
470 Ga0495596_0023163
471 Ga0495596_0057383
472 Ga0495607_0000534
473 Ga0495607_0000578
474 Ga0495607_0000620
475 Ga0495607_0000732
476 Ga0495607_0008047
477 Ga0495607_0021909
478 Ga0495607_0025325
479 Ga0495607_0033400
480 Ga0495607_0041558
481 Ga0495607_0051532
482 Ga0495607_0082324
483 Ga0495607_0091896
484 Ga0495583_0000015
485 Ga0495583_0000899
486 Ga0495583_0005349
487 Ga0495583_0050567
488 Ga0495583_0062169
489 Ga0495606_0000352
490 Ga0495606_0001099
491 Ga0495606_0034675
492 Ga0495606_0110981
493 Ga0495610_0003012
494 Ga0495610_0052518
495 Ga0495610_0121134
496 Ga0495616_0021933
497 Ga0495616_0071807
498 Ga0495616_0078158
499 Ga0495620_0000050
500 Ga0495620_0004494
501 Ga0495620_0028010
502 Ga0495620_0056884
503 Ga0495631_0011798
504 Ga0495631_0020217
505 Ga0495631_0021649
506 Ga0495631_0040057
507 Ga0495632_0004504
508 Ga0495632_0023250
509 Ga0495632_0031569
510 Ga0495637_0000020
511 Ga0495637_0001123
512 Ga0495637_0034687
513 Ga0495637_0041421
514 Ga0495637_0066832
515 Ga0495643_0024246
516 Ga0495643_0039993
517 Ga0495644_0010727
518 Ga0495648_0002060
519 Ga0495648_0009495
520 Ga0495648_0026934
521 Ga0495666_0150694
522 Ga0495654_0001205
523 Ga0495654_0003950
524 Ga0495654_0004366
525 Ga0495654_0019233
526 Ga0495654_0072689
527 Ga0495609_0000165
528 Ga0495609_0000264
529 Ga0495609_0000290
530 Ga0495609_0019466
531 Ga0495609_0057333
532 Ga0495597_0000124
533 Ga0495597_0005387
534 Ga0495597_0040570
535 Ga0495597_0061809
536 Ga0495645_0250217
537 Ga0495622_0071392
538 Ga0495622_0161168
539 Ga0495633_0000084
540 Ga0495668_0007486
541 Ga0495668_0049213
542 Ga0495668_0066349
543 Ga0495668_0124685
544 Ga0495634_0094098
545 Ga0495611_0004467
546 Ga0495611_0037491
547 Ga0495611_0153630
548 Ga0495625_0000133
549 Ga0495625_0104542
550 Ga0495661_0000065
551 Ga0495661_0000370
552 Ga0495661_0000387
553 Ga0495661_0080911
554 Ga0495661_0081303
555 Ga0495646_0016248
556 Ga0495613_0053953
557 Ga0495624_0017341
558 Ga0495670_0005711
559 Ga0495670_0080702
560 Ga0495671_0011798
561 Ga0495671_0049424
562 Ga0495671_0055645
563 Ga0495649_0122587
564 Ga0495649_0178647
565 Ga0495589_0001973
566 Ga0495660_0000430
567 Ga0495660_0003627
568 Ga0495660_0025369
569 Ga0495660_0061691
570 Ga0495660_0078336
571 Ga0495672_0017277
572 Ga0495672_0039260
573 Ga0495672_0039926
574 Ga0495672_0071970
575 Ga0495672_0074919
576 Ga0495672_0084040
577 Ga0495676_0000202
578 Ga0495676_0017971
579 Ga0495680_0215805
580 Ga0495683_0000109
581 Ga0495675_0160777
582 Ga0495679_000643
583 Ga0495679_000997
584 Ga0495673_0010555
585 Ga0495673_0020515
586 Ga0495673_0020663
587 Ga0495673_0022687
588 Ga0495673_0040037
589 Ga0495673_0056232
590 Ga0495673_0068629
591 Ga0495681_0007827
592 Ga0495681_0016374
593 Ga0495681_0030365
594 Ga0495681_0083069
595 Ga0495684_0308618
596 Ga0495686_0059782
597 Ga0495686_0087385
598 Ga0495593_0021210
599 Ga0495602_0030647
600 Ga0495626_0000371
601 Ga0496102_0151353
602 Ga0496116_0000567
603 Ga0496116_0049029
604 Ga0496117_0005023
605 Ga0496117_0086225
606 Ga0496118_0097296
607 Ga0496118_0110524
608 Ga0496118_0121122
609 Ga0496118_0125477
610 Ga0496118_0140289
611 Ga0496119_0000448
612 Ga0496120_0011575
613 Ga0496121_0002566
614 Ga0496121_0019527
615 Ga0496122_0007075
616 Ga0496122_0013010
617 Ga0496122_0098023
618 Ga0496122_0154661
619 Ga0496123_0000921
620 Ga0496123_0007596
621 Ga0496123_0058117
622 Ga0496123_0069072
623 Ga0496124_0000819
624 Ga0496124_0008908
625 Ga0496124_0059470
626 Ga0496124_0114283
627 Ga0496125_0014953
628 Ga0496125_0052637
629 Ga0495678_000017
630 Ga0495678_007238
631 Ga0495678_012788
632 Ga0495678_041403
633 Ga0495682_0000335
634 Ga0495682_0001724
635 Ga0501222_008776
636 nmdc:mga00v17_383583_c1
637 Ga0500573_0068504
638 Ga0500586_048298
639 2511263372
640 2511337835
641 2511344597
642 2511349177
643 2511358646
644 2555667494
645 2597855723
646 2597861730
647 2597867455
648 2599327300
649 2599485625
650 2599806755
651 2599944650
652 2599957603
653 2599973028
654 2599983226
655 2599991608
656 2599994771
657 2600000969
658 2600027276
659 2600036788
660 2600048229
661 2600077740
662 2600364817
663 2601627114
664 2621302116
665 2643841056
666 2643872555
667 2671772406
668 2678261065
669 2738674149
670 2738687515
671 2738752542
672 2738861583
673 2739263136
674 2743735142
675 2745006376
676 2808955944
677 2809218049
678 2812370284
679 2817488475
680 2826586198
681 2834032147
682 2842817830
683 2842851778
684 2917071245
685 2919157657
686 2923154138
687 2923524372
688 2929144889
689 2931371772
690 2935359072
691 2939655367
692 2945967658
693 2946012441
694 2947235238
695 2988732283
696 3007399690
697 3007517988
698 3007621974
699 3007870778
700 8054287706
701 8054350067
702 8054504039
703 8055879905
704 8056573362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13449

Phytase-like

Esterase-like activity of phytase

56

265

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qqz-assembly1.cif.gz_A crystal structure of the c-terminal domain of the yjik protein from escherichia coli cft073 0.7006 27 315
3nok-assembly2.cif.gz_B crystal structure of myxococcus xanthus glutaminyl cyclase 0.6817 20 315
3nom-assembly2.cif.gz_B crystal structure of zymomonas mobilis glutaminyl cyclase (monoclinic form) 0.6766 23 315
3qqz-assembly1.cif.gz_A crystal structure of the c-terminal domain of the yjik protein from escherichia coli cft073 0.6746 27 315
8ctg-assembly1.cif.gz_C extracellular architecture of an engineered canonical wnt signaling ternary complex 0.674 39 259
ID Description Score Start End Superfamily
af_A0A2R8PYI8_1_196_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7174 116 255 2.120.10.30
af_I1L7B7_441_568_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7066 33 194 2.130.10.10
af_Q7ZZT0_452_615_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7051 118 255 2.120.10.30
af_Q54MH6_8_136_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6881 161 263 2.130.10.10
af_A0A140LGI0_49_356_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6878 39 255 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A3M6C0B5-F1-model_v4 DNA topoisomerase IV subunit B 0.9924 21 325 GO:0016853
AF-A0A656JRM6-F1-model_v4 Phytase-like domain-containing protein 0.9904 45 259
AF-A0A3M6C0B5-F1-model_v4 DNA topoisomerase IV subunit B 0.9891 21 325 GO:0016853
AF-A0A3M3PJ41-F1-model_v4 Phytase-like domain-containing protein 0.9882 35 325
AF-A0A656JRM6-F1-model_v4 Phytase-like domain-containing protein 0.9859 45 259

Map