F419101
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 352 | 198 | 352 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1132411|Ga0436364_1132411_16092_17009 |
| Length | 295 |
| Sequence | VANLGSIWAKIHHTPWAAVAMSLARRRLIRVPASSANLGPGFDVLAAALALHLELEVCETGSFAVHTDLPVRRDRDNLVVRAFERLHPADGFEFTITSNIPLSGGLGSSAAAIVAGLVAADHLFELDADVLGIAAELEGHGFVVCNDGRAHRFEPPMGLEAVLVVPNEAVQTDRARAALPESVPRDDAVFNLAHASMLMLGLATADWELISAGLQDRLHQPQRAHLYPRSVGLLCRARSLGALGATISGAGPTVLVWCTYEQTGPLLEALQRETEGWATVMRGRFEAQGADVRAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 75 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 132 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 133 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 134 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 135 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 195 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 198 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 15.34 |
| Rhizosphere | 74.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10112777 | 3300005327 | Bacteria | 2254 |
| 2 | Ga0070676_10059871 | 3300005328 | Bacteria | 2260 |
| 3 | Ga0070683_100000645 | 3300005329 | Bacteria | 25129 |
| 4 | Ga0070683_100191131 | 3300005329 | Bacteria | 1944 |
| 5 | Ga0070683_100645819 | 3300005329 | Bacteria | 1013 |
| 6 | Ga0068869_100013296 | 3300005334 | Bacteria | 5471 |
| 7 | Ga0070682_100007928 | 3300005337 | Bacteria | 5974 |
| 8 | Ga0070682_100094279 | 3300005337 | Bacteria | 1963 |
| 9 | Ga0068868_100016666 | 3300005338 | Bacteria | 5463 |
| 10 | Ga0068868_100068431 | 3300005338 | Bacteria | 2827 |
| 11 | Ga0070660_100095567 | 3300005339 | Bacteria | 2349 |
| 12 | Ga0070660_100257580 | 3300005339 | Bacteria | 1424 |
| 13 | Ga0070669_100091181 | 3300005353 | Bacteria | 2285 |
| 14 | Ga0070675_100074866 | 3300005354 | Bacteria | 2814 |
| 15 | Ga0070673_100410343 | 3300005364 | Bacteria | 1213 |
| 16 | Ga0070688_100033036 | 3300005365 | Bacteria | 3125 |
| 17 | Ga0070659_100000026 | 3300005366 | Bacteria | 143542 |
| 18 | Ga0070659_100096723 | 3300005366 | Bacteria | 2372 |
| 19 | Ga0070659_100122956 | 3300005366 | Bacteria | 2103 |
| 20 | Ga0070714_100000083 | 3300005435 | Bacteria | 81010 |
| 21 | Ga0070714_100051429 | 3300005435 | Bacteria | 3512 |
| 22 | Ga0070713_100024016 | 3300005436 | Bacteria | 4741 |
| 23 | Ga0070710_10186829 | 3300005437 | Bacteria | 1301 |
| 24 | Ga0070701_10269315 | 3300005438 | Bacteria | 1036 |
| 25 | Ga0070711_100027746 | 3300005439 | Bacteria | 3719 |
| 26 | Ga0070711_100254907 | 3300005439 | Bacteria | 1378 |
| 27 | Ga0070705_100160829 | 3300005440 | Bacteria | 1501 |
| 28 | Ga0070700_100106186 | 3300005441 | Bacteria | 1858 |
| 29 | Ga0070678_100016305 | 3300005456 | Bacteria | 4751 |
| 30 | Ga0070685_10089732 | 3300005466 | Bacteria | 1858 |
| 31 | Ga0070707_100526401 | 3300005468 | Unclassified | 1144 |
| 32 | Ga0070699_100526241 | 3300005518 | Bacteria | 1075 |
| 33 | Ga0070679_100085663 | 3300005530 | Bacteria | 3138 |
| 34 | Ga0070684_100003617 | 3300005535 | Bacteria | 11636 |
| 35 | Ga0068853_100103857 | 3300005539 | Bacteria | 2516 |
| 36 | Ga0070686_100199414 | 3300005544 | Bacteria | 1433 |
| 37 | Ga0070695_100342125 | 3300005545 | Bacteria | 1118 |
| 38 | Ga0070704_100118754 | 3300005549 | Bacteria | 2026 |
| 39 | Ga0070664_100003373 | 3300005564 | Bacteria | 12904 |
| 40 | Ga0068854_100065924 | 3300005578 | Bacteria | 2634 |
| 41 | Ga0068854_100071808 | 3300005578 | Bacteria | 2533 |
| 42 | Ga0068856_100005907 | 3300005614 | Bacteria | 12057 |
| 43 | Ga0068856_100586685 | 3300005614 | Bacteria | 1136 |
| 44 | Ga0068852_100280971 | 3300005616 | Bacteria | 1605 |
| 45 | Ga0068852_100435462 | 3300005616 | Bacteria | 1295 |
| 46 | Ga0068859_100085525 | 3300005617 | Bacteria | 3199 |
| 47 | Ga0068859_100636242 | 3300005617 | Bacteria | 1159 |
| 48 | Ga0068864_100075568 | 3300005618 | Bacteria | 2942 |
| 49 | Ga0068861_100048491 | 3300005719 | Bacteria | 3211 |
| 50 | Ga0068863_100194834 | 3300005841 | Bacteria | 1948 |
| 51 | Ga0068863_100319505 | 3300005841 | Bacteria | 1508 |
| 52 | Ga0068862_100389842 | 3300005844 | Bacteria | 1301 |
| 53 | Ga0081455_10010781 | 3300005937 | Bacteria | 9235 |
| 54 | Ga0081540_1001234 | 3300005983 | Bacteria | 22306 |
| 55 | Ga0081539_10027906 | 3300005985 | Bacteria | 3563 |
| 56 | Ga0070717_10000004 | 3300006028 | Bacteria | 365525 |
| 57 | Ga0075365_10232294 | 3300006038 | Bacteria | 1295 |
| 58 | Ga0075432_10018839 | 3300006058 | Bacteria | 2356 |
| 59 | Ga0070716_100311498 | 3300006173 | Bacteria | 1099 |
| 60 | Ga0070712_100000008 | 3300006175 | Bacteria | 149644 |
| 61 | Ga0070712_100003760 | 3300006175 | Bacteria | 9350 |
| 62 | Ga0075431_100033246 | 3300006847 | Bacteria | 5315 |
| 63 | Ga0075433_10039591 | 3300006852 | Bacteria | 4076 |
| 64 | Ga0075433_10257675 | 3300006852 | Bacteria | 1547 |
| 65 | Ga0075434_100023596 | 3300006871 | Bacteria | 5998 |
| 66 | Ga0075429_100249664 | 3300006880 | Bacteria | 1554 |
| 67 | Ga0075436_100042542 | 3300006914 | Bacteria | 3133 |
| 68 | Ga0097620_100085517 | 3300006931 | Bacteria | 3199 |
| 69 | Ga0097620_100636157 | 3300006931 | Bacteria | 1159 |
| 70 | Ga0111539_10038710 | 3300009094 | Bacteria | 5755 |
| 71 | Ga0111539_10370025 | 3300009094 | Bacteria | 1668 |
| 72 | Ga0105245_10004181 | 3300009098 | Bacteria | 12821 |
| 73 | Ga0105245_10080580 | 3300009098 | Bacteria | 2974 |
| 74 | Ga0105245_10258404 | 3300009098 | Bacteria | 1694 |
| 75 | Ga0105247_10017078 | 3300009101 | Bacteria | 4357 |
| 76 | Ga0114129_11199004 | 3300009147 | Bacteria | 946 |
| 77 | Ga0105243_10076332 | 3300009148 | Bacteria | 2722 |
| 78 | Ga0105243_10143381 | 3300009148 | Bacteria | 2041 |
| 79 | Ga0105243_10354058 | 3300009148 | Bacteria | 1349 |
| 80 | Ga0105242_10267747 | 3300009176 | Bacteria | 1546 |
| 81 | Ga0105248_10133732 | 3300009177 | Bacteria | 2798 |
| 82 | Ga0105248_10490879 | 3300009177 | Bacteria | 1384 |
| 83 | Ga0105249_10356240 | 3300009553 | Bacteria | 1483 |
| 84 | Ga0105249_10698988 | 3300009553 | Bacteria | 1074 |
| 85 | Ga0105239_10051102 | 3300010375 | Bacteria | 4532 |
| 86 | Ga0105239_11208299 | 3300010375 | Bacteria | 871 |
| 87 | Ga0105246_10099981 | 3300011119 | Bacteria | 2109 |
| 88 | Ga0157374_10007098 | 3300013296 | Bacteria | 9536 |
| 89 | Ga0163162_10157124 | 3300013306 | Bacteria | 2394 |
| 90 | Ga0157372_10012336 | 3300013307 | Bacteria | 9107 |
| 91 | Ga0157375_10017301 | 3300013308 | Bacteria | 6503 |
| 92 | Ga0157375_10140072 | 3300013308 | Bacteria | 2545 |
| 93 | Ga0163163_10253249 | 3300014325 | Bacteria | 1811 |
| 94 | Ga0157380_10286599 | 3300014326 | Bacteria | 1510 |
| 95 | Ga0157377_10000822 | 3300014745 | Bacteria | 12885 |
| 96 | Ga0157377_10036509 | 3300014745 | Bacteria | 2704 |
| 97 | Ga0157379_10002281 | 3300014968 | Bacteria | 15981 |
| 98 | Ga0157379_10160127 | 3300014968 | Bacteria | 2032 |
| 99 | Ga0157376_10025716 | 3300014969 | Bacteria | 4639 |
| 100 | Ga0157376_10206614 | 3300014969 | Bacteria | 1810 |
| 101 | Ga0213874_10016513 | 3300021377 | Bacteria | 1966 |
| 102 | Ga0213876_10006252 | 3300021384 | Bacteria | 6495 |
| 103 | Ga0213876_10013367 | 3300021384 | Bacteria | 4362 |
| 104 | Ga0213876_10026102 | 3300021384 | Bacteria | 3081 |
| 105 | Ga0213876_10134437 | 3300021384 | Bacteria | 1315 |
| 106 | Ga0213876_10135711 | 3300021384 | Bacteria | 1309 |
| 107 | Ga0213875_10049702 | 3300021388 | Bacteria | 1965 |
| 108 | Ga0213875_10181052 | 3300021388 | Bacteria | 990 |
| 109 | Ga0207426_1007432 | 3300025302 | Bacteria | 4589 |
| 110 | Ga0207692_10028496 | 3300025898 | Bacteria | 2642 |
| 111 | Ga0207710_10015807 | 3300025900 | Bacteria | 3192 |
| 112 | Ga0207688_10000691 | 3300025901 | Bacteria | 16661 |
| 113 | Ga0207688_10021608 | 3300025901 | Bacteria | 3518 |
| 114 | Ga0207680_10067852 | 3300025903 | Bacteria | 2198 |
| 115 | Ga0207699_10040004 | 3300025906 | Bacteria | 2698 |
| 116 | Ga0207645_10025224 | 3300025907 | Bacteria | 3847 |
| 117 | Ga0207643_10004422 | 3300025908 | Bacteria | 7559 |
| 118 | Ga0207705_10124878 | 3300025909 | Bacteria | 1912 |
| 119 | Ga0207671_10005669 | 3300025914 | Bacteria | 11415 |
| 120 | Ga0207693_10000002 | 3300025915 | Bacteria | 304011 |
| 121 | Ga0207693_10010715 | 3300025915 | Bacteria | 7440 |
| 122 | Ga0207693_10073893 | 3300025915 | Bacteria | 2669 |
| 123 | Ga0207693_10156959 | 3300025915 | Bacteria | 1790 |
| 124 | Ga0207663_10250335 | 3300025916 | Bacteria | 1303 |
| 125 | Ga0207662_10111475 | 3300025918 | Bacteria | 1706 |
| 126 | Ga0207662_10197723 | 3300025918 | Bacteria | 1300 |
| 127 | Ga0207662_10272900 | 3300025918 | Bacteria | 1117 |
| 128 | Ga0207657_10052831 | 3300025919 | Bacteria | 3524 |
| 129 | Ga0207657_10066688 | 3300025919 | Bacteria | 3063 |
| 130 | Ga0207657_10199289 | 3300025919 | Bacteria | 1611 |
| 131 | Ga0207652_10012226 | 3300025921 | Bacteria | 6935 |
| 132 | Ga0207646_10170390 | 3300025922 | Bacteria | 1966 |
| 133 | Ga0207681_10057966 | 3300025923 | Bacteria | 2650 |
| 134 | Ga0207681_10070560 | 3300025923 | Bacteria | 2433 |
| 135 | Ga0207694_10400915 | 3300025924 | Bacteria | 1141 |
| 136 | Ga0207687_10161996 | 3300025927 | Bacteria | 1718 |
| 137 | Ga0207687_10396423 | 3300025927 | Bacteria | 1134 |
| 138 | Ga0207700_10037394 | 3300025928 | Bacteria | 3515 |
| 139 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 140 | Ga0207664_10004303 | 3300025929 | Bacteria | 9639 |
| 141 | Ga0207664_10189025 | 3300025929 | Bacteria | 1772 |
| 142 | Ga0207690_10000098 | 3300025932 | Bacteria | 71853 |
| 143 | Ga0207690_10059478 | 3300025932 | Bacteria | 2589 |
| 144 | Ga0207706_10046911 | 3300025933 | Bacteria | 3824 |
| 145 | Ga0207686_10201644 | 3300025934 | Bacteria | 1425 |
| 146 | Ga0207709_10032271 | 3300025935 | Bacteria | 3065 |
| 147 | Ga0207709_10097016 | 3300025935 | Bacteria | 1940 |
| 148 | Ga0207709_10170193 | 3300025935 | Bacteria | 1528 |
| 149 | Ga0207669_10082238 | 3300025937 | Bacteria | 2067 |
| 150 | Ga0207669_10149399 | 3300025937 | Bacteria | 1634 |
| 151 | Ga0207704_10087667 | 3300025938 | Bacteria | 2033 |
| 152 | Ga0207689_10040643 | 3300025942 | Bacteria | 3849 |
| 153 | Ga0207689_10064905 | 3300025942 | Bacteria | 3003 |
| 154 | Ga0207661_10058057 | 3300025944 | Bacteria | 3114 |
| 155 | Ga0207661_10417873 | 3300025944 | Bacteria | 1218 |
| 156 | Ga0207679_10130024 | 3300025945 | Bacteria | 2018 |
| 157 | Ga0207679_10282205 | 3300025945 | Bacteria | 1425 |
| 158 | Ga0207651_10498057 | 3300025960 | Bacteria | 1053 |
| 159 | Ga0207640_10131560 | 3300025981 | Bacteria | 1809 |
| 160 | Ga0207640_10147320 | 3300025981 | Bacteria | 1724 |
| 161 | Ga0207640_10201214 | 3300025981 | Bacteria | 1510 |
| 162 | Ga0207677_10203133 | 3300026023 | Bacteria | 1577 |
| 163 | Ga0207677_10680253 | 3300026023 | Bacteria | 911 |
| 164 | Ga0207678_10053507 | 3300026067 | Bacteria | 3478 |
| 165 | Ga0207678_10286386 | 3300026067 | Bacteria | 1415 |
| 166 | Ga0207708_10003393 | 3300026075 | Bacteria | 11731 |
| 167 | Ga0207641_10058565 | 3300026088 | Bacteria | 3279 |
| 168 | Ga0207641_10244413 | 3300026088 | Bacteria | 1674 |
| 169 | Ga0207648_10100590 | 3300026089 | Bacteria | 2533 |
| 170 | Ga0207676_10018388 | 3300026095 | Bacteria | 5080 |
| 171 | Ga0207674_10054859 | 3300026116 | Bacteria | 4055 |
| 172 | Ga0207675_100491963 | 3300026118 | Bacteria | 1220 |
| 173 | Ga0207683_10249791 | 3300026121 | Bacteria | 1619 |
| 174 | Ga0207698_10055350 | 3300026142 | Bacteria | 3057 |
| 175 | Ga0207698_10323847 | 3300026142 | Bacteria | 1445 |
| 176 | Ga0207428_10013418 | 3300027907 | Bacteria | 7159 |
| 177 | Ga0268265_10080998 | 3300028380 | Bacteria | 2562 |
| 178 | Ga0265319_1000544 | 3300028563 | Bacteria | 25627 |
| 179 | Ga0265320_10039201 | 3300031240 | Bacteria | 2371 |
| 180 | Ga0307406_10308357 | 3300031901 | Bacteria | 1219 |
| 181 | Ga0307416_100347719 | 3300032002 | Bacteria | 1499 |
| 182 | Ga0373927_0298181 | 3300035695 | Bacteria | 1061 |
| 183 | Ga0373947_0220936 | 3300035725 | Bacteria | 1245 |
| 184 | Ga0373937_0006516 | 3300036401 | Bacteria | 10078 |
| 185 | Ga0395900_0264338 | 3300037418 | Bacteria | 1717 |
| 186 | Ga0395900_0611964 | 3300037418 | Bacteria | 1029 |
| 187 | Ga0395898_0046905 | 3300037466 | Bacteria | 4243 |
| 188 | Ga0395898_0274162 | 3300037466 | Bacteria | 1609 |
| 189 | Ga0436364_0200518 | 3300037853 | Bacteria | 1904 |
| 190 | Ga0436364_0520142 | 3300037853 | Bacteria | 2720 |
| 191 | Ga0436364_0575671 | 3300037853 | Bacteria | 7609 |
| 192 | Ga0436364_0830799 | 3300037853 | Bacteria | 3525 |
| 193 | Ga0436364_0920241 | 3300037853 | Bacteria | 1547 |
| 194 | Ga0436364_1132411 | 3300037853 | Bacteria | 58691 |
| 195 | Ga0436364_1142787 | 3300037853 | Bacteria | 6981 |
| 196 | Ga0436364_1150642 | 3300037853 | Bacteria | 1231 |
| 197 | Ga0436364_1382614 | 3300037853 | Bacteria | 17798 |
| 198 | Ga0395901_0070917 | 3300038443 | Bacteria | 3630 |
| 199 | Ga0395901_0140427 | 3300038443 | Bacteria | 2539 |
| 200 | Ga0436365_0262453 | 3300039437 | Bacteria | 28030 |
| 201 | Ga0436365_0627820 | 3300039437 | Bacteria | 7220 |
| 202 | Ga0436365_0677843 | 3300039437 | Bacteria | 4410 |
| 203 | Ga0436365_0838755 | 3300039437 | Bacteria | 2137 |
| 204 | Ga0436365_0944756 | 3300039437 | Bacteria | 2314 |
| 205 | Ga0436365_1044040 | 3300039437 | Bacteria | 2856 |
| 206 | Ga0436365_1108574 | 3300039437 | Bacteria | 4739 |
| 207 | Ga0436365_1174289 | 3300039437 | Bacteria | 19637 |
| 208 | Ga0436365_1373684 | 3300039437 | Bacteria | 1344 |
| 209 | Ga0436365_1757939 | 3300039437 | Bacteria | 2849 |
| 210 | Ga0436365_1826901 | 3300039437 | Bacteria | 15104 |
| 211 | Ga0436365_1839438 | 3300039437 | Bacteria | 3219 |
| 212 | Ga0436360_0252082 | 3300039438 | Bacteria | 4238 |
| 213 | Ga0436363_0403902 | 3300039450 | Bacteria | 8557 |
| 214 | Ga0436363_0449139 | 3300039450 | Bacteria | 1936 |
| 215 | Ga0436363_0678117 | 3300039450 | Bacteria | 33768 |
| 216 | Ga0436362_0290643 | 3300039453 | Bacteria | 5761 |
| 217 | Ga0436362_0575825 | 3300039453 | Bacteria | 3209 |
| 218 | Ga0436362_1224300 | 3300039453 | Bacteria | 1171 |
| 219 | Ga0451853_3803240 | 3300041512 | Bacteria | 1455 |
| 220 | Ga0466966_0020653 | 3300044684 | Bacteria | 4328 |
| 221 | Ga0466966_0045528 | 3300044684 | Bacteria | 2805 |
| 222 | Ga0466966_0140138 | 3300044684 | Bacteria | 1478 |
| 223 | Ga0466966_0143686 | 3300044684 | Bacteria | 1457 |
| 224 | Ga0466963_0018438 | 3300044694 | Bacteria | 4364 |
| 225 | Ga0466963_0064727 | 3300044694 | Bacteria | 2450 |
| 226 | Ga0466963_0228665 | 3300044694 | Bacteria | 1303 |
| 227 | Ga0466963_0342138 | 3300044694 | Bacteria | 1053 |
| 228 | Ga0466964_0048542 | 3300044706 | Bacteria | 1736 |
| 229 | Ga0466971_0011751 | 3300044719 | Bacteria | 3835 |
| 230 | Ga0466968_0039588 | 3300044735 | Bacteria | 1985 |
| 231 | Ga0466968_0149135 | 3300044735 | Bacteria | 1074 |
| 232 | Ga0466957_0007335 | 3300044842 | Bacteria | 6231 |
| 233 | Ga0466957_0169153 | 3300044842 | Bacteria | 1423 |
| 234 | Ga0466957_0262067 | 3300044842 | Bacteria | 1152 |
| 235 | Ga0466960_0000037 | 3300044901 | Bacteria | 43394 |
| 236 | Ga0466959_0008217 | 3300045049 | Bacteria | 7363 |
| 237 | Ga0466959_0011476 | 3300045049 | Bacteria | 6369 |
| 238 | Ga0466959_0109536 | 3300045049 | Bacteria | 1972 |
| 239 | Ga0466959_0116488 | 3300045049 | Bacteria | 1903 |
| 240 | Ga0466959_0162454 | 3300045049 | Bacteria | 1570 |
| 241 | Ga0466959_0233517 | 3300045049 | Bacteria | 1272 |
| 242 | Ga0466959_0380084 | 3300045049 | Bacteria | 961 |
| 243 | Ga0466959_0474355 | 3300045049 | Bacteria | 847 |
| 244 | Ga0466958_0001567 | 3300045836 | Bacteria | 10965 |
| 245 | Ga0466958_0010758 | 3300045836 | Bacteria | 5132 |
| 246 | Ga0466958_0021974 | 3300045836 | Bacteria | 3731 |
| 247 | Ga0466958_0038051 | 3300045836 | Bacteria | 2885 |
| 248 | Ga0466958_0088539 | 3300045836 | Bacteria | 1913 |
| 249 | Ga0466958_0158572 | 3300045836 | Bacteria | 1429 |
| 250 | Ga0466958_0340405 | 3300045836 | Bacteria | 965 |
| 251 | Ga0466967_0067584 | 3300045976 | Bacteria | 3188 |
| 252 | Ga0466967_0138997 | 3300045976 | Bacteria | 2261 |
| 253 | Ga0466967_0373136 | 3300045976 | Bacteria | 1384 |
| 254 | Ga0466967_0709762 | 3300045976 | Bacteria | 996 |
| 255 | Ga0495592_0070591 | 3300046454 | Bacteria | 2544 |
| 256 | Ga0495651_0006035 | 3300046462 | Bacteria | 9249 |
| 257 | Ga0495653_0039669 | 3300046463 | Bacteria | 3687 |
| 258 | Ga0495639_0150130 | 3300046475 | Bacteria | 1124 |
| 259 | Ga0495608_0005776 | 3300046511 | Bacteria | 8813 |
| 260 | Ga0495608_0109236 | 3300046511 | Bacteria | 1779 |
| 261 | Ga0495628_0059195 | 3300046516 | Bacteria | 3008 |
| 262 | Ga0495587_0043741 | 3300046536 | Bacteria | 2666 |
| 263 | Ga0495667_0007367 | 3300046559 | Bacteria | 7462 |
| 264 | Ga0495656_0006425 | 3300046615 | Bacteria | 4125 |
| 265 | Ga0495634_0138994 | 3300046642 | Bacteria | 1543 |
| 266 | Ga0495635_0007467 | 3300046663 | Bacteria | 7631 |
| 267 | Ga0495657_0002620 | 3300046675 | Bacteria | 15053 |
| 268 | Ga0495599_0149988 | 3300046678 | Bacteria | 1444 |
| 269 | Ga0495604_0037728 | 3300047317 | Bacteria | 3804 |
| 270 | Ga0495680_0030777 | 3300047322 | Bacteria | 4376 |
| 271 | Ga0495675_0119462 | 3300047444 | Bacteria | 1642 |
| 272 | Ga0495684_0001764 | 3300047471 | Bacteria | 17376 |
| 273 | Ga0495684_0084327 | 3300047471 | Bacteria | 2410 |
| 274 | Ga0495602_0035913 | 3300048088 | Bacteria | 4617 |
| 275 | Ga0496100_0000534 | 3300048903 | Bacteria | 18056 |
| 276 | Ga0496100_0008692 | 3300048903 | Bacteria | 5673 |
| 277 | Ga0496100_0029937 | 3300048903 | Bacteria | 3372 |
| 278 | Ga0496100_0080410 | 3300048903 | Bacteria | 2199 |
| 279 | Ga0496101_0001866 | 3300048904 | Bacteria | 12729 |
| 280 | Ga0496102_0089693 | 3300048905 | Bacteria | 2844 |
| 281 | Ga0496102_0107356 | 3300048905 | Bacteria | 2599 |
| 282 | Ga0496102_0557733 | 3300048905 | Bacteria | 1068 |
| 283 | Ga0496103_0018758 | 3300048906 | Bacteria | 4152 |
| 284 | Ga0496103_0076442 | 3300048906 | Bacteria | 2101 |
| 285 | Ga0496104_0016491 | 3300048907 | Bacteria | 6712 |
| 286 | Ga0496104_0051969 | 3300048907 | Bacteria | 3870 |
| 287 | Ga0496104_0639644 | 3300048907 | Bacteria | 973 |
| 288 | Ga0496105_0018448 | 3300048908 | Bacteria | 5608 |
| 289 | Ga0496105_0061387 | 3300048908 | Bacteria | 3102 |
| 290 | Ga0496105_0132750 | 3300048908 | Bacteria | 2052 |
| 291 | Ga0496105_0216164 | 3300048908 | Bacteria | 1561 |
| 292 | Ga0496105_0294107 | 3300048908 | Bacteria | 1307 |
| 293 | Ga0496106_0021970 | 3300048909 | Bacteria | 4741 |
| 294 | Ga0496108_0030684 | 3300048911 | Bacteria | 4454 |
| 295 | Ga0496108_0325736 | 3300048911 | Bacteria | 1339 |
| 296 | Ga0496109_0008446 | 3300048912 | Bacteria | 8756 |
| 297 | Ga0496109_0010278 | 3300048912 | Bacteria | 7991 |
| 298 | Ga0496109_0050143 | 3300048912 | Bacteria | 3802 |
| 299 | Ga0496109_0052228 | 3300048912 | Bacteria | 3725 |
| 300 | Ga0496109_0084226 | 3300048912 | Bacteria | 2933 |
| 301 | Ga0496109_0133873 | 3300048912 | Bacteria | 2315 |
| 302 | Ga0496109_0200979 | 3300048912 | Bacteria | 1873 |
| 303 | Ga0496109_0306400 | 3300048912 | Bacteria | 1498 |
| 304 | Ga0496110_0004098 | 3300048913 | Bacteria | 11251 |
| 305 | Ga0496110_0022592 | 3300048913 | Bacteria | 5343 |
| 306 | Ga0496110_0068099 | 3300048913 | Bacteria | 3150 |
| 307 | Ga0496110_0163146 | 3300048913 | Bacteria | 2020 |
| 308 | Ga0496111_0048481 | 3300048914 | Bacteria | 3060 |
| 309 | Ga0496111_0064209 | 3300048914 | Bacteria | 2663 |
| 310 | Ga0496111_0134451 | 3300048914 | Bacteria | 1831 |
| 311 | Ga0496112_0000401 | 3300048915 | Bacteria | 28280 |
| 312 | Ga0496112_0006492 | 3300048915 | Bacteria | 10278 |
| 313 | Ga0496112_0007418 | 3300048915 | Bacteria | 9735 |
| 314 | Ga0496112_0151332 | 3300048915 | Bacteria | 2287 |
| 315 | Ga0496112_0226221 | 3300048915 | Bacteria | 1826 |
| 316 | Ga0496112_0351107 | 3300048915 | Bacteria | 1417 |
| 317 | Ga0496112_0354067 | 3300048915 | Bacteria | 1410 |
| 318 | Ga0496112_0555588 | 3300048915 | Bacteria | 1082 |
| 319 | Ga0496112_0672816 | 3300048915 | Bacteria | 964 |
| 320 | Ga0496113_0022203 | 3300048916 | Bacteria | 4485 |
| 321 | Ga0496113_0022346 | 3300048916 | Bacteria | 4472 |
| 322 | Ga0496113_0055366 | 3300048916 | Bacteria | 2973 |
| 323 | Ga0496113_0128244 | 3300048916 | Bacteria | 1988 |
| 324 | Ga0496113_0147630 | 3300048916 | Bacteria | 1853 |
| 325 | Ga0496114_0285470 | 3300048917 | Bacteria | 1456 |
| 326 | Ga0496115_0000296 | 3300048918 | Bacteria | 42934 |
| 327 | Ga0496115_0000306 | 3300048918 | Bacteria | 41705 |
| 328 | Ga0496115_0042014 | 3300048918 | Bacteria | 3641 |
| 329 | Ga0501034_0097897 | 3300049571 | Bacteria | 2929 |
| 330 | Ga0501036_0054445 | 3300049572 | Bacteria | 3389 |
| 331 | Ga0501040_0131596 | 3300049576 | Bacteria | 1759 |
| 332 | Ga0501048_0098944 | 3300049582 | Bacteria | 2057 |
| 333 | Ga0501067_0048818 | 3300049583 | Bacteria | 2347 |
| 334 | Ga0501071_0068082 | 3300049587 | Bacteria | 2590 |
| 335 | Ga0501072_0049498 | 3300049588 | Bacteria | 3308 |
| 336 | Ga0501076_0129288 | 3300049592 | Bacteria | 2048 |
| 337 | Ga0501079_0536721 | 3300049741 | Bacteria | 920 |
| 338 | Ga0501081_0094377 | 3300049743 | Bacteria | 2108 |
| 339 | nmdc:mga0n895_204385_c1 | 3300050512 | Bacteria | 2006 |
| 340 | nmdc:mga0rr50_337555_c1 | 3300050513 | Bacteria | 1266 |
| 341 | nmdc:mga08x19_117882_c1 | 3300050514 | Bacteria | 1776 |
| 342 | nmdc:mga0a205_332636_c1 | 3300050515 | Bacteria | 1388 |
| 343 | nmdc:mga0a205_336139_c1 | 3300050515 | Bacteria | 1379 |
| 344 | nmdc:mga0a205_78951_c1 | 3300050515 | Bacteria | 3180 |
| 345 | Ga0495595_0003402 | 3300053084 | Bacteria | 6323 |
| 346 | Ga0495619_0049006 | 3300053085 | Bacteria | 2784 |
| 347 | Ga0500616_0004399 | 3300053153 | Bacteria | 10062 |
| 348 | Ga0501084_0091881 | 3300054114 | Bacteria | 2548 |
| 349 | Ga0501082_0046295 | 3300060353 | Bacteria | 3750 |
| 350 | Ga0466962_0089210 | 3300061719 | Bacteria | 1477 |
| 351 | Ga0466962_0151887 | 3300061719 | Bacteria | 1124 |
| 352 | Ga0530510_0166584 | 3300061734 | Bacteria | 1631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028563 | Ga0265319_1000544 | Ga0265319_100054413 | 216 |
| 2 | 3300031240 | Ga0265320_10039201 | Ga0265320_100392012 | 216 |
| 3 | 3300010375 | Ga0105239_11208299 | Ga0105239_112082991 | 227 |
| 4 | 3300048915 | Ga0496112_0151332 | Ga0496112_0151332_1497_2258 | 227 |
| 5 | 3300049741 | Ga0501079_0536721 | Ga0501079_0536721_10_771 | 227 |
| 6 | 3300045049 | Ga0466959_0474355 | Ga0466959_0474355_10_780 | 228 |
| 7 | 3300048915 | Ga0496112_0555588 | Ga0496112_0555588_47_901 | 232 |
| 8 | 3300005329 | Ga0070683_100191131 | Ga0070683_1001911312 | 234 |
| 9 | 3300025944 | Ga0207661_10058057 | Ga0207661_100580573 | 234 |
| 10 | 3300041512 | Ga0451853_3803240 | Ga0451853_3803240_47_829 | 234 |
| 11 | 3300044684 | Ga0466966_0045528 | Ga0466966_0045528_143_1054 | 234 |
| 12 | 3300005468 | Ga0070707_100526401 | Ga0070707_1005264011 | 235 |
| 13 | 3300025922 | Ga0207646_10170390 | Ga0207646_101703902 | 235 |
| 14 | 3300048906 | Ga0496103_0076442 | Ga0496103_0076442_830_1615 | 235 |
| 15 | 3300048908 | Ga0496105_0294107 | Ga0496105_0294107_370_1155 | 235 |
| 16 | 3300048918 | Ga0496115_0000306 | Ga0496115_0000306_2851_3636 | 235 |
| 17 | 3300045049 | Ga0466959_0008217 | Ga0466959_0008217_5299_6087 | 236 |
| 18 | 3300045836 | Ga0466958_0021974 | Ga0466958_0021974_2180_2968 | 236 |
| 19 | 3300039437 | Ga0436365_0677843 | Ga0436365_0677843_2115_3152 | 243 |
| 20 | 3300005440 | Ga0070705_100160829 | Ga0070705_1001608292 | 244 |
| 21 | 3300006028 | Ga0070717_10000004 | Ga0070717_1000000446 | 244 |
| 22 | 3300005353 | Ga0070669_100091181 | Ga0070669_1000911813 | 245 |
| 23 | 3300025923 | Ga0207681_10070560 | Ga0207681_100705603 | 245 |
| 24 | 3300037466 | Ga0395898_0274162 | Ga0395898_0274162_707_1558 | 246 |
| 25 | 3300038443 | Ga0395901_0140427 | Ga0395901_0140427_1577_2428 | 246 |
| 26 | 3300046475 | Ga0495639_0150130 | Ga0495639_0150130_165_1016 | 246 |
| 27 | 3300037853 | Ga0436364_1132411 | Ga0436364_1132411_16092_17009 | 247 |
| 28 | 3300039437 | Ga0436365_1174289 | Ga0436365_1174289_939_1856 | 247 |
| 29 | 3300039437 | Ga0436365_1757939 | Ga0436365_1757939_451_1317 | 247 |
| 30 | 3300039450 | Ga0436363_0403902 | Ga0436363_0403902_7404_8321 | 247 |
| 31 | 3300039453 | Ga0436362_0290643 | Ga0436362_0290643_1583_2500 | 247 |
| 32 | 3300006175 | Ga0070712_100000008 | Ga0070712_1000000089 | 249 |
| 33 | 3300009148 | Ga0105243_10354058 | Ga0105243_103540582 | 249 |
| 34 | 3300025915 | Ga0207693_10000002 | Ga0207693_10000002332 | 249 |
| 35 | 3300035695 | Ga0373927_0298181 | Ga0373927_0298181_85_912 | 249 |
| 36 | 3300036401 | Ga0373937_0006516 | Ga0373937_0006516_2642_3469 | 249 |
| 37 | 3300037853 | Ga0436364_0200518 | Ga0436364_0200518_870_1736 | 249 |
| 38 | 3300039453 | Ga0436362_1224300 | Ga0436362_1224300_206_1063 | 249 |
| 39 | 3300044735 | Ga0466968_0039588 | Ga0466968_0039588_47_874 | 249 |
| 40 | 3300046454 | Ga0495592_0070591 | Ga0495592_0070591_1506_2333 | 249 |
| 41 | 3300046462 | Ga0495651_0006035 | Ga0495651_0006035_3649_4476 | 249 |
| 42 | 3300046463 | Ga0495653_0039669 | Ga0495653_0039669_50_877 | 249 |
| 43 | 3300046511 | Ga0495608_0005776 | Ga0495608_0005776_4631_5458 | 249 |
| 44 | 3300046516 | Ga0495628_0059195 | Ga0495628_0059195_1698_2525 | 249 |
| 45 | 3300046536 | Ga0495587_0043741 | Ga0495587_0043741_580_1407 | 249 |
| 46 | 3300046559 | Ga0495667_0007367 | Ga0495667_0007367_4840_5667 | 249 |
| 47 | 3300046642 | Ga0495634_0138994 | Ga0495634_0138994_684_1511 | 249 |
| 48 | 3300046663 | Ga0495635_0007467 | Ga0495635_0007467_4263_5090 | 249 |
| 49 | 3300046675 | Ga0495657_0002620 | Ga0495657_0002620_12215_13042 | 249 |
| 50 | 3300046678 | Ga0495599_0149988 | Ga0495599_0149988_33_860 | 249 |
| 51 | 3300047317 | Ga0495604_0037728 | Ga0495604_0037728_1478_2305 | 249 |
| 52 | 3300047322 | Ga0495680_0030777 | Ga0495680_0030777_2800_3627 | 249 |
| 53 | 3300047444 | Ga0495675_0119462 | Ga0495675_0119462_748_1575 | 249 |
| 54 | 3300047471 | Ga0495684_0084327 | Ga0495684_0084327_78_905 | 249 |
| 55 | 3300048088 | Ga0495602_0035913 | Ga0495602_0035913_404_1231 | 249 |
| 56 | 3300048915 | Ga0496112_0007418 | Ga0496112_0007418_2850_3677 | 249 |
| 57 | 3300048916 | Ga0496113_0022203 | Ga0496113_0022203_2576_3403 | 249 |
| 58 | 3300053084 | Ga0495595_0003402 | Ga0495595_0003402_3380_4207 | 249 |
| 59 | 3300053085 | Ga0495619_0049006 | Ga0495619_0049006_260_1087 | 249 |
| 60 | 3300025981 | Ga0207640_10201214 | Ga0207640_102012142 | 250 |
| 61 | 3300039438 | Ga0436360_0252082 | Ga0436360_0252082_572_1435 | 250 |
| 62 | 3300044842 | Ga0466957_0262067 | Ga0466957_0262067_183_1040 | 250 |
| 63 | 3300061719 | Ga0466962_0151887 | Ga0466962_0151887_45_902 | 250 |
| 64 | 3300025914 | Ga0207671_10005669 | Ga0207671_100056694 | 251 |
| 65 | 3300037853 | Ga0436364_0920241 | Ga0436364_0920241_352_1185 | 251 |
| 66 | 3300037853 | Ga0436364_1150642 | Ga0436364_1150642_377_1213 | 251 |
| 67 | 3300049572 | Ga0501036_0054445 | Ga0501036_0054445_149_1003 | 251 |
| 68 | 3300049576 | Ga0501040_0131596 | Ga0501040_0131596_882_1736 | 251 |
| 69 | 3300049582 | Ga0501048_0098944 | Ga0501048_0098944_1178_2032 | 251 |
| 70 | 3300049587 | Ga0501071_0068082 | Ga0501071_0068082_1049_1903 | 251 |
| 71 | 3300049588 | Ga0501072_0049498 | Ga0501072_0049498_1810_2664 | 251 |
| 72 | 3300049592 | Ga0501076_0129288 | Ga0501076_0129288_850_1704 | 251 |
| 73 | 3300049743 | Ga0501081_0094377 | Ga0501081_0094377_917_1771 | 251 |
| 74 | 3300054114 | Ga0501084_0091881 | Ga0501084_0091881_323_1177 | 251 |
| 75 | 3300060353 | Ga0501082_0046295 | Ga0501082_0046295_1322_2176 | 251 |
| 76 | 3300061734 | Ga0530510_0166584 | Ga0530510_0166584_441_1295 | 251 |
| 77 | 3300048918 | Ga0496115_0000296 | Ga0496115_0000296_2923_3759 | 252 |
| 78 | 3300021384 | Ga0213876_10013367 | Ga0213876_100133674 | 256 |
| 79 | 3300025302 | Ga0207426_1007432 | Ga0207426_10074326 | 256 |
| 80 | 3300026023 | Ga0207677_10680253 | Ga0207677_106802531 | 256 |
| 81 | 3300037418 | Ga0395900_0264338 | Ga0395900_0264338_784_1635 | 256 |
| 82 | 3300039437 | Ga0436365_0262453 | Ga0436365_0262453_17501_18355 | 256 |
| 83 | 3300044694 | Ga0466963_0064727 | Ga0466963_0064727_1405_2259 | 256 |
| 84 | 3300005327 | Ga0070658_10112777 | Ga0070658_101127772 | 257 |
| 85 | 3300005328 | Ga0070676_10059871 | Ga0070676_100598712 | 257 |
| 86 | 3300005329 | Ga0070683_100000645 | Ga0070683_1000006454 | 257 |
| 87 | 3300005329 | Ga0070683_100645819 | Ga0070683_1006458191 | 257 |
| 88 | 3300005334 | Ga0068869_100013296 | Ga0068869_1000132964 | 257 |
| 89 | 3300005337 | Ga0070682_100007928 | Ga0070682_1000079288 | 257 |
| 90 | 3300005337 | Ga0070682_100094279 | Ga0070682_1000942792 | 257 |
| 91 | 3300005338 | Ga0068868_100016666 | Ga0068868_1000166664 | 257 |
| 92 | 3300005338 | Ga0068868_100068431 | Ga0068868_1000684313 | 257 |
| 93 | 3300005339 | Ga0070660_100095567 | Ga0070660_1000955672 | 257 |
| 94 | 3300005339 | Ga0070660_100257580 | Ga0070660_1002575802 | 257 |
| 95 | 3300005354 | Ga0070675_100074866 | Ga0070675_1000748664 | 257 |
| 96 | 3300005364 | Ga0070673_100410343 | Ga0070673_1004103432 | 257 |
| 97 | 3300005365 | Ga0070688_100033036 | Ga0070688_1000330362 | 257 |
| 98 | 3300005366 | Ga0070659_100000026 | Ga0070659_10000002665 | 257 |
| 99 | 3300005366 | Ga0070659_100096723 | Ga0070659_1000967232 | 257 |
| 100 | 3300005366 | Ga0070659_100122956 | Ga0070659_1001229562 | 257 |
| 101 | 3300005435 | Ga0070714_100000083 | Ga0070714_10000008369 | 257 |
| 102 | 3300005435 | Ga0070714_100051429 | Ga0070714_1000514292 | 257 |
| 103 | 3300005436 | Ga0070713_100024016 | Ga0070713_1000240163 | 257 |
| 104 | 3300005437 | Ga0070710_10186829 | Ga0070710_101868292 | 257 |
| 105 | 3300005438 | Ga0070701_10269315 | Ga0070701_102693151 | 257 |
| 106 | 3300005439 | Ga0070711_100027746 | Ga0070711_1000277462 | 257 |
| 107 | 3300005439 | Ga0070711_100254907 | Ga0070711_1002549072 | 257 |
| 108 | 3300005441 | Ga0070700_100106186 | Ga0070700_1001061862 | 257 |
| 109 | 3300005456 | Ga0070678_100016305 | Ga0070678_1000163056 | 257 |
| 110 | 3300005466 | Ga0070685_10089732 | Ga0070685_100897322 | 257 |
| 111 | 3300005518 | Ga0070699_100526241 | Ga0070699_1005262411 | 257 |
| 112 | 3300005530 | Ga0070679_100085663 | Ga0070679_1000856633 | 257 |
| 113 | 3300005535 | Ga0070684_100003617 | Ga0070684_1000036172 | 257 |
| 114 | 3300005539 | Ga0068853_100103857 | Ga0068853_1001038573 | 257 |
| 115 | 3300005544 | Ga0070686_100199414 | Ga0070686_1001994142 | 257 |
| 116 | 3300005545 | Ga0070695_100342125 | Ga0070695_1003421252 | 257 |
| 117 | 3300005549 | Ga0070704_100118754 | Ga0070704_1001187542 | 257 |
| 118 | 3300005564 | Ga0070664_100003373 | Ga0070664_10000337314 | 257 |
| 119 | 3300005578 | Ga0068854_100065924 | Ga0068854_1000659243 | 257 |
| 120 | 3300005578 | Ga0068854_100071808 | Ga0068854_1000718082 | 257 |
| 121 | 3300005614 | Ga0068856_100005907 | Ga0068856_10000590711 | 257 |
| 122 | 3300005614 | Ga0068856_100586685 | Ga0068856_1005866852 | 257 |
| 123 | 3300005616 | Ga0068852_100280971 | Ga0068852_1002809712 | 257 |
| 124 | 3300005616 | Ga0068852_100435462 | Ga0068852_1004354622 | 257 |
| 125 | 3300005617 | Ga0068859_100085525 | Ga0068859_1000855252 | 257 |
| 126 | 3300005617 | Ga0068859_100636242 | Ga0068859_1006362422 | 257 |
| 127 | 3300005618 | Ga0068864_100075568 | Ga0068864_1000755682 | 257 |
| 128 | 3300005719 | Ga0068861_100048491 | Ga0068861_1000484913 | 257 |
| 129 | 3300005841 | Ga0068863_100194834 | Ga0068863_1001948342 | 257 |
| 130 | 3300005841 | Ga0068863_100319505 | Ga0068863_1003195052 | 257 |
| 131 | 3300005844 | Ga0068862_100389842 | Ga0068862_1003898422 | 257 |
| 132 | 3300005937 | Ga0081455_10010781 | Ga0081455_100107816 | 257 |
| 133 | 3300005983 | Ga0081540_1001234 | Ga0081540_10012345 | 257 |
| 134 | 3300005985 | Ga0081539_10027906 | Ga0081539_100279062 | 257 |
| 135 | 3300006038 | Ga0075365_10232294 | Ga0075365_102322942 | 257 |
| 136 | 3300006058 | Ga0075432_10018839 | Ga0075432_100188393 | 257 |
| 137 | 3300006173 | Ga0070716_100311498 | Ga0070716_1003114982 | 257 |
| 138 | 3300006175 | Ga0070712_100003760 | Ga0070712_1000037606 | 257 |
| 139 | 3300006847 | Ga0075431_100033246 | Ga0075431_1000332464 | 257 |
| 140 | 3300006852 | Ga0075433_10039591 | Ga0075433_100395914 | 257 |
| 141 | 3300006852 | Ga0075433_10257675 | Ga0075433_102576752 | 257 |
| 142 | 3300006871 | Ga0075434_100023596 | Ga0075434_1000235968 | 257 |
| 143 | 3300006880 | Ga0075429_100249664 | Ga0075429_1002496641 | 257 |
| 144 | 3300006914 | Ga0075436_100042542 | Ga0075436_1000425423 | 257 |
| 145 | 3300006931 | Ga0097620_100085517 | Ga0097620_1000855172 | 257 |
| 146 | 3300006931 | Ga0097620_100636157 | Ga0097620_1006361572 | 257 |
| 147 | 3300009094 | Ga0111539_10038710 | Ga0111539_100387105 | 257 |
| 148 | 3300009094 | Ga0111539_10370025 | Ga0111539_103700251 | 257 |
| 149 | 3300009098 | Ga0105245_10004181 | Ga0105245_100041814 | 257 |
| 150 | 3300009098 | Ga0105245_10080580 | Ga0105245_100805803 | 257 |
| 151 | 3300009098 | Ga0105245_10258404 | Ga0105245_102584042 | 257 |
| 152 | 3300009101 | Ga0105247_10017078 | Ga0105247_100170782 | 257 |
| 153 | 3300009147 | Ga0114129_11199004 | Ga0114129_111990041 | 257 |
| 154 | 3300009148 | Ga0105243_10076332 | Ga0105243_100763321 | 257 |
| 155 | 3300009148 | Ga0105243_10143381 | Ga0105243_101433812 | 257 |
| 156 | 3300009176 | Ga0105242_10267747 | Ga0105242_102677472 | 257 |
| 157 | 3300009177 | Ga0105248_10133732 | Ga0105248_101337322 | 257 |
| 158 | 3300009177 | Ga0105248_10490879 | Ga0105248_104908792 | 257 |
| 159 | 3300009553 | Ga0105249_10356240 | Ga0105249_103562402 | 257 |
| 160 | 3300009553 | Ga0105249_10698988 | Ga0105249_106989882 | 257 |
| 161 | 3300010375 | Ga0105239_10051102 | Ga0105239_100511026 | 257 |
| 162 | 3300011119 | Ga0105246_10099981 | Ga0105246_100999813 | 257 |
| 163 | 3300013296 | Ga0157374_10007098 | Ga0157374_1000709811 | 257 |
| 164 | 3300013306 | Ga0163162_10157124 | Ga0163162_101571243 | 257 |
| 165 | 3300013307 | Ga0157372_10012336 | Ga0157372_100123362 | 257 |
| 166 | 3300013308 | Ga0157375_10017301 | Ga0157375_100173018 | 257 |
| 167 | 3300013308 | Ga0157375_10140072 | Ga0157375_101400722 | 257 |
| 168 | 3300014325 | Ga0163163_10253249 | Ga0163163_102532492 | 257 |
| 169 | 3300014326 | Ga0157380_10286599 | Ga0157380_102865992 | 257 |
| 170 | 3300014745 | Ga0157377_10000822 | Ga0157377_100008223 | 257 |
| 171 | 3300014745 | Ga0157377_10036509 | Ga0157377_100365092 | 257 |
| 172 | 3300014968 | Ga0157379_10002281 | Ga0157379_1000228113 | 257 |
| 173 | 3300014968 | Ga0157379_10160127 | Ga0157379_101601272 | 257 |
| 174 | 3300014969 | Ga0157376_10025716 | Ga0157376_100257167 | 257 |
| 175 | 3300014969 | Ga0157376_10206614 | Ga0157376_102066142 | 257 |
| 176 | 3300021377 | Ga0213874_10016513 | Ga0213874_100165132 | 257 |
| 177 | 3300021384 | Ga0213876_10006252 | Ga0213876_100062525 | 257 |
| 178 | 3300021384 | Ga0213876_10026102 | Ga0213876_100261023 | 257 |
| 179 | 3300021384 | Ga0213876_10134437 | Ga0213876_101344372 | 257 |
| 180 | 3300021384 | Ga0213876_10135711 | Ga0213876_101357111 | 257 |
| 181 | 3300021388 | Ga0213875_10049702 | Ga0213875_100497022 | 257 |
| 182 | 3300021388 | Ga0213875_10181052 | Ga0213875_101810521 | 257 |
| 183 | 3300025898 | Ga0207692_10028496 | Ga0207692_100284962 | 257 |
| 184 | 3300025900 | Ga0207710_10015807 | Ga0207710_100158071 | 257 |
| 185 | 3300025901 | Ga0207688_10000691 | Ga0207688_1000069111 | 257 |
| 186 | 3300025901 | Ga0207688_10021608 | Ga0207688_100216082 | 257 |
| 187 | 3300025903 | Ga0207680_10067852 | Ga0207680_100678522 | 257 |
| 188 | 3300025906 | Ga0207699_10040004 | Ga0207699_100400042 | 257 |
| 189 | 3300025907 | Ga0207645_10025224 | Ga0207645_100252242 | 257 |
| 190 | 3300025908 | Ga0207643_10004422 | Ga0207643_100044223 | 257 |
| 191 | 3300025909 | Ga0207705_10124878 | Ga0207705_101248782 | 257 |
| 192 | 3300025915 | Ga0207693_10010715 | Ga0207693_100107159 | 257 |
| 193 | 3300025915 | Ga0207693_10073893 | Ga0207693_100738932 | 257 |
| 194 | 3300025915 | Ga0207693_10156959 | Ga0207693_101569592 | 257 |
| 195 | 3300025916 | Ga0207663_10250335 | Ga0207663_102503352 | 257 |
| 196 | 3300025918 | Ga0207662_10111475 | Ga0207662_101114752 | 257 |
| 197 | 3300025918 | Ga0207662_10197723 | Ga0207662_101977231 | 257 |
| 198 | 3300025918 | Ga0207662_10272900 | Ga0207662_102729002 | 257 |
| 199 | 3300025919 | Ga0207657_10052831 | Ga0207657_100528314 | 257 |
| 200 | 3300025919 | Ga0207657_10066688 | Ga0207657_100666882 | 257 |
| 201 | 3300025919 | Ga0207657_10199289 | Ga0207657_101992892 | 257 |
| 202 | 3300025921 | Ga0207652_10012226 | Ga0207652_100122266 | 257 |
| 203 | 3300025923 | Ga0207681_10057966 | Ga0207681_100579662 | 257 |
| 204 | 3300025924 | Ga0207694_10400915 | Ga0207694_104009152 | 257 |
| 205 | 3300025927 | Ga0207687_10161996 | Ga0207687_101619962 | 257 |
| 206 | 3300025927 | Ga0207687_10396423 | Ga0207687_103964231 | 257 |
| 207 | 3300025928 | Ga0207700_10037394 | Ga0207700_100373943 | 257 |
| 208 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006345 | 257 |
| 209 | 3300025929 | Ga0207664_10004303 | Ga0207664_100043039 | 257 |
| 210 | 3300025929 | Ga0207664_10189025 | Ga0207664_101890252 | 257 |
| 211 | 3300025932 | Ga0207690_10000098 | Ga0207690_1000009830 | 257 |
| 212 | 3300025932 | Ga0207690_10059478 | Ga0207690_100594783 | 257 |
| 213 | 3300025933 | Ga0207706_10046911 | Ga0207706_100469112 | 257 |
| 214 | 3300025934 | Ga0207686_10201644 | Ga0207686_102016442 | 257 |
| 215 | 3300025935 | Ga0207709_10032271 | Ga0207709_100322712 | 257 |
| 216 | 3300025935 | Ga0207709_10097016 | Ga0207709_100970162 | 257 |
| 217 | 3300025935 | Ga0207709_10170193 | Ga0207709_101701932 | 257 |
| 218 | 3300025937 | Ga0207669_10082238 | Ga0207669_100822382 | 257 |
| 219 | 3300025937 | Ga0207669_10149399 | Ga0207669_101493992 | 257 |
| 220 | 3300025938 | Ga0207704_10087667 | Ga0207704_100876672 | 257 |
| 221 | 3300025942 | Ga0207689_10040643 | Ga0207689_100406435 | 257 |
| 222 | 3300025942 | Ga0207689_10064905 | Ga0207689_100649052 | 257 |
| 223 | 3300025944 | Ga0207661_10417873 | Ga0207661_104178732 | 257 |
| 224 | 3300025945 | Ga0207679_10130024 | Ga0207679_101300242 | 257 |
| 225 | 3300025945 | Ga0207679_10282205 | Ga0207679_102822052 | 257 |
| 226 | 3300025960 | Ga0207651_10498057 | Ga0207651_104980571 | 257 |
| 227 | 3300025981 | Ga0207640_10131560 | Ga0207640_101315602 | 257 |
| 228 | 3300025981 | Ga0207640_10147320 | Ga0207640_101473201 | 257 |
| 229 | 3300026023 | Ga0207677_10203133 | Ga0207677_102031332 | 257 |
| 230 | 3300026067 | Ga0207678_10053507 | Ga0207678_100535073 | 257 |
| 231 | 3300026067 | Ga0207678_10286386 | Ga0207678_102863862 | 257 |
| 232 | 3300026075 | Ga0207708_10003393 | Ga0207708_100033939 | 257 |
| 233 | 3300026088 | Ga0207641_10058565 | Ga0207641_100585654 | 257 |
| 234 | 3300026088 | Ga0207641_10244413 | Ga0207641_102444131 | 257 |
| 235 | 3300026089 | Ga0207648_10100590 | Ga0207648_101005902 | 257 |
| 236 | 3300026095 | Ga0207676_10018388 | Ga0207676_100183888 | 257 |
| 237 | 3300026116 | Ga0207674_10054859 | Ga0207674_100548592 | 257 |
| 238 | 3300026118 | Ga0207675_100491963 | Ga0207675_1004919632 | 257 |
| 239 | 3300026121 | Ga0207683_10249791 | Ga0207683_102497911 | 257 |
| 240 | 3300026142 | Ga0207698_10055350 | Ga0207698_100553502 | 257 |
| 241 | 3300026142 | Ga0207698_10323847 | Ga0207698_103238472 | 257 |
| 242 | 3300027907 | Ga0207428_10013418 | Ga0207428_100134185 | 257 |
| 243 | 3300028380 | Ga0268265_10080998 | Ga0268265_100809982 | 257 |
| 244 | 3300031901 | Ga0307406_10308357 | Ga0307406_103083571 | 257 |
| 245 | 3300032002 | Ga0307416_100347719 | Ga0307416_1003477191 | 257 |
| 246 | 3300035725 | Ga0373947_0220936 | Ga0373947_0220936_57_908 | 257 |
| 247 | 3300037418 | Ga0395900_0611964 | Ga0395900_0611964_49_900 | 257 |
| 248 | 3300037466 | Ga0395898_0046905 | Ga0395898_0046905_287_1138 | 257 |
| 249 | 3300037853 | Ga0436364_0520142 | Ga0436364_0520142_298_1155 | 257 |
| 250 | 3300037853 | Ga0436364_0575671 | Ga0436364_0575671_4710_5594 | 257 |
| 251 | 3300037853 | Ga0436364_0830799 | Ga0436364_0830799_119_982 | 257 |
| 252 | 3300037853 | Ga0436364_1142787 | Ga0436364_1142787_1445_2302 | 257 |
| 253 | 3300037853 | Ga0436364_1382614 | Ga0436364_1382614_3057_3914 | 257 |
| 254 | 3300038443 | Ga0395901_0070917 | Ga0395901_0070917_2353_3204 | 257 |
| 255 | 3300039437 | Ga0436365_0627820 | Ga0436365_0627820_6074_6931 | 257 |
| 256 | 3300039437 | Ga0436365_0838755 | Ga0436365_0838755_246_1106 | 257 |
| 257 | 3300039437 | Ga0436365_0944756 | Ga0436365_0944756_58_921 | 257 |
| 258 | 3300039437 | Ga0436365_1044040 | Ga0436365_1044040_103_960 | 257 |
| 259 | 3300039437 | Ga0436365_1108574 | Ga0436365_1108574_2694_3557 | 257 |
| 260 | 3300039437 | Ga0436365_1373684 | Ga0436365_1373684_104_955 | 257 |
| 261 | 3300039437 | Ga0436365_1826901 | Ga0436365_1826901_6288_7151 | 257 |
| 262 | 3300039437 | Ga0436365_1839438 | Ga0436365_1839438_745_1629 | 257 |
| 263 | 3300039450 | Ga0436363_0449139 | Ga0436363_0449139_19_873 | 257 |
| 264 | 3300039450 | Ga0436363_0678117 | Ga0436363_0678117_32032_32892 | 257 |
| 265 | 3300039453 | Ga0436362_0575825 | Ga0436362_0575825_1169_2026 | 257 |
| 266 | 3300044684 | Ga0466966_0020653 | Ga0466966_0020653_1056_1907 | 257 |
| 267 | 3300044684 | Ga0466966_0140138 | Ga0466966_0140138_576_1436 | 257 |
| 268 | 3300044684 | Ga0466966_0143686 | Ga0466966_0143686_59_916 | 257 |
| 269 | 3300044694 | Ga0466963_0018438 | Ga0466963_0018438_331_1194 | 257 |
| 270 | 3300044694 | Ga0466963_0228665 | Ga0466963_0228665_190_1047 | 257 |
| 271 | 3300044694 | Ga0466963_0342138 | Ga0466963_0342138_41_898 | 257 |
| 272 | 3300044706 | Ga0466964_0048542 | Ga0466964_0048542_271_1128 | 257 |
| 273 | 3300044719 | Ga0466971_0011751 | Ga0466971_0011751_2171_3034 | 257 |
| 274 | 3300044735 | Ga0466968_0149135 | Ga0466968_0149135_198_1061 | 257 |
| 275 | 3300044842 | Ga0466957_0007335 | Ga0466957_0007335_1330_2187 | 257 |
| 276 | 3300044842 | Ga0466957_0169153 | Ga0466957_0169153_267_1130 | 257 |
| 277 | 3300044901 | Ga0466960_0000037 | Ga0466960_0000037_42488_43339 | 257 |
| 278 | 3300045049 | Ga0466959_0011476 | Ga0466959_0011476_3904_4761 | 257 |
| 279 | 3300045049 | Ga0466959_0109536 | Ga0466959_0109536_314_1180 | 257 |
| 280 | 3300045049 | Ga0466959_0116488 | Ga0466959_0116488_341_1189 | 257 |
| 281 | 3300045049 | Ga0466959_0162454 | Ga0466959_0162454_460_1311 | 257 |
| 282 | 3300045049 | Ga0466959_0233517 | Ga0466959_0233517_191_1054 | 257 |
| 283 | 3300045049 | Ga0466959_0380084 | Ga0466959_0380084_93_950 | 257 |
| 284 | 3300045836 | Ga0466958_0001567 | Ga0466958_0001567_1030_1887 | 257 |
| 285 | 3300045836 | Ga0466958_0010758 | Ga0466958_0010758_867_1730 | 257 |
| 286 | 3300045836 | Ga0466958_0038051 | Ga0466958_0038051_1964_2827 | 257 |
| 287 | 3300045836 | Ga0466958_0088539 | Ga0466958_0088539_489_1352 | 257 |
| 288 | 3300045836 | Ga0466958_0158572 | Ga0466958_0158572_497_1354 | 257 |
| 289 | 3300045836 | Ga0466958_0340405 | Ga0466958_0340405_84_947 | 257 |
| 290 | 3300045976 | Ga0466967_0067584 | Ga0466967_0067584_1628_2485 | 257 |
| 291 | 3300045976 | Ga0466967_0138997 | Ga0466967_0138997_174_1037 | 257 |
| 292 | 3300045976 | Ga0466967_0373136 | Ga0466967_0373136_457_1320 | 257 |
| 293 | 3300045976 | Ga0466967_0709762 | Ga0466967_0709762_67_930 | 257 |
| 294 | 3300046511 | Ga0495608_0109236 | Ga0495608_0109236_824_1681 | 257 |
| 295 | 3300046615 | Ga0495656_0006425 | Ga0495656_0006425_1861_2712 | 257 |
| 296 | 3300047471 | Ga0495684_0001764 | Ga0495684_0001764_12117_12968 | 257 |
| 297 | 3300048903 | Ga0496100_0000534 | Ga0496100_0000534_6305_7156 | 257 |
| 298 | 3300048903 | Ga0496100_0008692 | Ga0496100_0008692_4163_5014 | 257 |
| 299 | 3300048903 | Ga0496100_0029937 | Ga0496100_0029937_1660_2514 | 257 |
| 300 | 3300048903 | Ga0496100_0080410 | Ga0496100_0080410_862_1713 | 257 |
| 301 | 3300048904 | Ga0496101_0001866 | Ga0496101_0001866_10553_11404 | 257 |
| 302 | 3300048905 | Ga0496102_0089693 | Ga0496102_0089693_178_1032 | 257 |
| 303 | 3300048905 | Ga0496102_0107356 | Ga0496102_0107356_100_951 | 257 |
| 304 | 3300048905 | Ga0496102_0557733 | Ga0496102_0557733_143_994 | 257 |
| 305 | 3300048906 | Ga0496103_0018758 | Ga0496103_0018758_367_1221 | 257 |
| 306 | 3300048907 | Ga0496104_0016491 | Ga0496104_0016491_5390_6241 | 257 |
| 307 | 3300048907 | Ga0496104_0051969 | Ga0496104_0051969_2804_3655 | 257 |
| 308 | 3300048907 | Ga0496104_0639644 | Ga0496104_0639644_71_922 | 257 |
| 309 | 3300048908 | Ga0496105_0018448 | Ga0496105_0018448_760_1614 | 257 |
| 310 | 3300048908 | Ga0496105_0061387 | Ga0496105_0061387_227_1078 | 257 |
| 311 | 3300048908 | Ga0496105_0132750 | Ga0496105_0132750_1019_1870 | 257 |
| 312 | 3300048908 | Ga0496105_0216164 | Ga0496105_0216164_55_906 | 257 |
| 313 | 3300048909 | Ga0496106_0021970 | Ga0496106_0021970_1686_2540 | 257 |
| 314 | 3300048911 | Ga0496108_0030684 | Ga0496108_0030684_305_1156 | 257 |
| 315 | 3300048911 | Ga0496108_0325736 | Ga0496108_0325736_426_1280 | 257 |
| 316 | 3300048912 | Ga0496109_0008446 | Ga0496109_0008446_3965_4816 | 257 |
| 317 | 3300048912 | Ga0496109_0010278 | Ga0496109_0010278_5928_6779 | 257 |
| 318 | 3300048912 | Ga0496109_0050143 | Ga0496109_0050143_1494_2348 | 257 |
| 319 | 3300048912 | Ga0496109_0052228 | Ga0496109_0052228_2202_3053 | 257 |
| 320 | 3300048912 | Ga0496109_0084226 | Ga0496109_0084226_2054_2905 | 257 |
| 321 | 3300048912 | Ga0496109_0133873 | Ga0496109_0133873_938_1789 | 257 |
| 322 | 3300048912 | Ga0496109_0200979 | Ga0496109_0200979_118_969 | 257 |
| 323 | 3300048912 | Ga0496109_0306400 | Ga0496109_0306400_270_1121 | 257 |
| 324 | 3300048913 | Ga0496110_0004098 | Ga0496110_0004098_8348_9199 | 257 |
| 325 | 3300048913 | Ga0496110_0022592 | Ga0496110_0022592_2827_3681 | 257 |
| 326 | 3300048913 | Ga0496110_0068099 | Ga0496110_0068099_1405_2256 | 257 |
| 327 | 3300048913 | Ga0496110_0163146 | Ga0496110_0163146_945_1796 | 257 |
| 328 | 3300048914 | Ga0496111_0048481 | Ga0496111_0048481_1174_2025 | 257 |
| 329 | 3300048914 | Ga0496111_0064209 | Ga0496111_0064209_70_924 | 257 |
| 330 | 3300048914 | Ga0496111_0134451 | Ga0496111_0134451_923_1774 | 257 |
| 331 | 3300048915 | Ga0496112_0000401 | Ga0496112_0000401_21864_22715 | 257 |
| 332 | 3300048915 | Ga0496112_0006492 | Ga0496112_0006492_3096_3947 | 257 |
| 333 | 3300048915 | Ga0496112_0226221 | Ga0496112_0226221_938_1789 | 257 |
| 334 | 3300048915 | Ga0496112_0351107 | Ga0496112_0351107_95_946 | 257 |
| 335 | 3300048915 | Ga0496112_0354067 | Ga0496112_0354067_426_1277 | 257 |
| 336 | 3300048915 | Ga0496112_0672816 | Ga0496112_0672816_101_952 | 257 |
| 337 | 3300048916 | Ga0496113_0022346 | Ga0496113_0022346_940_1794 | 257 |
| 338 | 3300048916 | Ga0496113_0055366 | Ga0496113_0055366_315_1166 | 257 |
| 339 | 3300048916 | Ga0496113_0128244 | Ga0496113_0128244_603_1454 | 257 |
| 340 | 3300048916 | Ga0496113_0147630 | Ga0496113_0147630_905_1756 | 257 |
| 341 | 3300048917 | Ga0496114_0285470 | Ga0496114_0285470_552_1403 | 257 |
| 342 | 3300048918 | Ga0496115_0042014 | Ga0496115_0042014_2239_3090 | 257 |
| 343 | 3300049571 | Ga0501034_0097897 | Ga0501034_0097897_1341_2192 | 257 |
| 344 | 3300049583 | Ga0501067_0048818 | Ga0501067_0048818_931_1782 | 257 |
| 345 | 3300050512 | nmdc:mga0n895_204385_c1 | nmdc:mga0n895_204385_c1_960_1814 | 257 |
| 346 | 3300050513 | nmdc:mga0rr50_337555_c1 | nmdc:mga0rr50_337555_c1_157_1011 | 257 |
| 347 | 3300050514 | nmdc:mga08x19_117882_c1 | nmdc:mga08x19_117882_c1_648_1502 | 257 |
| 348 | 3300050515 | nmdc:mga0a205_332636_c1 | nmdc:mga0a205_332636_c1_57_908 | 257 |
| 349 | 3300050515 | nmdc:mga0a205_336139_c1 | nmdc:mga0a205_336139_c1_158_1012 | 257 |
| 350 | 3300050515 | nmdc:mga0a205_78951_c1 | nmdc:mga0a205_78951_c1_1150_2004 | 257 |
| 351 | 3300053153 | Ga0500616_0004399 | Ga0500616_0004399_4266_5117 | 257 |
| 352 | 3300061719 | Ga0466962_0089210 | Ga0466962_0089210_408_1271 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p52-assembly1.cif.gz_A | crystal structure of homoserine kinase from cytophaga hutchinsonii atcc 33406, nysgrc target 032717. | 0.8869 | 4 | 255 |
| 5wat-assembly1.cif.gz_B | corynebacterium glutamicum full length homoserine kinase | 0.8691 | 1 | 255 |
| 4p52-assembly1.cif.gz_A | crystal structure of homoserine kinase from cytophaga hutchinsonii atcc 33406, nysgrc target 032717. | 0.8678 | 4 | 255 |
| 5wat-assembly1.cif.gz_B | corynebacterium glutamicum full length homoserine kinase | 0.8595 | 1 | 255 |
| 3hul-assembly1.cif.gz_A-2 | structure of putative homoserine kinase thrb from listeria monocytogenes | 0.8586 | 5 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYV2_166_287_3.30.70.890 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain | 0.8981 | 149 | 239 | 3.30.70.890 |
| af_Q4DQQ2_7_172_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.894 | 6 | 145 | 3.30.230.10 |
| 3hulB01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8936 | 5 | 141 | 3.30.230.10 |
| af_P9WKE7_13_177_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8751 | 6 | 142 | 3.30.230.10 |
| af_Q2FYV2_4_165_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8721 | 6 | 144 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0RC14-F1-model_v4 | Homoserine kinase | 0.9736 | 1 | 200 |
GO:0005524
GO:0008652 GO:0016020 GO:0016301 |
| AF-A0A7V9J7L6-F1-model_v4 | Homoserine kinase (HK) (HSK) (EC 2.7.1.39) | 0.9711 | 1 | 257 |
GO:0004413
GO:0005524 GO:0005737 GO:0009088 |
| AF-A0A7V9J7L6-F1-model_v4 | Homoserine kinase (HK) (HSK) (EC 2.7.1.39) | 0.9674 | 1 | 257 |
GO:0004413
GO:0005524 GO:0005737 GO:0009088 |
| AF-A0A838V2K4-F1-model_v4 | Homoserine kinase (HK) (HSK) (EC 2.7.1.39) | 0.965 | 1 | 257 |
GO:0004413
GO:0005524 GO:0005737 GO:0009088 |
| AF-A0A838V2K4-F1-model_v4 | Homoserine kinase (HK) (HSK) (EC 2.7.1.39) | 0.9613 | 1 | 257 |
GO:0004413
GO:0005524 GO:0005737 GO:0009088 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar