F419101

General Info

Members Datasets Scaffolds Average Seq Length
352 198 352 279

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1132411|Ga0436364_1132411_16092_17009
Length 295
Sequence VANLGSIWAKIHHTPWAAVAMSLARRRLIRVPASSANLGPGFDVLAAALALHLELEVCETGSFAVHTDLPVRRDRDNLVVRAFERLHPADGFEFTITSNIPLSGGLGSSAAAIVAGLVAADHLFELDADVLGIAAELEGHGFVVCNDGRAHRFEPPMGLEAVLVVPNEAVQTDRARAALPESVPRDDAVFNLAHASMLMLGLATADWELISAGLQDRLHQPQRAHLYPRSVGLLCRARSLGALGATISGAGPTVLVWCTYEQTGPLLEALQRETEGWATVMRGRFEAQGADVRAI

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 15.34
Rhizosphere 74.43
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10112777 3300005327 Bacteria 2254
2 Ga0070676_10059871 3300005328 Bacteria 2260
3 Ga0070683_100000645 3300005329 Bacteria 25129
4 Ga0070683_100191131 3300005329 Bacteria 1944
5 Ga0070683_100645819 3300005329 Bacteria 1013
6 Ga0068869_100013296 3300005334 Bacteria 5471
7 Ga0070682_100007928 3300005337 Bacteria 5974
8 Ga0070682_100094279 3300005337 Bacteria 1963
9 Ga0068868_100016666 3300005338 Bacteria 5463
10 Ga0068868_100068431 3300005338 Bacteria 2827
11 Ga0070660_100095567 3300005339 Bacteria 2349
12 Ga0070660_100257580 3300005339 Bacteria 1424
13 Ga0070669_100091181 3300005353 Bacteria 2285
14 Ga0070675_100074866 3300005354 Bacteria 2814
15 Ga0070673_100410343 3300005364 Bacteria 1213
16 Ga0070688_100033036 3300005365 Bacteria 3125
17 Ga0070659_100000026 3300005366 Bacteria 143542
18 Ga0070659_100096723 3300005366 Bacteria 2372
19 Ga0070659_100122956 3300005366 Bacteria 2103
20 Ga0070714_100000083 3300005435 Bacteria 81010
21 Ga0070714_100051429 3300005435 Bacteria 3512
22 Ga0070713_100024016 3300005436 Bacteria 4741
23 Ga0070710_10186829 3300005437 Bacteria 1301
24 Ga0070701_10269315 3300005438 Bacteria 1036
25 Ga0070711_100027746 3300005439 Bacteria 3719
26 Ga0070711_100254907 3300005439 Bacteria 1378
27 Ga0070705_100160829 3300005440 Bacteria 1501
28 Ga0070700_100106186 3300005441 Bacteria 1858
29 Ga0070678_100016305 3300005456 Bacteria 4751
30 Ga0070685_10089732 3300005466 Bacteria 1858
31 Ga0070707_100526401 3300005468 Unclassified 1144
32 Ga0070699_100526241 3300005518 Bacteria 1075
33 Ga0070679_100085663 3300005530 Bacteria 3138
34 Ga0070684_100003617 3300005535 Bacteria 11636
35 Ga0068853_100103857 3300005539 Bacteria 2516
36 Ga0070686_100199414 3300005544 Bacteria 1433
37 Ga0070695_100342125 3300005545 Bacteria 1118
38 Ga0070704_100118754 3300005549 Bacteria 2026
39 Ga0070664_100003373 3300005564 Bacteria 12904
40 Ga0068854_100065924 3300005578 Bacteria 2634
41 Ga0068854_100071808 3300005578 Bacteria 2533
42 Ga0068856_100005907 3300005614 Bacteria 12057
43 Ga0068856_100586685 3300005614 Bacteria 1136
44 Ga0068852_100280971 3300005616 Bacteria 1605
45 Ga0068852_100435462 3300005616 Bacteria 1295
46 Ga0068859_100085525 3300005617 Bacteria 3199
47 Ga0068859_100636242 3300005617 Bacteria 1159
48 Ga0068864_100075568 3300005618 Bacteria 2942
49 Ga0068861_100048491 3300005719 Bacteria 3211
50 Ga0068863_100194834 3300005841 Bacteria 1948
51 Ga0068863_100319505 3300005841 Bacteria 1508
52 Ga0068862_100389842 3300005844 Bacteria 1301
53 Ga0081455_10010781 3300005937 Bacteria 9235
54 Ga0081540_1001234 3300005983 Bacteria 22306
55 Ga0081539_10027906 3300005985 Bacteria 3563
56 Ga0070717_10000004 3300006028 Bacteria 365525
57 Ga0075365_10232294 3300006038 Bacteria 1295
58 Ga0075432_10018839 3300006058 Bacteria 2356
59 Ga0070716_100311498 3300006173 Bacteria 1099
60 Ga0070712_100000008 3300006175 Bacteria 149644
61 Ga0070712_100003760 3300006175 Bacteria 9350
62 Ga0075431_100033246 3300006847 Bacteria 5315
63 Ga0075433_10039591 3300006852 Bacteria 4076
64 Ga0075433_10257675 3300006852 Bacteria 1547
65 Ga0075434_100023596 3300006871 Bacteria 5998
66 Ga0075429_100249664 3300006880 Bacteria 1554
67 Ga0075436_100042542 3300006914 Bacteria 3133
68 Ga0097620_100085517 3300006931 Bacteria 3199
69 Ga0097620_100636157 3300006931 Bacteria 1159
70 Ga0111539_10038710 3300009094 Bacteria 5755
71 Ga0111539_10370025 3300009094 Bacteria 1668
72 Ga0105245_10004181 3300009098 Bacteria 12821
73 Ga0105245_10080580 3300009098 Bacteria 2974
74 Ga0105245_10258404 3300009098 Bacteria 1694
75 Ga0105247_10017078 3300009101 Bacteria 4357
76 Ga0114129_11199004 3300009147 Bacteria 946
77 Ga0105243_10076332 3300009148 Bacteria 2722
78 Ga0105243_10143381 3300009148 Bacteria 2041
79 Ga0105243_10354058 3300009148 Bacteria 1349
80 Ga0105242_10267747 3300009176 Bacteria 1546
81 Ga0105248_10133732 3300009177 Bacteria 2798
82 Ga0105248_10490879 3300009177 Bacteria 1384
83 Ga0105249_10356240 3300009553 Bacteria 1483
84 Ga0105249_10698988 3300009553 Bacteria 1074
85 Ga0105239_10051102 3300010375 Bacteria 4532
86 Ga0105239_11208299 3300010375 Bacteria 871
87 Ga0105246_10099981 3300011119 Bacteria 2109
88 Ga0157374_10007098 3300013296 Bacteria 9536
89 Ga0163162_10157124 3300013306 Bacteria 2394
90 Ga0157372_10012336 3300013307 Bacteria 9107
91 Ga0157375_10017301 3300013308 Bacteria 6503
92 Ga0157375_10140072 3300013308 Bacteria 2545
93 Ga0163163_10253249 3300014325 Bacteria 1811
94 Ga0157380_10286599 3300014326 Bacteria 1510
95 Ga0157377_10000822 3300014745 Bacteria 12885
96 Ga0157377_10036509 3300014745 Bacteria 2704
97 Ga0157379_10002281 3300014968 Bacteria 15981
98 Ga0157379_10160127 3300014968 Bacteria 2032
99 Ga0157376_10025716 3300014969 Bacteria 4639
100 Ga0157376_10206614 3300014969 Bacteria 1810
101 Ga0213874_10016513 3300021377 Bacteria 1966
102 Ga0213876_10006252 3300021384 Bacteria 6495
103 Ga0213876_10013367 3300021384 Bacteria 4362
104 Ga0213876_10026102 3300021384 Bacteria 3081
105 Ga0213876_10134437 3300021384 Bacteria 1315
106 Ga0213876_10135711 3300021384 Bacteria 1309
107 Ga0213875_10049702 3300021388 Bacteria 1965
108 Ga0213875_10181052 3300021388 Bacteria 990
109 Ga0207426_1007432 3300025302 Bacteria 4589
110 Ga0207692_10028496 3300025898 Bacteria 2642
111 Ga0207710_10015807 3300025900 Bacteria 3192
112 Ga0207688_10000691 3300025901 Bacteria 16661
113 Ga0207688_10021608 3300025901 Bacteria 3518
114 Ga0207680_10067852 3300025903 Bacteria 2198
115 Ga0207699_10040004 3300025906 Bacteria 2698
116 Ga0207645_10025224 3300025907 Bacteria 3847
117 Ga0207643_10004422 3300025908 Bacteria 7559
118 Ga0207705_10124878 3300025909 Bacteria 1912
119 Ga0207671_10005669 3300025914 Bacteria 11415
120 Ga0207693_10000002 3300025915 Bacteria 304011
121 Ga0207693_10010715 3300025915 Bacteria 7440
122 Ga0207693_10073893 3300025915 Bacteria 2669
123 Ga0207693_10156959 3300025915 Bacteria 1790
124 Ga0207663_10250335 3300025916 Bacteria 1303
125 Ga0207662_10111475 3300025918 Bacteria 1706
126 Ga0207662_10197723 3300025918 Bacteria 1300
127 Ga0207662_10272900 3300025918 Bacteria 1117
128 Ga0207657_10052831 3300025919 Bacteria 3524
129 Ga0207657_10066688 3300025919 Bacteria 3063
130 Ga0207657_10199289 3300025919 Bacteria 1611
131 Ga0207652_10012226 3300025921 Bacteria 6935
132 Ga0207646_10170390 3300025922 Bacteria 1966
133 Ga0207681_10057966 3300025923 Bacteria 2650
134 Ga0207681_10070560 3300025923 Bacteria 2433
135 Ga0207694_10400915 3300025924 Bacteria 1141
136 Ga0207687_10161996 3300025927 Bacteria 1718
137 Ga0207687_10396423 3300025927 Bacteria 1134
138 Ga0207700_10037394 3300025928 Bacteria 3515
139 Ga0207664_10000006 3300025929 Bacteria 408702
140 Ga0207664_10004303 3300025929 Bacteria 9639
141 Ga0207664_10189025 3300025929 Bacteria 1772
142 Ga0207690_10000098 3300025932 Bacteria 71853
143 Ga0207690_10059478 3300025932 Bacteria 2589
144 Ga0207706_10046911 3300025933 Bacteria 3824
145 Ga0207686_10201644 3300025934 Bacteria 1425
146 Ga0207709_10032271 3300025935 Bacteria 3065
147 Ga0207709_10097016 3300025935 Bacteria 1940
148 Ga0207709_10170193 3300025935 Bacteria 1528
149 Ga0207669_10082238 3300025937 Bacteria 2067
150 Ga0207669_10149399 3300025937 Bacteria 1634
151 Ga0207704_10087667 3300025938 Bacteria 2033
152 Ga0207689_10040643 3300025942 Bacteria 3849
153 Ga0207689_10064905 3300025942 Bacteria 3003
154 Ga0207661_10058057 3300025944 Bacteria 3114
155 Ga0207661_10417873 3300025944 Bacteria 1218
156 Ga0207679_10130024 3300025945 Bacteria 2018
157 Ga0207679_10282205 3300025945 Bacteria 1425
158 Ga0207651_10498057 3300025960 Bacteria 1053
159 Ga0207640_10131560 3300025981 Bacteria 1809
160 Ga0207640_10147320 3300025981 Bacteria 1724
161 Ga0207640_10201214 3300025981 Bacteria 1510
162 Ga0207677_10203133 3300026023 Bacteria 1577
163 Ga0207677_10680253 3300026023 Bacteria 911
164 Ga0207678_10053507 3300026067 Bacteria 3478
165 Ga0207678_10286386 3300026067 Bacteria 1415
166 Ga0207708_10003393 3300026075 Bacteria 11731
167 Ga0207641_10058565 3300026088 Bacteria 3279
168 Ga0207641_10244413 3300026088 Bacteria 1674
169 Ga0207648_10100590 3300026089 Bacteria 2533
170 Ga0207676_10018388 3300026095 Bacteria 5080
171 Ga0207674_10054859 3300026116 Bacteria 4055
172 Ga0207675_100491963 3300026118 Bacteria 1220
173 Ga0207683_10249791 3300026121 Bacteria 1619
174 Ga0207698_10055350 3300026142 Bacteria 3057
175 Ga0207698_10323847 3300026142 Bacteria 1445
176 Ga0207428_10013418 3300027907 Bacteria 7159
177 Ga0268265_10080998 3300028380 Bacteria 2562
178 Ga0265319_1000544 3300028563 Bacteria 25627
179 Ga0265320_10039201 3300031240 Bacteria 2371
180 Ga0307406_10308357 3300031901 Bacteria 1219
181 Ga0307416_100347719 3300032002 Bacteria 1499
182 Ga0373927_0298181 3300035695 Bacteria 1061
183 Ga0373947_0220936 3300035725 Bacteria 1245
184 Ga0373937_0006516 3300036401 Bacteria 10078
185 Ga0395900_0264338 3300037418 Bacteria 1717
186 Ga0395900_0611964 3300037418 Bacteria 1029
187 Ga0395898_0046905 3300037466 Bacteria 4243
188 Ga0395898_0274162 3300037466 Bacteria 1609
189 Ga0436364_0200518 3300037853 Bacteria 1904
190 Ga0436364_0520142 3300037853 Bacteria 2720
191 Ga0436364_0575671 3300037853 Bacteria 7609
192 Ga0436364_0830799 3300037853 Bacteria 3525
193 Ga0436364_0920241 3300037853 Bacteria 1547
194 Ga0436364_1132411 3300037853 Bacteria 58691
195 Ga0436364_1142787 3300037853 Bacteria 6981
196 Ga0436364_1150642 3300037853 Bacteria 1231
197 Ga0436364_1382614 3300037853 Bacteria 17798
198 Ga0395901_0070917 3300038443 Bacteria 3630
199 Ga0395901_0140427 3300038443 Bacteria 2539
200 Ga0436365_0262453 3300039437 Bacteria 28030
201 Ga0436365_0627820 3300039437 Bacteria 7220
202 Ga0436365_0677843 3300039437 Bacteria 4410
203 Ga0436365_0838755 3300039437 Bacteria 2137
204 Ga0436365_0944756 3300039437 Bacteria 2314
205 Ga0436365_1044040 3300039437 Bacteria 2856
206 Ga0436365_1108574 3300039437 Bacteria 4739
207 Ga0436365_1174289 3300039437 Bacteria 19637
208 Ga0436365_1373684 3300039437 Bacteria 1344
209 Ga0436365_1757939 3300039437 Bacteria 2849
210 Ga0436365_1826901 3300039437 Bacteria 15104
211 Ga0436365_1839438 3300039437 Bacteria 3219
212 Ga0436360_0252082 3300039438 Bacteria 4238
213 Ga0436363_0403902 3300039450 Bacteria 8557
214 Ga0436363_0449139 3300039450 Bacteria 1936
215 Ga0436363_0678117 3300039450 Bacteria 33768
216 Ga0436362_0290643 3300039453 Bacteria 5761
217 Ga0436362_0575825 3300039453 Bacteria 3209
218 Ga0436362_1224300 3300039453 Bacteria 1171
219 Ga0451853_3803240 3300041512 Bacteria 1455
220 Ga0466966_0020653 3300044684 Bacteria 4328
221 Ga0466966_0045528 3300044684 Bacteria 2805
222 Ga0466966_0140138 3300044684 Bacteria 1478
223 Ga0466966_0143686 3300044684 Bacteria 1457
224 Ga0466963_0018438 3300044694 Bacteria 4364
225 Ga0466963_0064727 3300044694 Bacteria 2450
226 Ga0466963_0228665 3300044694 Bacteria 1303
227 Ga0466963_0342138 3300044694 Bacteria 1053
228 Ga0466964_0048542 3300044706 Bacteria 1736
229 Ga0466971_0011751 3300044719 Bacteria 3835
230 Ga0466968_0039588 3300044735 Bacteria 1985
231 Ga0466968_0149135 3300044735 Bacteria 1074
232 Ga0466957_0007335 3300044842 Bacteria 6231
233 Ga0466957_0169153 3300044842 Bacteria 1423
234 Ga0466957_0262067 3300044842 Bacteria 1152
235 Ga0466960_0000037 3300044901 Bacteria 43394
236 Ga0466959_0008217 3300045049 Bacteria 7363
237 Ga0466959_0011476 3300045049 Bacteria 6369
238 Ga0466959_0109536 3300045049 Bacteria 1972
239 Ga0466959_0116488 3300045049 Bacteria 1903
240 Ga0466959_0162454 3300045049 Bacteria 1570
241 Ga0466959_0233517 3300045049 Bacteria 1272
242 Ga0466959_0380084 3300045049 Bacteria 961
243 Ga0466959_0474355 3300045049 Bacteria 847
244 Ga0466958_0001567 3300045836 Bacteria 10965
245 Ga0466958_0010758 3300045836 Bacteria 5132
246 Ga0466958_0021974 3300045836 Bacteria 3731
247 Ga0466958_0038051 3300045836 Bacteria 2885
248 Ga0466958_0088539 3300045836 Bacteria 1913
249 Ga0466958_0158572 3300045836 Bacteria 1429
250 Ga0466958_0340405 3300045836 Bacteria 965
251 Ga0466967_0067584 3300045976 Bacteria 3188
252 Ga0466967_0138997 3300045976 Bacteria 2261
253 Ga0466967_0373136 3300045976 Bacteria 1384
254 Ga0466967_0709762 3300045976 Bacteria 996
255 Ga0495592_0070591 3300046454 Bacteria 2544
256 Ga0495651_0006035 3300046462 Bacteria 9249
257 Ga0495653_0039669 3300046463 Bacteria 3687
258 Ga0495639_0150130 3300046475 Bacteria 1124
259 Ga0495608_0005776 3300046511 Bacteria 8813
260 Ga0495608_0109236 3300046511 Bacteria 1779
261 Ga0495628_0059195 3300046516 Bacteria 3008
262 Ga0495587_0043741 3300046536 Bacteria 2666
263 Ga0495667_0007367 3300046559 Bacteria 7462
264 Ga0495656_0006425 3300046615 Bacteria 4125
265 Ga0495634_0138994 3300046642 Bacteria 1543
266 Ga0495635_0007467 3300046663 Bacteria 7631
267 Ga0495657_0002620 3300046675 Bacteria 15053
268 Ga0495599_0149988 3300046678 Bacteria 1444
269 Ga0495604_0037728 3300047317 Bacteria 3804
270 Ga0495680_0030777 3300047322 Bacteria 4376
271 Ga0495675_0119462 3300047444 Bacteria 1642
272 Ga0495684_0001764 3300047471 Bacteria 17376
273 Ga0495684_0084327 3300047471 Bacteria 2410
274 Ga0495602_0035913 3300048088 Bacteria 4617
275 Ga0496100_0000534 3300048903 Bacteria 18056
276 Ga0496100_0008692 3300048903 Bacteria 5673
277 Ga0496100_0029937 3300048903 Bacteria 3372
278 Ga0496100_0080410 3300048903 Bacteria 2199
279 Ga0496101_0001866 3300048904 Bacteria 12729
280 Ga0496102_0089693 3300048905 Bacteria 2844
281 Ga0496102_0107356 3300048905 Bacteria 2599
282 Ga0496102_0557733 3300048905 Bacteria 1068
283 Ga0496103_0018758 3300048906 Bacteria 4152
284 Ga0496103_0076442 3300048906 Bacteria 2101
285 Ga0496104_0016491 3300048907 Bacteria 6712
286 Ga0496104_0051969 3300048907 Bacteria 3870
287 Ga0496104_0639644 3300048907 Bacteria 973
288 Ga0496105_0018448 3300048908 Bacteria 5608
289 Ga0496105_0061387 3300048908 Bacteria 3102
290 Ga0496105_0132750 3300048908 Bacteria 2052
291 Ga0496105_0216164 3300048908 Bacteria 1561
292 Ga0496105_0294107 3300048908 Bacteria 1307
293 Ga0496106_0021970 3300048909 Bacteria 4741
294 Ga0496108_0030684 3300048911 Bacteria 4454
295 Ga0496108_0325736 3300048911 Bacteria 1339
296 Ga0496109_0008446 3300048912 Bacteria 8756
297 Ga0496109_0010278 3300048912 Bacteria 7991
298 Ga0496109_0050143 3300048912 Bacteria 3802
299 Ga0496109_0052228 3300048912 Bacteria 3725
300 Ga0496109_0084226 3300048912 Bacteria 2933
301 Ga0496109_0133873 3300048912 Bacteria 2315
302 Ga0496109_0200979 3300048912 Bacteria 1873
303 Ga0496109_0306400 3300048912 Bacteria 1498
304 Ga0496110_0004098 3300048913 Bacteria 11251
305 Ga0496110_0022592 3300048913 Bacteria 5343
306 Ga0496110_0068099 3300048913 Bacteria 3150
307 Ga0496110_0163146 3300048913 Bacteria 2020
308 Ga0496111_0048481 3300048914 Bacteria 3060
309 Ga0496111_0064209 3300048914 Bacteria 2663
310 Ga0496111_0134451 3300048914 Bacteria 1831
311 Ga0496112_0000401 3300048915 Bacteria 28280
312 Ga0496112_0006492 3300048915 Bacteria 10278
313 Ga0496112_0007418 3300048915 Bacteria 9735
314 Ga0496112_0151332 3300048915 Bacteria 2287
315 Ga0496112_0226221 3300048915 Bacteria 1826
316 Ga0496112_0351107 3300048915 Bacteria 1417
317 Ga0496112_0354067 3300048915 Bacteria 1410
318 Ga0496112_0555588 3300048915 Bacteria 1082
319 Ga0496112_0672816 3300048915 Bacteria 964
320 Ga0496113_0022203 3300048916 Bacteria 4485
321 Ga0496113_0022346 3300048916 Bacteria 4472
322 Ga0496113_0055366 3300048916 Bacteria 2973
323 Ga0496113_0128244 3300048916 Bacteria 1988
324 Ga0496113_0147630 3300048916 Bacteria 1853
325 Ga0496114_0285470 3300048917 Bacteria 1456
326 Ga0496115_0000296 3300048918 Bacteria 42934
327 Ga0496115_0000306 3300048918 Bacteria 41705
328 Ga0496115_0042014 3300048918 Bacteria 3641
329 Ga0501034_0097897 3300049571 Bacteria 2929
330 Ga0501036_0054445 3300049572 Bacteria 3389
331 Ga0501040_0131596 3300049576 Bacteria 1759
332 Ga0501048_0098944 3300049582 Bacteria 2057
333 Ga0501067_0048818 3300049583 Bacteria 2347
334 Ga0501071_0068082 3300049587 Bacteria 2590
335 Ga0501072_0049498 3300049588 Bacteria 3308
336 Ga0501076_0129288 3300049592 Bacteria 2048
337 Ga0501079_0536721 3300049741 Bacteria 920
338 Ga0501081_0094377 3300049743 Bacteria 2108
339 nmdc:mga0n895_204385_c1 3300050512 Bacteria 2006
340 nmdc:mga0rr50_337555_c1 3300050513 Bacteria 1266
341 nmdc:mga08x19_117882_c1 3300050514 Bacteria 1776
342 nmdc:mga0a205_332636_c1 3300050515 Bacteria 1388
343 nmdc:mga0a205_336139_c1 3300050515 Bacteria 1379
344 nmdc:mga0a205_78951_c1 3300050515 Bacteria 3180
345 Ga0495595_0003402 3300053084 Bacteria 6323
346 Ga0495619_0049006 3300053085 Bacteria 2784
347 Ga0500616_0004399 3300053153 Bacteria 10062
348 Ga0501084_0091881 3300054114 Bacteria 2548
349 Ga0501082_0046295 3300060353 Bacteria 3750
350 Ga0466962_0089210 3300061719 Bacteria 1477
351 Ga0466962_0151887 3300061719 Bacteria 1124
352 Ga0530510_0166584 3300061734 Bacteria 1631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028563 Ga0265319_1000544 Ga0265319_100054413 216
2 3300031240 Ga0265320_10039201 Ga0265320_100392012 216
3 3300010375 Ga0105239_11208299 Ga0105239_112082991 227
4 3300048915 Ga0496112_0151332 Ga0496112_0151332_1497_2258 227
5 3300049741 Ga0501079_0536721 Ga0501079_0536721_10_771 227
6 3300045049 Ga0466959_0474355 Ga0466959_0474355_10_780 228
7 3300048915 Ga0496112_0555588 Ga0496112_0555588_47_901 232
8 3300005329 Ga0070683_100191131 Ga0070683_1001911312 234
9 3300025944 Ga0207661_10058057 Ga0207661_100580573 234
10 3300041512 Ga0451853_3803240 Ga0451853_3803240_47_829 234
11 3300044684 Ga0466966_0045528 Ga0466966_0045528_143_1054 234
12 3300005468 Ga0070707_100526401 Ga0070707_1005264011 235
13 3300025922 Ga0207646_10170390 Ga0207646_101703902 235
14 3300048906 Ga0496103_0076442 Ga0496103_0076442_830_1615 235
15 3300048908 Ga0496105_0294107 Ga0496105_0294107_370_1155 235
16 3300048918 Ga0496115_0000306 Ga0496115_0000306_2851_3636 235
17 3300045049 Ga0466959_0008217 Ga0466959_0008217_5299_6087 236
18 3300045836 Ga0466958_0021974 Ga0466958_0021974_2180_2968 236
19 3300039437 Ga0436365_0677843 Ga0436365_0677843_2115_3152 243
20 3300005440 Ga0070705_100160829 Ga0070705_1001608292 244
21 3300006028 Ga0070717_10000004 Ga0070717_1000000446 244
22 3300005353 Ga0070669_100091181 Ga0070669_1000911813 245
23 3300025923 Ga0207681_10070560 Ga0207681_100705603 245
24 3300037466 Ga0395898_0274162 Ga0395898_0274162_707_1558 246
25 3300038443 Ga0395901_0140427 Ga0395901_0140427_1577_2428 246
26 3300046475 Ga0495639_0150130 Ga0495639_0150130_165_1016 246
27 3300037853 Ga0436364_1132411 Ga0436364_1132411_16092_17009 247
28 3300039437 Ga0436365_1174289 Ga0436365_1174289_939_1856 247
29 3300039437 Ga0436365_1757939 Ga0436365_1757939_451_1317 247
30 3300039450 Ga0436363_0403902 Ga0436363_0403902_7404_8321 247
31 3300039453 Ga0436362_0290643 Ga0436362_0290643_1583_2500 247
32 3300006175 Ga0070712_100000008 Ga0070712_1000000089 249
33 3300009148 Ga0105243_10354058 Ga0105243_103540582 249
34 3300025915 Ga0207693_10000002 Ga0207693_10000002332 249
35 3300035695 Ga0373927_0298181 Ga0373927_0298181_85_912 249
36 3300036401 Ga0373937_0006516 Ga0373937_0006516_2642_3469 249
37 3300037853 Ga0436364_0200518 Ga0436364_0200518_870_1736 249
38 3300039453 Ga0436362_1224300 Ga0436362_1224300_206_1063 249
39 3300044735 Ga0466968_0039588 Ga0466968_0039588_47_874 249
40 3300046454 Ga0495592_0070591 Ga0495592_0070591_1506_2333 249
41 3300046462 Ga0495651_0006035 Ga0495651_0006035_3649_4476 249
42 3300046463 Ga0495653_0039669 Ga0495653_0039669_50_877 249
43 3300046511 Ga0495608_0005776 Ga0495608_0005776_4631_5458 249
44 3300046516 Ga0495628_0059195 Ga0495628_0059195_1698_2525 249
45 3300046536 Ga0495587_0043741 Ga0495587_0043741_580_1407 249
46 3300046559 Ga0495667_0007367 Ga0495667_0007367_4840_5667 249
47 3300046642 Ga0495634_0138994 Ga0495634_0138994_684_1511 249
48 3300046663 Ga0495635_0007467 Ga0495635_0007467_4263_5090 249
49 3300046675 Ga0495657_0002620 Ga0495657_0002620_12215_13042 249
50 3300046678 Ga0495599_0149988 Ga0495599_0149988_33_860 249
51 3300047317 Ga0495604_0037728 Ga0495604_0037728_1478_2305 249
52 3300047322 Ga0495680_0030777 Ga0495680_0030777_2800_3627 249
53 3300047444 Ga0495675_0119462 Ga0495675_0119462_748_1575 249
54 3300047471 Ga0495684_0084327 Ga0495684_0084327_78_905 249
55 3300048088 Ga0495602_0035913 Ga0495602_0035913_404_1231 249
56 3300048915 Ga0496112_0007418 Ga0496112_0007418_2850_3677 249
57 3300048916 Ga0496113_0022203 Ga0496113_0022203_2576_3403 249
58 3300053084 Ga0495595_0003402 Ga0495595_0003402_3380_4207 249
59 3300053085 Ga0495619_0049006 Ga0495619_0049006_260_1087 249
60 3300025981 Ga0207640_10201214 Ga0207640_102012142 250
61 3300039438 Ga0436360_0252082 Ga0436360_0252082_572_1435 250
62 3300044842 Ga0466957_0262067 Ga0466957_0262067_183_1040 250
63 3300061719 Ga0466962_0151887 Ga0466962_0151887_45_902 250
64 3300025914 Ga0207671_10005669 Ga0207671_100056694 251
65 3300037853 Ga0436364_0920241 Ga0436364_0920241_352_1185 251
66 3300037853 Ga0436364_1150642 Ga0436364_1150642_377_1213 251
67 3300049572 Ga0501036_0054445 Ga0501036_0054445_149_1003 251
68 3300049576 Ga0501040_0131596 Ga0501040_0131596_882_1736 251
69 3300049582 Ga0501048_0098944 Ga0501048_0098944_1178_2032 251
70 3300049587 Ga0501071_0068082 Ga0501071_0068082_1049_1903 251
71 3300049588 Ga0501072_0049498 Ga0501072_0049498_1810_2664 251
72 3300049592 Ga0501076_0129288 Ga0501076_0129288_850_1704 251
73 3300049743 Ga0501081_0094377 Ga0501081_0094377_917_1771 251
74 3300054114 Ga0501084_0091881 Ga0501084_0091881_323_1177 251
75 3300060353 Ga0501082_0046295 Ga0501082_0046295_1322_2176 251
76 3300061734 Ga0530510_0166584 Ga0530510_0166584_441_1295 251
77 3300048918 Ga0496115_0000296 Ga0496115_0000296_2923_3759 252
78 3300021384 Ga0213876_10013367 Ga0213876_100133674 256
79 3300025302 Ga0207426_1007432 Ga0207426_10074326 256
80 3300026023 Ga0207677_10680253 Ga0207677_106802531 256
81 3300037418 Ga0395900_0264338 Ga0395900_0264338_784_1635 256
82 3300039437 Ga0436365_0262453 Ga0436365_0262453_17501_18355 256
83 3300044694 Ga0466963_0064727 Ga0466963_0064727_1405_2259 256
84 3300005327 Ga0070658_10112777 Ga0070658_101127772 257
85 3300005328 Ga0070676_10059871 Ga0070676_100598712 257
86 3300005329 Ga0070683_100000645 Ga0070683_1000006454 257
87 3300005329 Ga0070683_100645819 Ga0070683_1006458191 257
88 3300005334 Ga0068869_100013296 Ga0068869_1000132964 257
89 3300005337 Ga0070682_100007928 Ga0070682_1000079288 257
90 3300005337 Ga0070682_100094279 Ga0070682_1000942792 257
91 3300005338 Ga0068868_100016666 Ga0068868_1000166664 257
92 3300005338 Ga0068868_100068431 Ga0068868_1000684313 257
93 3300005339 Ga0070660_100095567 Ga0070660_1000955672 257
94 3300005339 Ga0070660_100257580 Ga0070660_1002575802 257
95 3300005354 Ga0070675_100074866 Ga0070675_1000748664 257
96 3300005364 Ga0070673_100410343 Ga0070673_1004103432 257
97 3300005365 Ga0070688_100033036 Ga0070688_1000330362 257
98 3300005366 Ga0070659_100000026 Ga0070659_10000002665 257
99 3300005366 Ga0070659_100096723 Ga0070659_1000967232 257
100 3300005366 Ga0070659_100122956 Ga0070659_1001229562 257
101 3300005435 Ga0070714_100000083 Ga0070714_10000008369 257
102 3300005435 Ga0070714_100051429 Ga0070714_1000514292 257
103 3300005436 Ga0070713_100024016 Ga0070713_1000240163 257
104 3300005437 Ga0070710_10186829 Ga0070710_101868292 257
105 3300005438 Ga0070701_10269315 Ga0070701_102693151 257
106 3300005439 Ga0070711_100027746 Ga0070711_1000277462 257
107 3300005439 Ga0070711_100254907 Ga0070711_1002549072 257
108 3300005441 Ga0070700_100106186 Ga0070700_1001061862 257
109 3300005456 Ga0070678_100016305 Ga0070678_1000163056 257
110 3300005466 Ga0070685_10089732 Ga0070685_100897322 257
111 3300005518 Ga0070699_100526241 Ga0070699_1005262411 257
112 3300005530 Ga0070679_100085663 Ga0070679_1000856633 257
113 3300005535 Ga0070684_100003617 Ga0070684_1000036172 257
114 3300005539 Ga0068853_100103857 Ga0068853_1001038573 257
115 3300005544 Ga0070686_100199414 Ga0070686_1001994142 257
116 3300005545 Ga0070695_100342125 Ga0070695_1003421252 257
117 3300005549 Ga0070704_100118754 Ga0070704_1001187542 257
118 3300005564 Ga0070664_100003373 Ga0070664_10000337314 257
119 3300005578 Ga0068854_100065924 Ga0068854_1000659243 257
120 3300005578 Ga0068854_100071808 Ga0068854_1000718082 257
121 3300005614 Ga0068856_100005907 Ga0068856_10000590711 257
122 3300005614 Ga0068856_100586685 Ga0068856_1005866852 257
123 3300005616 Ga0068852_100280971 Ga0068852_1002809712 257
124 3300005616 Ga0068852_100435462 Ga0068852_1004354622 257
125 3300005617 Ga0068859_100085525 Ga0068859_1000855252 257
126 3300005617 Ga0068859_100636242 Ga0068859_1006362422 257
127 3300005618 Ga0068864_100075568 Ga0068864_1000755682 257
128 3300005719 Ga0068861_100048491 Ga0068861_1000484913 257
129 3300005841 Ga0068863_100194834 Ga0068863_1001948342 257
130 3300005841 Ga0068863_100319505 Ga0068863_1003195052 257
131 3300005844 Ga0068862_100389842 Ga0068862_1003898422 257
132 3300005937 Ga0081455_10010781 Ga0081455_100107816 257
133 3300005983 Ga0081540_1001234 Ga0081540_10012345 257
134 3300005985 Ga0081539_10027906 Ga0081539_100279062 257
135 3300006038 Ga0075365_10232294 Ga0075365_102322942 257
136 3300006058 Ga0075432_10018839 Ga0075432_100188393 257
137 3300006173 Ga0070716_100311498 Ga0070716_1003114982 257
138 3300006175 Ga0070712_100003760 Ga0070712_1000037606 257
139 3300006847 Ga0075431_100033246 Ga0075431_1000332464 257
140 3300006852 Ga0075433_10039591 Ga0075433_100395914 257
141 3300006852 Ga0075433_10257675 Ga0075433_102576752 257
142 3300006871 Ga0075434_100023596 Ga0075434_1000235968 257
143 3300006880 Ga0075429_100249664 Ga0075429_1002496641 257
144 3300006914 Ga0075436_100042542 Ga0075436_1000425423 257
145 3300006931 Ga0097620_100085517 Ga0097620_1000855172 257
146 3300006931 Ga0097620_100636157 Ga0097620_1006361572 257
147 3300009094 Ga0111539_10038710 Ga0111539_100387105 257
148 3300009094 Ga0111539_10370025 Ga0111539_103700251 257
149 3300009098 Ga0105245_10004181 Ga0105245_100041814 257
150 3300009098 Ga0105245_10080580 Ga0105245_100805803 257
151 3300009098 Ga0105245_10258404 Ga0105245_102584042 257
152 3300009101 Ga0105247_10017078 Ga0105247_100170782 257
153 3300009147 Ga0114129_11199004 Ga0114129_111990041 257
154 3300009148 Ga0105243_10076332 Ga0105243_100763321 257
155 3300009148 Ga0105243_10143381 Ga0105243_101433812 257
156 3300009176 Ga0105242_10267747 Ga0105242_102677472 257
157 3300009177 Ga0105248_10133732 Ga0105248_101337322 257
158 3300009177 Ga0105248_10490879 Ga0105248_104908792 257
159 3300009553 Ga0105249_10356240 Ga0105249_103562402 257
160 3300009553 Ga0105249_10698988 Ga0105249_106989882 257
161 3300010375 Ga0105239_10051102 Ga0105239_100511026 257
162 3300011119 Ga0105246_10099981 Ga0105246_100999813 257
163 3300013296 Ga0157374_10007098 Ga0157374_1000709811 257
164 3300013306 Ga0163162_10157124 Ga0163162_101571243 257
165 3300013307 Ga0157372_10012336 Ga0157372_100123362 257
166 3300013308 Ga0157375_10017301 Ga0157375_100173018 257
167 3300013308 Ga0157375_10140072 Ga0157375_101400722 257
168 3300014325 Ga0163163_10253249 Ga0163163_102532492 257
169 3300014326 Ga0157380_10286599 Ga0157380_102865992 257
170 3300014745 Ga0157377_10000822 Ga0157377_100008223 257
171 3300014745 Ga0157377_10036509 Ga0157377_100365092 257
172 3300014968 Ga0157379_10002281 Ga0157379_1000228113 257
173 3300014968 Ga0157379_10160127 Ga0157379_101601272 257
174 3300014969 Ga0157376_10025716 Ga0157376_100257167 257
175 3300014969 Ga0157376_10206614 Ga0157376_102066142 257
176 3300021377 Ga0213874_10016513 Ga0213874_100165132 257
177 3300021384 Ga0213876_10006252 Ga0213876_100062525 257
178 3300021384 Ga0213876_10026102 Ga0213876_100261023 257
179 3300021384 Ga0213876_10134437 Ga0213876_101344372 257
180 3300021384 Ga0213876_10135711 Ga0213876_101357111 257
181 3300021388 Ga0213875_10049702 Ga0213875_100497022 257
182 3300021388 Ga0213875_10181052 Ga0213875_101810521 257
183 3300025898 Ga0207692_10028496 Ga0207692_100284962 257
184 3300025900 Ga0207710_10015807 Ga0207710_100158071 257
185 3300025901 Ga0207688_10000691 Ga0207688_1000069111 257
186 3300025901 Ga0207688_10021608 Ga0207688_100216082 257
187 3300025903 Ga0207680_10067852 Ga0207680_100678522 257
188 3300025906 Ga0207699_10040004 Ga0207699_100400042 257
189 3300025907 Ga0207645_10025224 Ga0207645_100252242 257
190 3300025908 Ga0207643_10004422 Ga0207643_100044223 257
191 3300025909 Ga0207705_10124878 Ga0207705_101248782 257
192 3300025915 Ga0207693_10010715 Ga0207693_100107159 257
193 3300025915 Ga0207693_10073893 Ga0207693_100738932 257
194 3300025915 Ga0207693_10156959 Ga0207693_101569592 257
195 3300025916 Ga0207663_10250335 Ga0207663_102503352 257
196 3300025918 Ga0207662_10111475 Ga0207662_101114752 257
197 3300025918 Ga0207662_10197723 Ga0207662_101977231 257
198 3300025918 Ga0207662_10272900 Ga0207662_102729002 257
199 3300025919 Ga0207657_10052831 Ga0207657_100528314 257
200 3300025919 Ga0207657_10066688 Ga0207657_100666882 257
201 3300025919 Ga0207657_10199289 Ga0207657_101992892 257
202 3300025921 Ga0207652_10012226 Ga0207652_100122266 257
203 3300025923 Ga0207681_10057966 Ga0207681_100579662 257
204 3300025924 Ga0207694_10400915 Ga0207694_104009152 257
205 3300025927 Ga0207687_10161996 Ga0207687_101619962 257
206 3300025927 Ga0207687_10396423 Ga0207687_103964231 257
207 3300025928 Ga0207700_10037394 Ga0207700_100373943 257
208 3300025929 Ga0207664_10000006 Ga0207664_10000006345 257
209 3300025929 Ga0207664_10004303 Ga0207664_100043039 257
210 3300025929 Ga0207664_10189025 Ga0207664_101890252 257
211 3300025932 Ga0207690_10000098 Ga0207690_1000009830 257
212 3300025932 Ga0207690_10059478 Ga0207690_100594783 257
213 3300025933 Ga0207706_10046911 Ga0207706_100469112 257
214 3300025934 Ga0207686_10201644 Ga0207686_102016442 257
215 3300025935 Ga0207709_10032271 Ga0207709_100322712 257
216 3300025935 Ga0207709_10097016 Ga0207709_100970162 257
217 3300025935 Ga0207709_10170193 Ga0207709_101701932 257
218 3300025937 Ga0207669_10082238 Ga0207669_100822382 257
219 3300025937 Ga0207669_10149399 Ga0207669_101493992 257
220 3300025938 Ga0207704_10087667 Ga0207704_100876672 257
221 3300025942 Ga0207689_10040643 Ga0207689_100406435 257
222 3300025942 Ga0207689_10064905 Ga0207689_100649052 257
223 3300025944 Ga0207661_10417873 Ga0207661_104178732 257
224 3300025945 Ga0207679_10130024 Ga0207679_101300242 257
225 3300025945 Ga0207679_10282205 Ga0207679_102822052 257
226 3300025960 Ga0207651_10498057 Ga0207651_104980571 257
227 3300025981 Ga0207640_10131560 Ga0207640_101315602 257
228 3300025981 Ga0207640_10147320 Ga0207640_101473201 257
229 3300026023 Ga0207677_10203133 Ga0207677_102031332 257
230 3300026067 Ga0207678_10053507 Ga0207678_100535073 257
231 3300026067 Ga0207678_10286386 Ga0207678_102863862 257
232 3300026075 Ga0207708_10003393 Ga0207708_100033939 257
233 3300026088 Ga0207641_10058565 Ga0207641_100585654 257
234 3300026088 Ga0207641_10244413 Ga0207641_102444131 257
235 3300026089 Ga0207648_10100590 Ga0207648_101005902 257
236 3300026095 Ga0207676_10018388 Ga0207676_100183888 257
237 3300026116 Ga0207674_10054859 Ga0207674_100548592 257
238 3300026118 Ga0207675_100491963 Ga0207675_1004919632 257
239 3300026121 Ga0207683_10249791 Ga0207683_102497911 257
240 3300026142 Ga0207698_10055350 Ga0207698_100553502 257
241 3300026142 Ga0207698_10323847 Ga0207698_103238472 257
242 3300027907 Ga0207428_10013418 Ga0207428_100134185 257
243 3300028380 Ga0268265_10080998 Ga0268265_100809982 257
244 3300031901 Ga0307406_10308357 Ga0307406_103083571 257
245 3300032002 Ga0307416_100347719 Ga0307416_1003477191 257
246 3300035725 Ga0373947_0220936 Ga0373947_0220936_57_908 257
247 3300037418 Ga0395900_0611964 Ga0395900_0611964_49_900 257
248 3300037466 Ga0395898_0046905 Ga0395898_0046905_287_1138 257
249 3300037853 Ga0436364_0520142 Ga0436364_0520142_298_1155 257
250 3300037853 Ga0436364_0575671 Ga0436364_0575671_4710_5594 257
251 3300037853 Ga0436364_0830799 Ga0436364_0830799_119_982 257
252 3300037853 Ga0436364_1142787 Ga0436364_1142787_1445_2302 257
253 3300037853 Ga0436364_1382614 Ga0436364_1382614_3057_3914 257
254 3300038443 Ga0395901_0070917 Ga0395901_0070917_2353_3204 257
255 3300039437 Ga0436365_0627820 Ga0436365_0627820_6074_6931 257
256 3300039437 Ga0436365_0838755 Ga0436365_0838755_246_1106 257
257 3300039437 Ga0436365_0944756 Ga0436365_0944756_58_921 257
258 3300039437 Ga0436365_1044040 Ga0436365_1044040_103_960 257
259 3300039437 Ga0436365_1108574 Ga0436365_1108574_2694_3557 257
260 3300039437 Ga0436365_1373684 Ga0436365_1373684_104_955 257
261 3300039437 Ga0436365_1826901 Ga0436365_1826901_6288_7151 257
262 3300039437 Ga0436365_1839438 Ga0436365_1839438_745_1629 257
263 3300039450 Ga0436363_0449139 Ga0436363_0449139_19_873 257
264 3300039450 Ga0436363_0678117 Ga0436363_0678117_32032_32892 257
265 3300039453 Ga0436362_0575825 Ga0436362_0575825_1169_2026 257
266 3300044684 Ga0466966_0020653 Ga0466966_0020653_1056_1907 257
267 3300044684 Ga0466966_0140138 Ga0466966_0140138_576_1436 257
268 3300044684 Ga0466966_0143686 Ga0466966_0143686_59_916 257
269 3300044694 Ga0466963_0018438 Ga0466963_0018438_331_1194 257
270 3300044694 Ga0466963_0228665 Ga0466963_0228665_190_1047 257
271 3300044694 Ga0466963_0342138 Ga0466963_0342138_41_898 257
272 3300044706 Ga0466964_0048542 Ga0466964_0048542_271_1128 257
273 3300044719 Ga0466971_0011751 Ga0466971_0011751_2171_3034 257
274 3300044735 Ga0466968_0149135 Ga0466968_0149135_198_1061 257
275 3300044842 Ga0466957_0007335 Ga0466957_0007335_1330_2187 257
276 3300044842 Ga0466957_0169153 Ga0466957_0169153_267_1130 257
277 3300044901 Ga0466960_0000037 Ga0466960_0000037_42488_43339 257
278 3300045049 Ga0466959_0011476 Ga0466959_0011476_3904_4761 257
279 3300045049 Ga0466959_0109536 Ga0466959_0109536_314_1180 257
280 3300045049 Ga0466959_0116488 Ga0466959_0116488_341_1189 257
281 3300045049 Ga0466959_0162454 Ga0466959_0162454_460_1311 257
282 3300045049 Ga0466959_0233517 Ga0466959_0233517_191_1054 257
283 3300045049 Ga0466959_0380084 Ga0466959_0380084_93_950 257
284 3300045836 Ga0466958_0001567 Ga0466958_0001567_1030_1887 257
285 3300045836 Ga0466958_0010758 Ga0466958_0010758_867_1730 257
286 3300045836 Ga0466958_0038051 Ga0466958_0038051_1964_2827 257
287 3300045836 Ga0466958_0088539 Ga0466958_0088539_489_1352 257
288 3300045836 Ga0466958_0158572 Ga0466958_0158572_497_1354 257
289 3300045836 Ga0466958_0340405 Ga0466958_0340405_84_947 257
290 3300045976 Ga0466967_0067584 Ga0466967_0067584_1628_2485 257
291 3300045976 Ga0466967_0138997 Ga0466967_0138997_174_1037 257
292 3300045976 Ga0466967_0373136 Ga0466967_0373136_457_1320 257
293 3300045976 Ga0466967_0709762 Ga0466967_0709762_67_930 257
294 3300046511 Ga0495608_0109236 Ga0495608_0109236_824_1681 257
295 3300046615 Ga0495656_0006425 Ga0495656_0006425_1861_2712 257
296 3300047471 Ga0495684_0001764 Ga0495684_0001764_12117_12968 257
297 3300048903 Ga0496100_0000534 Ga0496100_0000534_6305_7156 257
298 3300048903 Ga0496100_0008692 Ga0496100_0008692_4163_5014 257
299 3300048903 Ga0496100_0029937 Ga0496100_0029937_1660_2514 257
300 3300048903 Ga0496100_0080410 Ga0496100_0080410_862_1713 257
301 3300048904 Ga0496101_0001866 Ga0496101_0001866_10553_11404 257
302 3300048905 Ga0496102_0089693 Ga0496102_0089693_178_1032 257
303 3300048905 Ga0496102_0107356 Ga0496102_0107356_100_951 257
304 3300048905 Ga0496102_0557733 Ga0496102_0557733_143_994 257
305 3300048906 Ga0496103_0018758 Ga0496103_0018758_367_1221 257
306 3300048907 Ga0496104_0016491 Ga0496104_0016491_5390_6241 257
307 3300048907 Ga0496104_0051969 Ga0496104_0051969_2804_3655 257
308 3300048907 Ga0496104_0639644 Ga0496104_0639644_71_922 257
309 3300048908 Ga0496105_0018448 Ga0496105_0018448_760_1614 257
310 3300048908 Ga0496105_0061387 Ga0496105_0061387_227_1078 257
311 3300048908 Ga0496105_0132750 Ga0496105_0132750_1019_1870 257
312 3300048908 Ga0496105_0216164 Ga0496105_0216164_55_906 257
313 3300048909 Ga0496106_0021970 Ga0496106_0021970_1686_2540 257
314 3300048911 Ga0496108_0030684 Ga0496108_0030684_305_1156 257
315 3300048911 Ga0496108_0325736 Ga0496108_0325736_426_1280 257
316 3300048912 Ga0496109_0008446 Ga0496109_0008446_3965_4816 257
317 3300048912 Ga0496109_0010278 Ga0496109_0010278_5928_6779 257
318 3300048912 Ga0496109_0050143 Ga0496109_0050143_1494_2348 257
319 3300048912 Ga0496109_0052228 Ga0496109_0052228_2202_3053 257
320 3300048912 Ga0496109_0084226 Ga0496109_0084226_2054_2905 257
321 3300048912 Ga0496109_0133873 Ga0496109_0133873_938_1789 257
322 3300048912 Ga0496109_0200979 Ga0496109_0200979_118_969 257
323 3300048912 Ga0496109_0306400 Ga0496109_0306400_270_1121 257
324 3300048913 Ga0496110_0004098 Ga0496110_0004098_8348_9199 257
325 3300048913 Ga0496110_0022592 Ga0496110_0022592_2827_3681 257
326 3300048913 Ga0496110_0068099 Ga0496110_0068099_1405_2256 257
327 3300048913 Ga0496110_0163146 Ga0496110_0163146_945_1796 257
328 3300048914 Ga0496111_0048481 Ga0496111_0048481_1174_2025 257
329 3300048914 Ga0496111_0064209 Ga0496111_0064209_70_924 257
330 3300048914 Ga0496111_0134451 Ga0496111_0134451_923_1774 257
331 3300048915 Ga0496112_0000401 Ga0496112_0000401_21864_22715 257
332 3300048915 Ga0496112_0006492 Ga0496112_0006492_3096_3947 257
333 3300048915 Ga0496112_0226221 Ga0496112_0226221_938_1789 257
334 3300048915 Ga0496112_0351107 Ga0496112_0351107_95_946 257
335 3300048915 Ga0496112_0354067 Ga0496112_0354067_426_1277 257
336 3300048915 Ga0496112_0672816 Ga0496112_0672816_101_952 257
337 3300048916 Ga0496113_0022346 Ga0496113_0022346_940_1794 257
338 3300048916 Ga0496113_0055366 Ga0496113_0055366_315_1166 257
339 3300048916 Ga0496113_0128244 Ga0496113_0128244_603_1454 257
340 3300048916 Ga0496113_0147630 Ga0496113_0147630_905_1756 257
341 3300048917 Ga0496114_0285470 Ga0496114_0285470_552_1403 257
342 3300048918 Ga0496115_0042014 Ga0496115_0042014_2239_3090 257
343 3300049571 Ga0501034_0097897 Ga0501034_0097897_1341_2192 257
344 3300049583 Ga0501067_0048818 Ga0501067_0048818_931_1782 257
345 3300050512 nmdc:mga0n895_204385_c1 nmdc:mga0n895_204385_c1_960_1814 257
346 3300050513 nmdc:mga0rr50_337555_c1 nmdc:mga0rr50_337555_c1_157_1011 257
347 3300050514 nmdc:mga08x19_117882_c1 nmdc:mga08x19_117882_c1_648_1502 257
348 3300050515 nmdc:mga0a205_332636_c1 nmdc:mga0a205_332636_c1_57_908 257
349 3300050515 nmdc:mga0a205_336139_c1 nmdc:mga0a205_336139_c1_158_1012 257
350 3300050515 nmdc:mga0a205_78951_c1 nmdc:mga0a205_78951_c1_1150_2004 257
351 3300053153 Ga0500616_0004399 Ga0500616_0004399_4266_5117 257
352 3300061719 Ga0466962_0089210 Ga0466962_0089210_408_1271 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

77

145

0.87

PF08544

GHMP_kinases_C

GHMP kinases C terminal

198

274

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p52-assembly1.cif.gz_A crystal structure of homoserine kinase from cytophaga hutchinsonii atcc 33406, nysgrc target 032717. 0.8869 4 255
5wat-assembly1.cif.gz_B corynebacterium glutamicum full length homoserine kinase 0.8691 1 255
4p52-assembly1.cif.gz_A crystal structure of homoserine kinase from cytophaga hutchinsonii atcc 33406, nysgrc target 032717. 0.8678 4 255
5wat-assembly1.cif.gz_B corynebacterium glutamicum full length homoserine kinase 0.8595 1 255
3hul-assembly1.cif.gz_A-2 structure of putative homoserine kinase thrb from listeria monocytogenes 0.8586 5 255
ID Description Score Start End Superfamily
af_Q2FYV2_166_287_3.30.70.890 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.8981 149 239 3.30.70.890
af_Q4DQQ2_7_172_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.894 6 145 3.30.230.10
3hulB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8936 5 141 3.30.230.10
af_P9WKE7_13_177_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8751 6 142 3.30.230.10
af_Q2FYV2_4_165_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8721 6 144 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A7W0RC14-F1-model_v4 Homoserine kinase 0.9736 1 200 GO:0005524
GO:0008652
GO:0016020
GO:0016301
AF-A0A7V9J7L6-F1-model_v4 Homoserine kinase (HK) (HSK) (EC 2.7.1.39) 0.9711 1 257 GO:0004413
GO:0005524
GO:0005737
GO:0009088
AF-A0A7V9J7L6-F1-model_v4 Homoserine kinase (HK) (HSK) (EC 2.7.1.39) 0.9674 1 257 GO:0004413
GO:0005524
GO:0005737
GO:0009088
AF-A0A838V2K4-F1-model_v4 Homoserine kinase (HK) (HSK) (EC 2.7.1.39) 0.965 1 257 GO:0004413
GO:0005524
GO:0005737
GO:0009088
AF-A0A838V2K4-F1-model_v4 Homoserine kinase (HK) (HSK) (EC 2.7.1.39) 0.9613 1 257 GO:0004413
GO:0005524
GO:0005737
GO:0009088

Feature Viewer

pLDDT pTM Quality
91.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map