F419044

General Info

Members Datasets Scaffolds Average Seq Length
352 187 704 300

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10010100|Ga0207695_100101002
Length 316
Sequence LASWPGKGTPRTLASKSPKPARRKPAVRKADLVIITGLSGSGKGSVLRALEDLGFYSVDNLPLELIPKFAELTKDNASIQSAALVVDVREGKSLKRFPSIFAGIRRSAGAKLIFLEADDKAILHRFSETRRPHPLGTDRSVLKSIRSERAQLAPIRDLADLTIDTSKFTVHELREFINERFGERDEAKTMIAVTSFGFRKGVPAESDLVFDVRFLPNPNYIPRFKNLTGKDKNVAQYVRSFPQTQEFIRRITDLLTFLLPHYIREGKSYLTISFGCTGGQHRSVMMAHEIGKNLQQAGYNAKITDRDIVKAPRQTR

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.7
Rhizosphere 96.59
Stem 0
Stem Tuber 0
Unclassified 23.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10010100 3300025913 Bacteria 11589
2 JGI24751J29686_10021328 3300002459 Unclassified 1342
3 Ga0065712_10108230 3300005290 Unclassified 1879
4 Ga0065707_10197136 3300005295 Bacteria 1310
5 Ga0070658_10017385 3300005327 Bacteria 5754
6 Ga0070658_10053259 3300005327 Unclassified 3283
7 Ga0070683_100007630 3300005329 Bacteria 9154
8 Ga0070683_100012228 3300005329 Bacteria 7453
9 Ga0068869_100004661 3300005334 Bacteria 8553
10 Ga0070666_10001823 3300005335 Bacteria 12984
11 Ga0070666_10272991 3300005335 Unclassified 1200
12 Ga0070682_100080948 3300005337 Bacteria 2101
13 Ga0068868_100002275 3300005338 Bacteria 13264
14 Ga0068868_100002322 3300005338 Bacteria 13159
15 Ga0068868_100009924 3300005338 Bacteria 6877
16 Ga0070660_100103546 3300005339 Unclassified 2257
17 Ga0070689_100025668 3300005340 Bacteria 4429
18 Ga0070687_100028208 3300005343 Bacteria 2720
19 Ga0070661_100078242 3300005344 Bacteria 2439
20 Ga0070668_100027399 3300005347 Bacteria 4326
21 Ga0070669_100004504 3300005353 Bacteria 10052
22 Ga0070675_100019313 3300005354 Bacteria 5429
23 Ga0070675_100157762 3300005354 Bacteria 1949
24 Ga0070671_100048940 3300005355 Unclassified 3517
25 Ga0070671_100105347 3300005355 Bacteria 2367
26 Ga0070674_100016231 3300005356 Bacteria 4666
27 Ga0070673_100018952 3300005364 Unclassified 4933
28 Ga0070673_100149170 3300005364 Unclassified 1979
29 Ga0070688_100002583 3300005365 Bacteria 9175
30 Ga0070667_100015312 3300005367 Bacteria 6338
31 Ga0070667_100175454 3300005367 Unclassified 1894
32 Ga0070714_100001451 3300005435 Bacteria 17277
33 Ga0070713_100089092 3300005436 Bacteria 2650
34 Ga0070713_100188591 3300005436 Unclassified 1857
35 Ga0070711_100451250 3300005439 Bacteria 1053
36 Ga0070662_100141086 3300005457 Bacteria 1867
37 Ga0070681_10022322 3300005458 Bacteria 6355
38 Ga0070681_10129369 3300005458 Unclassified 2457
39 Ga0068867_100418623 3300005459 Unclassified 1134
40 Ga0070685_10001583 3300005466 Bacteria 12008
41 Ga0070679_100124692 3300005530 Bacteria 2558
42 Ga0070679_100254114 3300005530 Bacteria 1713
43 Ga0070679_100287554 3300005530 Unclassified 1596
44 Ga0070684_100011945 3300005535 Bacteria 6937
45 Ga0070684_100204669 3300005535 Unclassified 1798
46 Ga0070697_100111955 3300005536 Bacteria 2276
47 Ga0068853_100012742 3300005539 Bacteria 6846
48 Ga0068853_100270288 3300005539 Bacteria 1565
49 Ga0070672_100055136 3300005543 Bacteria 3113
50 Ga0070686_100003803 3300005544 Bacteria 8303
51 Ga0070686_100099788 3300005544 Unclassified 1959
52 Ga0070665_100128359 3300005548 Unclassified 2538
53 Ga0068855_100010725 3300005563 Bacteria 11060
54 Ga0068855_100014202 3300005563 Bacteria 9593
55 Ga0068855_100017932 3300005563 Bacteria 8506
56 Ga0068855_100028861 3300005563 Bacteria 6638
57 Ga0068855_100415055 3300005563 Unclassified 1473
58 Ga0070664_100206812 3300005564 Bacteria 1753
59 Ga0068857_100009638 3300005577 Bacteria 8392
60 Ga0068857_100285781 3300005577 Bacteria 1518
61 Ga0068856_100006342 3300005614 Bacteria 11601
62 Ga0068852_100005478 3300005616 Bacteria 9083
63 Ga0068859_100343035 3300005617 Unclassified 1588
64 Ga0068859_100596820 3300005617 Unclassified 1197
65 Ga0068864_100014155 3300005618 Bacteria 6621
66 Ga0068864_100020562 3300005618 Bacteria 5522
67 Ga0068866_10001209 3300005718 Bacteria 11240
68 Ga0068861_100101457 3300005719 Bacteria 2289
69 Ga0068851_10035485 3300005834 Unclassified 2493
70 Ga0068870_10001169 3300005840 Bacteria 10508
71 Ga0068863_100063739 3300005841 Unclassified 3486
72 Ga0068863_100195329 3300005841 Bacteria 1945
73 Ga0068858_100005980 3300005842 Bacteria 11883
74 Ga0068858_100031632 3300005842 Bacteria 4916
75 Ga0068860_100044035 3300005843 Unclassified 4255
76 Ga0068862_100021726 3300005844 Bacteria 5368
77 Ga0081539_10070459 3300005985 Unclassified 1876
78 Ga0097621_100011563 3300006237 Bacteria 6505
79 Ga0097621_100018551 3300006237 Bacteria 5319
80 Ga0097621_100030904 3300006237 Bacteria 4243
81 Ga0097621_100104581 3300006237 Bacteria 2386
82 Ga0068871_100001009 3300006358 Bacteria 18881
83 Ga0068871_100005987 3300006358 Bacteria 8558
84 Ga0068871_100014247 3300006358 Bacteria 5922
85 Ga0068871_100319673 3300006358 Unclassified 1366
86 Ga0068871_100320997 3300006358 Bacteria 1364
87 Ga0075431_100013837 3300006847 Bacteria 8148
88 Ga0075431_100636693 3300006847 Bacteria 1048
89 Ga0075429_100213542 3300006880 Bacteria 1690
90 Ga0068865_100008285 3300006881 Bacteria 6419
91 Ga0068865_100026681 3300006881 Bacteria 3811
92 Ga0075436_100042386 3300006914 Bacteria 3139
93 Ga0075436_100198009 3300006914 Bacteria 1422
94 Ga0097620_100160836 3300006931 Bacteria 2325
95 Ga0097620_100343061 3300006931 Unclassified 1588
96 Ga0097620_100596803 3300006931 Unclassified 1197
97 Ga0105240_10000709 3300009093 Bacteria 61057
98 Ga0105240_10013017 3300009093 Bacteria 11454
99 Ga0105240_10049213 3300009093 Bacteria 5321
100 Ga0105240_10083893 3300009093 Unclassified 3908
101 Ga0105240_10291088 3300009093 Bacteria 1872
102 Ga0111539_10077966 3300009094 Unclassified 3899
103 Ga0105245_10002163 3300009098 Bacteria 17803
104 Ga0105245_10003137 3300009098 Bacteria 14794
105 Ga0105245_10024864 3300009098 Bacteria 5264
106 Ga0105245_10075625 3300009098 Bacteria 3066
107 Ga0105245_10098554 3300009098 Unclassified 2701
108 Ga0105245_10373190 3300009098 Bacteria 1419
109 Ga0105245_10680193 3300009098 Bacteria 1061
110 Ga0105247_10004466 3300009101 Bacteria 8917
111 Ga0105247_10031406 3300009101 Unclassified 3222
112 Ga0105247_10086867 3300009101 Bacteria 1980
113 Ga0105243_10239136 3300009148 Unclassified 1615
114 Ga0105241_10008535 3300009174 Bacteria 7534
115 Ga0105241_10020838 3300009174 Bacteria 4846
116 Ga0105241_10040558 3300009174 Unclassified 3515
117 Ga0105241_10062135 3300009174 Bacteria 2878
118 Ga0105241_10194230 3300009174 Unclassified 1691
119 Ga0105241_10246287 3300009174 Bacteria 1513
120 Ga0105242_10001977 3300009176 Bacteria 16122
121 Ga0105242_10013866 3300009176 Bacteria 6235
122 Ga0105242_10067993 3300009176 Bacteria 2946
123 Ga0105242_10244749 3300009176 Bacteria 1614
124 Ga0105248_10029915 3300009177 Bacteria 6077
125 Ga0105248_10134701 3300009177 Unclassified 2787
126 Ga0105248_10403911 3300009177 Unclassified 1538
127 Ga0105248_10498673 3300009177 Unclassified 1372
128 Ga0105248_10508320 3300009177 Unclassified 1359
129 Ga0105248_10517655 3300009177 Unclassified 1345
130 Ga0105237_10077423 3300009545 Bacteria 3315
131 Ga0105238_10007540 3300009551 Bacteria 10896
132 Ga0105238_10016963 3300009551 Bacteria 7390
133 Ga0105238_10038397 3300009551 Bacteria 4863
134 Ga0105238_10115251 3300009551 Unclassified 2667
135 Ga0105238_10254142 3300009551 Bacteria 1736
136 Ga0105238_10347860 3300009551 Bacteria 1471
137 Ga0105249_10603617 3300009553 Unclassified 1152
138 Ga0105239_10019023 3300010375 Bacteria 7590
139 Ga0105239_10019814 3300010375 Bacteria 7424
140 Ga0105239_10020900 3300010375 Bacteria 7222
141 Ga0105239_10021949 3300010375 Bacteria 7037
142 Ga0105239_10081058 3300010375 Bacteria 3572
143 Ga0105239_10154007 3300010375 Unclassified 2566
144 Ga0105246_10000897 3300011119 Bacteria 17089
145 Ga0157373_10008983 3300013100 Bacteria 7394
146 Ga0157371_10007242 3300013102 Bacteria 9009
147 Ga0157370_10050696 3300013104 Bacteria 3967
148 Ga0157370_10115215 3300013104 Unclassified 2511
149 Ga0157369_10005242 3300013105 Bacteria 15118
150 Ga0157369_10035527 3300013105 Bacteria 5464
151 Ga0157374_10021161 3300013296 Bacteria 5782
152 Ga0157374_10097861 3300013296 Bacteria 2808
153 Ga0157378_10036062 3300013297 Bacteria 4376
154 Ga0157378_10458951 3300013297 Unclassified 1266
155 Ga0157378_10508545 3300013297 Unclassified 1204
156 Ga0163162_10085843 3300013306 Bacteria 3225
157 Ga0163162_10310348 3300013306 Unclassified 1710
158 Ga0163162_10381036 3300013306 Unclassified 1544
159 Ga0157372_10045107 3300013307 Bacteria 4888
160 Ga0157372_10349657 3300013307 Bacteria 1722
161 Ga0157375_10267204 3300013308 Bacteria 1872
162 Ga0157375_10274594 3300013308 Unclassified 1848
163 Ga0157375_10296059 3300013308 Bacteria 1781
164 Ga0157375_10507788 3300013308 Unclassified 1369
165 Ga0157375_10749205 3300013308 Bacteria 1128
166 Ga0163163_10001960 3300014325 Bacteria 17389
167 Ga0163163_10002598 3300014325 Bacteria 15306
168 Ga0163163_10306795 3300014325 Bacteria 1640
169 Ga0163163_10354674 3300014325 Bacteria 1523
170 Ga0163163_10505312 3300014325 Unclassified 1271
171 Ga0157380_10010049 3300014326 Bacteria 6792
172 Ga0157379_10019353 3300014968 Bacteria 6012
173 Ga0157379_10027028 3300014968 Bacteria 5107
174 Ga0157376_10028991 3300014969 Bacteria 4406
175 Ga0157376_10039925 3300014969 Unclassified 3832
176 Ga0157376_10074144 3300014969 Bacteria 2900
177 Ga0157376_10327249 3300014969 Unclassified 1459
178 Ga0163161_10004560 3300017792 Bacteria 9646
179 Ga0213876_10055275 3300021384 Bacteria 2096
180 Ga0207697_10018615 3300025315 Bacteria 2848
181 Ga0207710_10011160 3300025900 Unclassified 3783
182 Ga0207688_10003416 3300025901 Bacteria 8663
183 Ga0207680_10327530 3300025903 Unclassified 1072
184 Ga0207647_10050451 3300025904 Bacteria 2576
185 Ga0207645_10001897 3300025907 Bacteria 16882
186 Ga0207643_10000869 3300025908 Bacteria 18203
187 Ga0207705_10023851 3300025909 Bacteria 4366
188 Ga0207705_10181440 3300025909 Bacteria 1589
189 Ga0207684_10067780 3300025910 Bacteria 3033
190 Ga0207654_10006762 3300025911 Bacteria 5768
191 Ga0207654_10027436 3300025911 Unclassified 3094
192 Ga0207654_10058568 3300025911 Bacteria 2243
193 Ga0207707_10032994 3300025912 Bacteria 4532
194 Ga0207707_10105010 3300025912 Bacteria 2469
195 Ga0207695_10002373 3300025913 Bacteria 27951
196 Ga0207695_10172721 3300025913 Bacteria 2086
197 Ga0207695_10260998 3300025913 Bacteria 1630
198 Ga0207695_10335668 3300025913 Unclassified 1399
199 Ga0207671_10046892 3300025914 Bacteria 3197
200 Ga0207693_10080324 3300025915 Bacteria 2553
201 Ga0207662_10003133 3300025918 Bacteria 8451
202 Ga0207657_10008514 3300025919 Bacteria 10401
203 Ga0207657_10013771 3300025919 Bacteria 7919
204 Ga0207649_10000439 3300025920 Bacteria 30050
205 Ga0207681_10113984 3300025923 Unclassified 1971
206 Ga0207694_10003426 3300025924 Bacteria 12624
207 Ga0207694_10013432 3300025924 Bacteria 6168
208 Ga0207694_10019442 3300025924 Bacteria 5133
209 Ga0207694_10089116 3300025924 Unclassified 2433
210 Ga0207650_10000053 3300025925 Bacteria 164599
211 Ga0207650_10428317 3300025925 Unclassified 1099
212 Ga0207659_10010370 3300025926 Bacteria 5855
213 Ga0207687_10009044 3300025927 Bacteria 6511
214 Ga0207687_10033350 3300025927 Bacteria 3492
215 Ga0207687_10073600 3300025927 Unclassified 2446
216 Ga0207687_10097666 3300025927 Unclassified 2155
217 Ga0207687_10098011 3300025927 Bacteria 2151
218 Ga0207687_10268854 3300025927 Bacteria 1362
219 Ga0207700_10019849 3300025928 Bacteria 4549
220 Ga0207700_10219115 3300025928 Unclassified 1612
221 Ga0207644_10011368 3300025931 Bacteria 5888
222 Ga0207644_10013253 3300025931 Bacteria 5493
223 Ga0207644_10155134 3300025931 Bacteria 1775
224 Ga0207690_10004912 3300025932 Bacteria 7890
225 Ga0207690_10209201 3300025932 Unclassified 1486
226 Ga0207706_10000229 3300025933 Bacteria 61238
227 Ga0207686_10004681 3300025934 Bacteria 7332
228 Ga0207686_10067961 3300025934 Bacteria 2281
229 Ga0207686_10264018 3300025934 Bacteria 1263
230 Ga0207670_10007095 3300025936 Bacteria 6240
231 Ga0207704_10015926 3300025938 Bacteria 3847
232 Ga0207704_10051394 3300025938 Unclassified 2492
233 Ga0207691_10005576 3300025940 Bacteria 12158
234 Ga0207711_10016037 3300025941 Bacteria 6216
235 Ga0207711_10062278 3300025941 Bacteria 3218
236 Ga0207711_10428147 3300025941 Unclassified 1231
237 Ga0207711_10499250 3300025941 Unclassified 1134
238 Ga0207689_10000106 3300025942 Bacteria 68440
239 Ga0207661_10000445 3300025944 Bacteria 26661
240 Ga0207661_10288443 3300025944 Unclassified 1468
241 Ga0207679_10000110 3300025945 Bacteria 66700
242 Ga0207667_10012406 3300025949 Bacteria 9821
243 Ga0207667_10100206 3300025949 Unclassified 2988
244 Ga0207667_10569032 3300025949 Unclassified 1145
245 Ga0207651_10013885 3300025960 Bacteria 4629
246 Ga0207651_10319723 3300025960 Unclassified 1297
247 Ga0207668_10021659 3300025972 Bacteria 4102
248 Ga0207658_10011968 3300025986 Bacteria 5916
249 Ga0207658_10012518 3300025986 Bacteria 5794
250 Ga0207677_10003453 3300026023 Bacteria 8374
251 Ga0207703_10012077 3300026035 Bacteria 6728
252 Ga0207703_10071494 3300026035 Bacteria 2866
253 Ga0207703_10258977 3300026035 Unclassified 1572
254 Ga0207639_10384120 3300026041 Unclassified 1262
255 Ga0207678_10005099 3300026067 Bacteria 11779
256 Ga0207702_10006104 3300026078 Bacteria 10441
257 Ga0207641_10000104 3300026088 Bacteria 122307
258 Ga0207641_10017442 3300026088 Bacteria 5878
259 Ga0207648_10001080 3300026089 Bacteria 30543
260 Ga0207648_10174939 3300026089 Bacteria 1898
261 Ga0207676_10000288 3300026095 Bacteria 43440
262 Ga0207676_10015283 3300026095 Bacteria 5536
263 Ga0207674_10000092 3300026116 Bacteria 99761
264 Ga0207674_10006162 3300026116 Bacteria 14164
265 Ga0207674_10239980 3300026116 Unclassified 1759
266 Ga0207675_100023652 3300026118 Bacteria 5715
267 Ga0207683_10002015 3300026121 Bacteria 17979
268 Ga0207698_10303927 3300026142 Unclassified 1486
269 Ga0268266_10003198 3300028379 Bacteria 16572
270 Ga0268266_10009537 3300028379 Bacteria 8542
271 Ga0268264_10003554 3300028381 Bacteria 13422
272 Ga0268264_10018018 3300028381 Bacteria 5775
273 Ga0268264_10434331 3300028381 Bacteria 1269
274 Ga0265323_10000402 3300028653 Bacteria 24796
275 Ga0265330_10097761 3300031235 Bacteria 1258
276 Ga0265327_10071530 3300031251 Bacteria 1735
277 Ga0265316_10000627 3300031344 Bacteria 39340
278 Ga0265316_10002205 3300031344 Bacteria 20469
279 Ga0265316_10019580 3300031344 Bacteria 5782
280 Ga0265316_10019854 3300031344 Bacteria 5737
281 Ga0265316_10094086 3300031344 Bacteria 2283
282 Ga0265316_10114291 3300031344 Unclassified 2042
283 Ga0265316_10250250 3300031344 Bacteria 1301
284 Ga0265313_10068423 3300031595 Bacteria 1641
285 Ga0265314_10004945 3300031711 Bacteria 12169
286 Ga0373934_0096972 3300035086 Bacteria 1191
287 Ga0373956_0103408 3300035119 Bacteria 1323
288 Ga0373955_0009957 3300035172 Bacteria 4473
289 Ga0373931_0382245 3300035691 Unclassified 888
290 Ga0373927_0001665 3300035695 Bacteria 16610
291 Ga0373927_0020451 3300035695 Bacteria 4339
292 Ga0373933_0032319 3300035724 Bacteria 3042
293 Ga0373947_0000811 3300035725 Bacteria 18828
294 Ga0373947_0096678 3300035725 Unclassified 1850
295 Ga0373937_0016137 3300036401 Bacteria 6626
296 Ga0373937_0609401 3300036401 Bacteria 1036
297 Ga0373925_0000116 3300037068 Bacteria 85656
298 Ga0373925_0172572 3300037068 Bacteria 1708
299 Ga0373925_0310366 3300037068 Bacteria 1275
300 Ga0395905_0653847 3300037471 Bacteria 953
301 Ga0436364_0305604 3300037853 Unclassified 2751
302 Ga0436364_0371147 3300037853 Bacteria 4302
303 Ga0436364_1370809 3300037853 Bacteria 5342
304 Ga0436364_1468552 3300037853 Bacteria 4247
305 Ga0436365_1092934 3300039437 Bacteria 3524
306 Ga0451576_0011712 3300045051 Bacteria 9937
307 Ga0495580_0008225 3300046472 Bacteria 8301
308 Ga0495580_0010440 3300046472 Bacteria 7240
309 Ga0495580_0069761 3300046472 Bacteria 2456
310 Ga0495580_0192563 3300046472 Bacteria 1406
311 Ga0495580_0225525 3300046472 Bacteria 1287
312 Ga0495580_0258351 3300046472 Bacteria 1191
313 Ga0495580_0259396 3300046472 Unclassified 1189
314 Ga0495580_0305391 3300046472 Bacteria 1083
315 Ga0495582_0109028 3300046473 Bacteria 1555
316 Ga0495628_0112852 3300046516 Bacteria 2089
317 Ga0495587_0113852 3300046536 Bacteria 1552
318 Ga0495645_0036828 3300046543 Unclassified 3566
319 Ga0495667_0016833 3300046559 Unclassified 4937
320 Ga0495667_0018197 3300046559 Bacteria 4747
321 Ga0495667_0103237 3300046559 Bacteria 1844
322 Ga0495599_0029586 3300046678 Unclassified 3434
323 Ga0495623_0035262 3300046679 Bacteria 3207
324 Ga0495613_0050150 3300046689 Bacteria 3079
325 Ga0495600_0038416 3300046809 Bacteria 3115
326 Ga0495604_0059451 3300047317 Bacteria 2929
327 Ga0495674_0018181 3300047319 Bacteria 6544
328 Ga0495674_0041758 3300047319 Bacteria 4095
329 Ga0495674_0340057 3300047319 Bacteria 1220
330 Ga0495674_0379020 3300047319 Bacteria 1145
331 Ga0495680_0237603 3300047322 Bacteria 1295
332 Ga0495680_0299291 3300047322 Bacteria 1130
333 Ga0495684_0002459 3300047471 Bacteria 14778
334 Ga0495602_0066134 3300048088 Bacteria 3116
335 Ga0496108_0000129 3300048911 Bacteria 74408
336 Ga0496109_0000124 3300048912 Bacteria 78766
337 Ga0496110_0000408 3300048913 Bacteria 29210
338 Ga0496112_0000109 3300048915 Bacteria 51364
339 Ga0496112_0244843 3300048915 Bacteria 1745
340 Ga0496113_0000848 3300048916 Bacteria 15989
341 Ga0501249_011972 3300049679 Bacteria 1829
342 Ga0501044_0020164 3300049823 Bacteria 7115
343 nmdc:mga05p37_158551_c1 3300050507 Unclassified 2764
344 nmdc:mga05p37_844785_c1 3300050507 Bacteria 995
345 nmdc:mga09592_143808_c1 3300050508 Bacteria 2056
346 nmdc:mga09592_256418_c1 3300050508 Bacteria 1516
347 nmdc:mga0qj67_30576_c1 3300050509 Bacteria 4193
348 nmdc:mga06r32_335113_c1 3300050510 Bacteria 1498
349 nmdc:mga08y16_192279_c1 3300050511 Bacteria 2116
350 nmdc:mga0n895_322565_c1 3300050512 Bacteria 1565
351 nmdc:mga08x19_1108_c1 3300050514 Bacteria 16801
352 Ga0501082_0000088 3300060353 Bacteria 70209
353 Ga0207695_10010100
354 JGI24751J29686_10021328
355 Ga0065712_10108230
356 Ga0065707_10197136
357 Ga0070658_10017385
358 Ga0070658_10053259
359 Ga0070683_100007630
360 Ga0070683_100012228
361 Ga0068869_100004661
362 Ga0070666_10001823
363 Ga0070666_10272991
364 Ga0070682_100080948
365 Ga0068868_100002275
366 Ga0068868_100002322
367 Ga0068868_100009924
368 Ga0070660_100103546
369 Ga0070689_100025668
370 Ga0070687_100028208
371 Ga0070661_100078242
372 Ga0070668_100027399
373 Ga0070669_100004504
374 Ga0070675_100019313
375 Ga0070675_100157762
376 Ga0070671_100048940
377 Ga0070671_100105347
378 Ga0070674_100016231
379 Ga0070673_100018952
380 Ga0070673_100149170
381 Ga0070688_100002583
382 Ga0070667_100015312
383 Ga0070667_100175454
384 Ga0070714_100001451
385 Ga0070713_100089092
386 Ga0070713_100188591
387 Ga0070711_100451250
388 Ga0070662_100141086
389 Ga0070681_10022322
390 Ga0070681_10129369
391 Ga0068867_100418623
392 Ga0070685_10001583
393 Ga0070679_100124692
394 Ga0070679_100254114
395 Ga0070679_100287554
396 Ga0070684_100011945
397 Ga0070684_100204669
398 Ga0070697_100111955
399 Ga0068853_100012742
400 Ga0068853_100270288
401 Ga0070672_100055136
402 Ga0070686_100003803
403 Ga0070686_100099788
404 Ga0070665_100128359
405 Ga0068855_100010725
406 Ga0068855_100014202
407 Ga0068855_100017932
408 Ga0068855_100028861
409 Ga0068855_100415055
410 Ga0070664_100206812
411 Ga0068857_100009638
412 Ga0068857_100285781
413 Ga0068856_100006342
414 Ga0068852_100005478
415 Ga0068859_100343035
416 Ga0068859_100596820
417 Ga0068864_100014155
418 Ga0068864_100020562
419 Ga0068866_10001209
420 Ga0068861_100101457
421 Ga0068851_10035485
422 Ga0068870_10001169
423 Ga0068863_100063739
424 Ga0068863_100195329
425 Ga0068858_100005980
426 Ga0068858_100031632
427 Ga0068860_100044035
428 Ga0068862_100021726
429 Ga0081539_10070459
430 Ga0097621_100011563
431 Ga0097621_100018551
432 Ga0097621_100030904
433 Ga0097621_100104581
434 Ga0068871_100001009
435 Ga0068871_100005987
436 Ga0068871_100014247
437 Ga0068871_100319673
438 Ga0068871_100320997
439 Ga0075431_100013837
440 Ga0075431_100636693
441 Ga0075429_100213542
442 Ga0068865_100008285
443 Ga0068865_100026681
444 Ga0075436_100042386
445 Ga0075436_100198009
446 Ga0097620_100160836
447 Ga0097620_100343061
448 Ga0097620_100596803
449 Ga0105240_10000709
450 Ga0105240_10013017
451 Ga0105240_10049213
452 Ga0105240_10083893
453 Ga0105240_10291088
454 Ga0111539_10077966
455 Ga0105245_10002163
456 Ga0105245_10003137
457 Ga0105245_10024864
458 Ga0105245_10075625
459 Ga0105245_10098554
460 Ga0105245_10373190
461 Ga0105245_10680193
462 Ga0105247_10004466
463 Ga0105247_10031406
464 Ga0105247_10086867
465 Ga0105243_10239136
466 Ga0105241_10008535
467 Ga0105241_10020838
468 Ga0105241_10040558
469 Ga0105241_10062135
470 Ga0105241_10194230
471 Ga0105241_10246287
472 Ga0105242_10001977
473 Ga0105242_10013866
474 Ga0105242_10067993
475 Ga0105242_10244749
476 Ga0105248_10029915
477 Ga0105248_10134701
478 Ga0105248_10403911
479 Ga0105248_10498673
480 Ga0105248_10508320
481 Ga0105248_10517655
482 Ga0105237_10077423
483 Ga0105238_10007540
484 Ga0105238_10016963
485 Ga0105238_10038397
486 Ga0105238_10115251
487 Ga0105238_10254142
488 Ga0105238_10347860
489 Ga0105249_10603617
490 Ga0105239_10019023
491 Ga0105239_10019814
492 Ga0105239_10020900
493 Ga0105239_10021949
494 Ga0105239_10081058
495 Ga0105239_10154007
496 Ga0105246_10000897
497 Ga0157373_10008983
498 Ga0157371_10007242
499 Ga0157370_10050696
500 Ga0157370_10115215
501 Ga0157369_10005242
502 Ga0157369_10035527
503 Ga0157374_10021161
504 Ga0157374_10097861
505 Ga0157378_10036062
506 Ga0157378_10458951
507 Ga0157378_10508545
508 Ga0163162_10085843
509 Ga0163162_10310348
510 Ga0163162_10381036
511 Ga0157372_10045107
512 Ga0157372_10349657
513 Ga0157375_10267204
514 Ga0157375_10274594
515 Ga0157375_10296059
516 Ga0157375_10507788
517 Ga0157375_10749205
518 Ga0163163_10001960
519 Ga0163163_10002598
520 Ga0163163_10306795
521 Ga0163163_10354674
522 Ga0163163_10505312
523 Ga0157380_10010049
524 Ga0157379_10019353
525 Ga0157379_10027028
526 Ga0157376_10028991
527 Ga0157376_10039925
528 Ga0157376_10074144
529 Ga0157376_10327249
530 Ga0163161_10004560
531 Ga0213876_10055275
532 Ga0207697_10018615
533 Ga0207710_10011160
534 Ga0207688_10003416
535 Ga0207680_10327530
536 Ga0207647_10050451
537 Ga0207645_10001897
538 Ga0207643_10000869
539 Ga0207705_10023851
540 Ga0207705_10181440
541 Ga0207684_10067780
542 Ga0207654_10006762
543 Ga0207654_10027436
544 Ga0207654_10058568
545 Ga0207707_10032994
546 Ga0207707_10105010
547 Ga0207695_10002373
548 Ga0207695_10172721
549 Ga0207695_10260998
550 Ga0207695_10335668
551 Ga0207671_10046892
552 Ga0207693_10080324
553 Ga0207662_10003133
554 Ga0207657_10008514
555 Ga0207657_10013771
556 Ga0207649_10000439
557 Ga0207681_10113984
558 Ga0207694_10003426
559 Ga0207694_10013432
560 Ga0207694_10019442
561 Ga0207694_10089116
562 Ga0207650_10000053
563 Ga0207650_10428317
564 Ga0207659_10010370
565 Ga0207687_10009044
566 Ga0207687_10033350
567 Ga0207687_10073600
568 Ga0207687_10097666
569 Ga0207687_10098011
570 Ga0207687_10268854
571 Ga0207700_10019849
572 Ga0207700_10219115
573 Ga0207644_10011368
574 Ga0207644_10013253
575 Ga0207644_10155134
576 Ga0207690_10004912
577 Ga0207690_10209201
578 Ga0207706_10000229
579 Ga0207686_10004681
580 Ga0207686_10067961
581 Ga0207686_10264018
582 Ga0207670_10007095
583 Ga0207704_10015926
584 Ga0207704_10051394
585 Ga0207691_10005576
586 Ga0207711_10016037
587 Ga0207711_10062278
588 Ga0207711_10428147
589 Ga0207711_10499250
590 Ga0207689_10000106
591 Ga0207661_10000445
592 Ga0207661_10288443
593 Ga0207679_10000110
594 Ga0207667_10012406
595 Ga0207667_10100206
596 Ga0207667_10569032
597 Ga0207651_10013885
598 Ga0207651_10319723
599 Ga0207668_10021659
600 Ga0207658_10011968
601 Ga0207658_10012518
602 Ga0207677_10003453
603 Ga0207703_10012077
604 Ga0207703_10071494
605 Ga0207703_10258977
606 Ga0207639_10384120
607 Ga0207678_10005099
608 Ga0207702_10006104
609 Ga0207641_10000104
610 Ga0207641_10017442
611 Ga0207648_10001080
612 Ga0207648_10174939
613 Ga0207676_10000288
614 Ga0207676_10015283
615 Ga0207674_10000092
616 Ga0207674_10006162
617 Ga0207674_10239980
618 Ga0207675_100023652
619 Ga0207683_10002015
620 Ga0207698_10303927
621 Ga0268266_10003198
622 Ga0268266_10009537
623 Ga0268264_10003554
624 Ga0268264_10018018
625 Ga0268264_10434331
626 Ga0265323_10000402
627 Ga0265330_10097761
628 Ga0265327_10071530
629 Ga0265316_10000627
630 Ga0265316_10002205
631 Ga0265316_10019580
632 Ga0265316_10019854
633 Ga0265316_10094086
634 Ga0265316_10114291
635 Ga0265316_10250250
636 Ga0265313_10068423
637 Ga0265314_10004945
638 Ga0373934_0096972
639 Ga0373956_0103408
640 Ga0373955_0009957
641 Ga0373931_0382245
642 Ga0373927_0001665
643 Ga0373927_0020451
644 Ga0373933_0032319
645 Ga0373947_0000811
646 Ga0373947_0096678
647 Ga0373937_0016137
648 Ga0373937_0609401
649 Ga0373925_0000116
650 Ga0373925_0172572
651 Ga0373925_0310366
652 Ga0395905_0653847
653 Ga0436364_0305604
654 Ga0436364_0371147
655 Ga0436364_1370809
656 Ga0436364_1468552
657 Ga0436365_1092934
658 Ga0451576_0011712
659 Ga0495580_0008225
660 Ga0495580_0010440
661 Ga0495580_0069761
662 Ga0495580_0192563
663 Ga0495580_0225525
664 Ga0495580_0258351
665 Ga0495580_0259396
666 Ga0495580_0305391
667 Ga0495582_0109028
668 Ga0495628_0112852
669 Ga0495587_0113852
670 Ga0495645_0036828
671 Ga0495667_0016833
672 Ga0495667_0018197
673 Ga0495667_0103237
674 Ga0495599_0029586
675 Ga0495623_0035262
676 Ga0495613_0050150
677 Ga0495600_0038416
678 Ga0495604_0059451
679 Ga0495674_0018181
680 Ga0495674_0041758
681 Ga0495674_0340057
682 Ga0495674_0379020
683 Ga0495680_0237603
684 Ga0495680_0299291
685 Ga0495684_0002459
686 Ga0495602_0066134
687 Ga0496108_0000129
688 Ga0496109_0000124
689 Ga0496110_0000408
690 Ga0496112_0000109
691 Ga0496112_0244843
692 Ga0496113_0000848
693 Ga0501249_011972
694 Ga0501044_0020164
695 nmdc:mga05p37_158551_c1
696 nmdc:mga05p37_844785_c1
697 nmdc:mga09592_143808_c1
698 nmdc:mga09592_256418_c1
699 nmdc:mga0qj67_30576_c1
700 nmdc:mga06r32_335113_c1
701 nmdc:mga08y16_192279_c1
702 nmdc:mga0n895_322565_c1
703 nmdc:mga08x19_1108_c1
704 Ga0501082_0000088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

189

309

0.98

PF03668

RapZ-like_N

RapZ-like N-terminal domain

30

185

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9528 186 303
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9082 186 303
2vli-assembly2.cif.gz_B-2 structure of deinococcus radiodurans tunicamycin resistance protein 0.6866 26 175
3vaa-assembly2.cif.gz_B 1.7 angstrom resolution crystal structure of shikimate kinase from bacteroides thetaiotaomicron 0.6698 28 179
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.6679 26 177
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9506 193 305 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.876 193 305 3.40.50.720
af_P0A894_1_282_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7552 27 303 3.40.50.300
af_P0A894_1_282_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7393 27 303 3.40.50.300
af_Q54TE2_1_167_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6792 25 130 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2Y5A4U3-F1-model_v4 deleted 0.96 189 303
AF-A0A7C9RG02-F1-model_v4 RNase adaptor protein RapZ 0.9591 27 179 GO:0005524
GO:0005525
AF-A0A662DSW2-F1-model_v4 RNase adaptor protein RapZ 0.9572 186 304 GO:0005524
AF-A0A7C8DKR4-F1-model_v4 RNase adaptor protein RapZ 0.9568 185 304 GO:0005524
AF-A0A838GXN5-F1-model_v4 RNase adaptor protein RapZ 0.9551 25 171 GO:0005524
GO:0005525

Map