F418924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 352 | 186 | 352 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10190895|Ga0070710_101908952 |
| Length | 272 |
| Sequence | MRSMRQLPRFQFRESAFQSPFCKCPTANCNLSVSPITGKPKLAIAAFLLSLIMVEISCRGLLFDLDGVLVDSTPAVARVWTKWALAHGFDPEETVRKAHGRPSLTTIKELLPNAADPIAENQVVLRGEIEDTDGIVPLPGVCDFLKALPQNRWALVTSCSKPLAHVRLSAAGIPIPEKIVTSDDVQHGKPDPEPYLKGAALLGLPASECVVFEDAPAGIRAGKAAGARVVALPTSSPENELKSSGADWVLPGYAHLSVMSANGFPGLKLRLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 52 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 78 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 137 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 183 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 96.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100008769 | 3300005329 | Bacteria | 8596 |
| 2 | Ga0068869_100035638 | 3300005334 | Bacteria | 3528 |
| 3 | Ga0070680_100055067 | 3300005336 | Bacteria | 3250 |
| 4 | Ga0068868_100001960 | 3300005338 | Bacteria | 14101 |
| 5 | Ga0068868_100007353 | 3300005338 | Bacteria | 7843 |
| 6 | Ga0068868_100027134 | 3300005338 | Bacteria | 4367 |
| 7 | Ga0070687_100013685 | 3300005343 | Bacteria | 3623 |
| 8 | Ga0070675_100040046 | 3300005354 | Bacteria | 3825 |
| 9 | Ga0070671_100031817 | 3300005355 | Unclassified | 4361 |
| 10 | Ga0070709_10003180 | 3300005434 | Bacteria | 8807 |
| 11 | Ga0070709_10279872 | 3300005434 | Bacteria | 1212 |
| 12 | Ga0070714_100048704 | 3300005435 | Bacteria | 3605 |
| 13 | Ga0070714_100228811 | 3300005435 | Unclassified | 1712 |
| 14 | Ga0070714_100305222 | 3300005435 | Unclassified | 1485 |
| 15 | Ga0070713_100002231 | 3300005436 | Bacteria | 12564 |
| 16 | Ga0070713_100080810 | 3300005436 | Bacteria | 2772 |
| 17 | Ga0070713_100125344 | 3300005436 | Bacteria | 2258 |
| 18 | Ga0070713_100181121 | 3300005436 | Bacteria | 1893 |
| 19 | Ga0070713_100350603 | 3300005436 | Unclassified | 1369 |
| 20 | Ga0070710_10190895 | 3300005437 | Bacteria | 1288 |
| 21 | Ga0070710_10293668 | 3300005437 | Bacteria | 1059 |
| 22 | Ga0070711_100106482 | 3300005439 | Bacteria | 2050 |
| 23 | Ga0070711_100226789 | 3300005439 | Unclassified | 1455 |
| 24 | Ga0070711_100230402 | 3300005439 | Bacteria | 1444 |
| 25 | Ga0070711_100345096 | 3300005439 | Bacteria | 1196 |
| 26 | Ga0070705_100023376 | 3300005440 | Bacteria | 3318 |
| 27 | Ga0070705_100326279 | 3300005440 | Unclassified | 1110 |
| 28 | Ga0070708_100002019 | 3300005445 | Bacteria | 15622 |
| 29 | Ga0070708_100064427 | 3300005445 | Bacteria | 3284 |
| 30 | Ga0070681_10000055 | 3300005458 | Bacteria | 80179 |
| 31 | Ga0070681_10147148 | 3300005458 | Bacteria | 2284 |
| 32 | Ga0070681_10241216 | 3300005458 | Bacteria | 1721 |
| 33 | Ga0068867_100011100 | 3300005459 | Bacteria | 6355 |
| 34 | Ga0070706_100184021 | 3300005467 | Bacteria | 1951 |
| 35 | Ga0070707_100103187 | 3300005468 | Unclassified | 2763 |
| 36 | Ga0070707_100127570 | 3300005468 | Bacteria | 2472 |
| 37 | Ga0070707_100491180 | 3300005468 | Bacteria | 1189 |
| 38 | Ga0070707_100517486 | 3300005468 | Bacteria | 1155 |
| 39 | Ga0070698_100012602 | 3300005471 | Bacteria | 8955 |
| 40 | Ga0070699_100043476 | 3300005518 | Bacteria | 3888 |
| 41 | Ga0070679_100069155 | 3300005530 | Bacteria | 3522 |
| 42 | Ga0070679_100088289 | 3300005530 | Bacteria | 3088 |
| 43 | Ga0070679_100272537 | 3300005530 | Bacteria | 1646 |
| 44 | Ga0070684_100021584 | 3300005535 | Bacteria | 5362 |
| 45 | Ga0070684_100053890 | 3300005535 | Bacteria | 3503 |
| 46 | Ga0070697_100019967 | 3300005536 | Bacteria | 5295 |
| 47 | Ga0070686_100060835 | 3300005544 | Bacteria | 2438 |
| 48 | Ga0070696_100245379 | 3300005546 | Bacteria | 1352 |
| 49 | Ga0070693_100018029 | 3300005547 | Bacteria | 3681 |
| 50 | Ga0070693_100105610 | 3300005547 | Unclassified | 1723 |
| 51 | Ga0070693_100198585 | 3300005547 | Unclassified | 1301 |
| 52 | Ga0068855_100001077 | 3300005563 | Bacteria | 33925 |
| 53 | Ga0068855_100002871 | 3300005563 | Bacteria | 21140 |
| 54 | Ga0068855_100061692 | 3300005563 | Bacteria | 4380 |
| 55 | Ga0068855_100357847 | 3300005563 | Unclassified | 1607 |
| 56 | Ga0070664_100001803 | 3300005564 | Bacteria | 17165 |
| 57 | Ga0070664_100056829 | 3300005564 | Unclassified | 3325 |
| 58 | Ga0068857_100000041 | 3300005577 | Bacteria | 70173 |
| 59 | Ga0068857_100007186 | 3300005577 | Bacteria | 9591 |
| 60 | Ga0068854_100006073 | 3300005578 | Bacteria | 7661 |
| 61 | Ga0068854_100072079 | 3300005578 | Unclassified | 2529 |
| 62 | Ga0068854_100085520 | 3300005578 | Bacteria | 2336 |
| 63 | Ga0068856_100000355 | 3300005614 | Bacteria | 49986 |
| 64 | Ga0068856_100001245 | 3300005614 | Bacteria | 26739 |
| 65 | Ga0068856_100001397 | 3300005614 | Bacteria | 25289 |
| 66 | Ga0068856_100087961 | 3300005614 | Bacteria | 3089 |
| 67 | Ga0070702_100427094 | 3300005615 | Unclassified | 955 |
| 68 | Ga0068852_100011956 | 3300005616 | Bacteria | 6566 |
| 69 | Ga0068852_100026166 | 3300005616 | Bacteria | 4738 |
| 70 | Ga0068852_100307464 | 3300005616 | Bacteria | 1536 |
| 71 | Ga0068852_100598890 | 3300005616 | Unclassified | 1106 |
| 72 | Ga0068859_100000959 | 3300005617 | Bacteria | 29530 |
| 73 | Ga0068864_100005434 | 3300005618 | Bacteria | 10446 |
| 74 | Ga0068864_100006890 | 3300005618 | Bacteria | 9315 |
| 75 | Ga0068866_10250552 | 3300005718 | Unclassified | 1083 |
| 76 | Ga0068863_100040850 | 3300005841 | Bacteria | 4410 |
| 77 | Ga0068863_100058223 | 3300005841 | Bacteria | 3657 |
| 78 | Ga0068863_100086132 | 3300005841 | Bacteria | 2977 |
| 79 | Ga0068863_100176285 | 3300005841 | Bacteria | 2052 |
| 80 | Ga0068858_100043994 | 3300005842 | Bacteria | 4140 |
| 81 | Ga0068858_100303383 | 3300005842 | Bacteria | 1524 |
| 82 | Ga0068860_100016243 | 3300005843 | Bacteria | 7258 |
| 83 | Ga0068860_100085305 | 3300005843 | Bacteria | 3005 |
| 84 | Ga0068860_100777318 | 3300005843 | Bacteria | 970 |
| 85 | Ga0081540_1039082 | 3300005983 | Bacteria | 2491 |
| 86 | Ga0070717_10004158 | 3300006028 | Bacteria | 10434 |
| 87 | Ga0070717_10151350 | 3300006028 | Bacteria | 2007 |
| 88 | Ga0070717_10263480 | 3300006028 | Viruses | 1525 |
| 89 | Ga0070716_100002152 | 3300006173 | Bacteria | 9057 |
| 90 | Ga0070716_100015676 | 3300006173 | Bacteria | 3899 |
| 91 | Ga0070716_100214269 | 3300006173 | Bacteria | 1289 |
| 92 | Ga0070716_100545064 | 3300006173 | Unclassified | 864 |
| 93 | Ga0070712_100039444 | 3300006175 | Bacteria | 3232 |
| 94 | Ga0070712_100077081 | 3300006175 | Bacteria | 2402 |
| 95 | Ga0070712_100496181 | 3300006175 | Unclassified | 1023 |
| 96 | Ga0097621_100000533 | 3300006237 | Bacteria | 26715 |
| 97 | Ga0097621_100000581 | 3300006237 | Bacteria | 25739 |
| 98 | Ga0097621_100002739 | 3300006237 | Bacteria | 12055 |
| 99 | Ga0097621_100003948 | 3300006237 | Bacteria | 10274 |
| 100 | Ga0097621_100051783 | 3300006237 | Bacteria | 3342 |
| 101 | Ga0097621_100249159 | 3300006237 | Bacteria | 1555 |
| 102 | Ga0068871_100000221 | 3300006358 | Bacteria | 40089 |
| 103 | Ga0068871_100000664 | 3300006358 | Bacteria | 23618 |
| 104 | Ga0068871_100007730 | 3300006358 | Bacteria | 7695 |
| 105 | Ga0068871_100012155 | 3300006358 | Bacteria | 6336 |
| 106 | Ga0068871_100092732 | 3300006358 | Unclassified | 2519 |
| 107 | Ga0068871_100152225 | 3300006358 | Unclassified | 1973 |
| 108 | Ga0075433_10591549 | 3300006852 | Bacteria | 974 |
| 109 | Ga0075434_100012218 | 3300006871 | Bacteria | 8136 |
| 110 | Ga0075434_100017276 | 3300006871 | Bacteria | 6948 |
| 111 | Ga0075434_100045476 | 3300006871 | Bacteria | 4355 |
| 112 | Ga0075434_100193453 | 3300006871 | Bacteria | 2055 |
| 113 | Ga0068865_100022996 | 3300006881 | Bacteria | 4075 |
| 114 | Ga0068865_100702532 | 3300006881 | Unclassified | 864 |
| 115 | Ga0097620_100000959 | 3300006931 | Bacteria | 29530 |
| 116 | Ga0075435_100005304 | 3300007076 | Bacteria | 8979 |
| 117 | Ga0075435_100014467 | 3300007076 | Bacteria | 5899 |
| 118 | Ga0075435_100039481 | 3300007076 | Bacteria | 3767 |
| 119 | Ga0099794_10003719 | 3300007265 | Bacteria | 5871 |
| 120 | Ga0099794_10015509 | 3300007265 | Bacteria | 3365 |
| 121 | Ga0099795_10002165 | 3300007788 | Bacteria | 4534 |
| 122 | Ga0105240_10032699 | 3300009093 | Bacteria | 6732 |
| 123 | Ga0105240_10038395 | 3300009093 | Bacteria | 6142 |
| 124 | Ga0105240_10043737 | 3300009093 | Bacteria | 5695 |
| 125 | Ga0105240_10097442 | 3300009093 | Bacteria | 3583 |
| 126 | Ga0105240_10693811 | 3300009093 | Unclassified | 1112 |
| 127 | Ga0105247_10161779 | 3300009101 | Bacteria | 1483 |
| 128 | Ga0105241_10011619 | 3300009174 | Bacteria | 6457 |
| 129 | Ga0105242_10175396 | 3300009176 | Bacteria | 1887 |
| 130 | Ga0105248_10015348 | 3300009177 | Bacteria | 8448 |
| 131 | Ga0105248_10257754 | 3300009177 | Bacteria | 1963 |
| 132 | Ga0105237_10015644 | 3300009545 | Bacteria | 7886 |
| 133 | Ga0105237_10019843 | 3300009545 | Bacteria | 6939 |
| 134 | Ga0105237_10300373 | 3300009545 | Bacteria | 1609 |
| 135 | Ga0105238_10006729 | 3300009551 | Bacteria | 11474 |
| 136 | Ga0105238_10644257 | 3300009551 | Bacteria | 1069 |
| 137 | Ga0105249_10427452 | 3300009553 | Bacteria | 1359 |
| 138 | Ga0105249_10531370 | 3300009553 | Bacteria | 1225 |
| 139 | Ga0099796_10014360 | 3300010159 | Bacteria | 2286 |
| 140 | Ga0105239_10030756 | 3300010375 | Bacteria | 5905 |
| 141 | Ga0105239_10323704 | 3300010375 | Bacteria | 1739 |
| 142 | Ga0105246_10023240 | 3300011119 | Bacteria | 4009 |
| 143 | Ga0157373_10001055 | 3300013100 | Bacteria | 21221 |
| 144 | Ga0157371_10038309 | 3300013102 | Unclassified | 3430 |
| 145 | Ga0157371_10045252 | 3300013102 | Bacteria | 3132 |
| 146 | Ga0157371_10165722 | 3300013102 | Bacteria | 1578 |
| 147 | Ga0157370_10017861 | 3300013104 | Bacteria | 7148 |
| 148 | Ga0157369_10000170 | 3300013105 | Bacteria | 91583 |
| 149 | Ga0157369_10009253 | 3300013105 | Bacteria | 11271 |
| 150 | Ga0157369_10021941 | 3300013105 | Bacteria | 7138 |
| 151 | Ga0157369_10032911 | 3300013105 | Bacteria | 5698 |
| 152 | Ga0157369_10048297 | 3300013105 | Bacteria | 4618 |
| 153 | Ga0157369_10150584 | 3300013105 | Bacteria | 2459 |
| 154 | Ga0157374_10000316 | 3300013296 | Bacteria | 44946 |
| 155 | Ga0157374_10000330 | 3300013296 | Bacteria | 43615 |
| 156 | Ga0157374_10000533 | 3300013296 | Bacteria | 34093 |
| 157 | Ga0157378_10000085 | 3300013297 | Bacteria | 87651 |
| 158 | Ga0157378_10000096 | 3300013297 | Bacteria | 83922 |
| 159 | Ga0157378_10000182 | 3300013297 | Bacteria | 60024 |
| 160 | Ga0157378_10071107 | 3300013297 | Bacteria | 3124 |
| 161 | Ga0157378_10103227 | 3300013297 | Bacteria | 2605 |
| 162 | Ga0157378_10318656 | 3300013297 | Bacteria | 1510 |
| 163 | Ga0157378_10343956 | 3300013297 | Bacteria | 1455 |
| 164 | Ga0163162_10832279 | 3300013306 | Bacteria | 1039 |
| 165 | Ga0157372_10000620 | 3300013307 | Bacteria | 38778 |
| 166 | Ga0157372_10001563 | 3300013307 | Bacteria | 24933 |
| 167 | Ga0157372_10001829 | 3300013307 | Bacteria | 23049 |
| 168 | Ga0157372_10002374 | 3300013307 | Bacteria | 20377 |
| 169 | Ga0157372_10011673 | 3300013307 | Bacteria | 9352 |
| 170 | Ga0157372_10023041 | 3300013307 | Bacteria | 6748 |
| 171 | Ga0157372_10028884 | 3300013307 | Bacteria | 6052 |
| 172 | Ga0157372_10032055 | 3300013307 | Bacteria | 5759 |
| 173 | Ga0157372_10173717 | 3300013307 | Bacteria | 2493 |
| 174 | Ga0157375_10124899 | 3300013308 | Bacteria | 2687 |
| 175 | Ga0157375_10244632 | 3300013308 | Bacteria | 1954 |
| 176 | Ga0157375_11734135 | 3300013308 | Unclassified | 740 |
| 177 | Ga0163163_10401700 | 3300014325 | Bacteria | 1428 |
| 178 | Ga0157377_10040099 | 3300014745 | Bacteria | 2592 |
| 179 | Ga0157379_10112996 | 3300014968 | Bacteria | 2441 |
| 180 | Ga0157376_10000014 | 3300014969 | Bacteria | 303001 |
| 181 | Ga0157376_10000462 | 3300014969 | Bacteria | 26233 |
| 182 | Ga0157376_10045908 | 3300014969 | Bacteria | 3600 |
| 183 | Ga0157376_10166630 | 3300014969 | Bacteria | 2002 |
| 184 | Ga0228598_1000362 | 3300024227 | Bacteria | 8988 |
| 185 | Ga0207692_10046164 | 3300025898 | Bacteria | 2183 |
| 186 | Ga0207642_10109524 | 3300025899 | Bacteria | 1403 |
| 187 | Ga0207710_10131421 | 3300025900 | Bacteria | 1202 |
| 188 | Ga0207647_10008021 | 3300025904 | Bacteria | 7593 |
| 189 | Ga0207699_10002789 | 3300025906 | Bacteria | 8251 |
| 190 | Ga0207699_10096009 | 3300025906 | Bacteria | 1871 |
| 191 | Ga0207643_10067271 | 3300025908 | Bacteria | 2056 |
| 192 | Ga0207654_10008543 | 3300025911 | Bacteria | 5186 |
| 193 | Ga0207707_10000739 | 3300025912 | Bacteria | 32307 |
| 194 | Ga0207707_10005345 | 3300025912 | Bacteria | 11220 |
| 195 | Ga0207707_10343213 | 3300025912 | Unclassified | 1287 |
| 196 | Ga0207695_10065669 | 3300025913 | Bacteria | 3730 |
| 197 | Ga0207695_10073020 | 3300025913 | Bacteria | 3497 |
| 198 | Ga0207695_10489334 | 3300025913 | Unclassified | 1112 |
| 199 | Ga0207671_10030492 | 3300025914 | Bacteria | 4022 |
| 200 | Ga0207693_10027726 | 3300025915 | Bacteria | 4477 |
| 201 | Ga0207693_10033637 | 3300025915 | Bacteria | 4044 |
| 202 | Ga0207693_10348186 | 3300025915 | Unclassified | 1159 |
| 203 | Ga0207693_10933846 | 3300025915 | Bacteria | 665 |
| 204 | Ga0207663_10131586 | 3300025916 | Bacteria | 1729 |
| 205 | Ga0207662_10073830 | 3300025918 | Bacteria | 2070 |
| 206 | Ga0207652_10061025 | 3300025921 | Bacteria | 3255 |
| 207 | Ga0207652_10689423 | 3300025921 | Bacteria | 912 |
| 208 | Ga0207646_10197909 | 3300025922 | Bacteria | 1815 |
| 209 | Ga0207646_10584695 | 3300025922 | Bacteria | 1003 |
| 210 | Ga0207694_10098661 | 3300025924 | Bacteria | 2313 |
| 211 | Ga0207650_10018697 | 3300025925 | Bacteria | 4866 |
| 212 | Ga0207659_10032473 | 3300025926 | Bacteria | 3583 |
| 213 | Ga0207687_10214937 | 3300025927 | Unclassified | 1510 |
| 214 | Ga0207700_10006558 | 3300025928 | Bacteria | 7043 |
| 215 | Ga0207700_10033559 | 3300025928 | Bacteria | 3674 |
| 216 | Ga0207700_10341974 | 3300025928 | Unclassified | 1301 |
| 217 | Ga0207700_10474055 | 3300025928 | Unclassified | 1105 |
| 218 | Ga0207700_10717773 | 3300025928 | Bacteria | 893 |
| 219 | Ga0207664_10007506 | 3300025929 | Bacteria | 7564 |
| 220 | Ga0207664_10042113 | 3300025929 | Bacteria | 3563 |
| 221 | Ga0207664_10107343 | 3300025929 | Bacteria | 2316 |
| 222 | Ga0207664_10390970 | 3300025929 | Bacteria | 1236 |
| 223 | Ga0207686_10352538 | 3300025934 | Bacteria | 1108 |
| 224 | Ga0207670_10221419 | 3300025936 | Bacteria | 1449 |
| 225 | Ga0207704_10033299 | 3300025938 | Bacteria | 2928 |
| 226 | Ga0207704_10621055 | 3300025938 | Unclassified | 887 |
| 227 | Ga0207665_10004561 | 3300025939 | Bacteria | 9191 |
| 228 | Ga0207665_10098430 | 3300025939 | Bacteria | 2038 |
| 229 | Ga0207711_10057247 | 3300025941 | Bacteria | 3352 |
| 230 | Ga0207689_10006686 | 3300025942 | Bacteria | 10172 |
| 231 | Ga0207661_10007877 | 3300025944 | Bacteria | 7591 |
| 232 | Ga0207679_10006350 | 3300025945 | Bacteria | 7470 |
| 233 | Ga0207679_10260402 | 3300025945 | Unclassified | 1479 |
| 234 | Ga0207667_10000785 | 3300025949 | Bacteria | 41249 |
| 235 | Ga0207667_10003707 | 3300025949 | Bacteria | 18846 |
| 236 | Ga0207667_10005364 | 3300025949 | Bacteria | 15629 |
| 237 | Ga0207667_10123205 | 3300025949 | Bacteria | 2671 |
| 238 | Ga0207651_10364096 | 3300025960 | Bacteria | 1221 |
| 239 | Ga0207640_10009516 | 3300025981 | Bacteria | 5443 |
| 240 | Ga0207640_10050349 | 3300025981 | Bacteria | 2702 |
| 241 | Ga0207677_10004627 | 3300026023 | Bacteria | 7403 |
| 242 | Ga0207677_10005454 | 3300026023 | Bacteria | 6906 |
| 243 | Ga0207703_10020414 | 3300026035 | Bacteria | 5181 |
| 244 | Ga0207703_10069166 | 3300026035 | Bacteria | 2911 |
| 245 | Ga0207639_10547362 | 3300026041 | Bacteria | 1062 |
| 246 | Ga0207702_10000089 | 3300026078 | Bacteria | 105440 |
| 247 | Ga0207702_10000759 | 3300026078 | Bacteria | 34304 |
| 248 | Ga0207702_10010816 | 3300026078 | Bacteria | 7612 |
| 249 | Ga0207641_10036769 | 3300026088 | Bacteria | 4087 |
| 250 | Ga0207641_10078728 | 3300026088 | Bacteria | 2855 |
| 251 | Ga0207641_10309710 | 3300026088 | Bacteria | 1494 |
| 252 | Ga0207641_10357469 | 3300026088 | Bacteria | 1393 |
| 253 | Ga0207648_10005354 | 3300026089 | Bacteria | 12938 |
| 254 | Ga0207676_10008246 | 3300026095 | Bacteria | 7411 |
| 255 | Ga0207676_10011245 | 3300026095 | Bacteria | 6395 |
| 256 | Ga0207674_10000309 | 3300026116 | Bacteria | 62067 |
| 257 | Ga0207683_10109270 | 3300026121 | Bacteria | 2475 |
| 258 | Ga0207698_10018594 | 3300026142 | Bacteria | 4740 |
| 259 | Ga0207698_11358952 | 3300026142 | Unclassified | 725 |
| 260 | Ga0209179_1001747 | 3300027512 | Bacteria | 2762 |
| 261 | Ga0268266_10000204 | 3300028379 | Bacteria | 104000 |
| 262 | Ga0268264_10013668 | 3300028381 | Bacteria | 6682 |
| 263 | Ga0268264_10075062 | 3300028381 | Bacteria | 2874 |
| 264 | Ga0268264_10543989 | 3300028381 | Bacteria | 1138 |
| 265 | Ga0373934_0000569 | 3300035086 | Bacteria | 12980 |
| 266 | Ga0373934_0032778 | 3300035086 | Unclassified | 2039 |
| 267 | Ga0373923_0044735 | 3300035111 | Bacteria | 1837 |
| 268 | Ga0373954_0000253 | 3300035118 | Bacteria | 19301 |
| 269 | Ga0373956_0003879 | 3300035119 | Bacteria | 6007 |
| 270 | Ga0373943_0062079 | 3300035170 | Bacteria | 1870 |
| 271 | Ga0373946_0254109 | 3300035171 | Unclassified | 858 |
| 272 | Ga0373955_0009722 | 3300035172 | Bacteria | 4517 |
| 273 | Ga0373924_0091149 | 3300035410 | Bacteria | 1304 |
| 274 | Ga0373931_0502148 | 3300035691 | Bacteria | 782 |
| 275 | Ga0373927_0031526 | 3300035695 | Bacteria | 3455 |
| 276 | Ga0373927_0110108 | 3300035695 | Bacteria | 1794 |
| 277 | Ga0373937_0003091 | 3300036401 | Bacteria | 13926 |
| 278 | Ga0373937_0025470 | 3300036401 | Bacteria | 5340 |
| 279 | Ga0373937_0216698 | 3300036401 | Bacteria | 1802 |
| 280 | Ga0373925_0005926 | 3300037068 | Bacteria | 9061 |
| 281 | Ga0373925_0020882 | 3300037068 | Bacteria | 4773 |
| 282 | Ga0395900_1040208 | 3300037418 | Bacteria | 738 |
| 283 | Ga0436363_1655911 | 3300039450 | Bacteria | 700 |
| 284 | Ga0436362_0334436 | 3300039453 | Unclassified | 912 |
| 285 | Ga0466966_0428471 | 3300044684 | Bacteria | 795 |
| 286 | Ga0466961_0080159 | 3300044693 | Unclassified | 2067 |
| 287 | Ga0466963_0122569 | 3300044694 | Bacteria | 1790 |
| 288 | Ga0453684_0712067 | 3300044712 | Unclassified | 1090 |
| 289 | Ga0466971_0036988 | 3300044719 | Unclassified | 2189 |
| 290 | Ga0466957_0092398 | 3300044842 | Bacteria | 1898 |
| 291 | Ga0466959_0105057 | 3300045049 | Bacteria | 2020 |
| 292 | Ga0451576_0605077 | 3300045051 | Unclassified | 1152 |
| 293 | Ga0466967_0175679 | 3300045976 | Bacteria | 2018 |
| 294 | Ga0495603_0013040 | 3300046455 | Bacteria | 5025 |
| 295 | Ga0495603_0024560 | 3300046455 | Bacteria | 3646 |
| 296 | Ga0495641_0033594 | 3300046461 | Bacteria | 2433 |
| 297 | Ga0495651_0069057 | 3300046462 | Unclassified | 2692 |
| 298 | Ga0495653_0026708 | 3300046463 | Unclassified | 4627 |
| 299 | Ga0495580_0004333 | 3300046472 | Bacteria | 11913 |
| 300 | Ga0495580_0006128 | 3300046472 | Bacteria | 9836 |
| 301 | Ga0495580_0009426 | 3300046472 | Bacteria | 7681 |
| 302 | Ga0495580_0050069 | 3300046472 | Bacteria | 2954 |
| 303 | Ga0495580_0204093 | 3300046472 | Bacteria | 1361 |
| 304 | Ga0495582_0000168 | 3300046473 | Bacteria | 35577 |
| 305 | Ga0495662_0080452 | 3300046476 | Bacteria | 1584 |
| 306 | Ga0495664_0032039 | 3300046477 | Bacteria | 3083 |
| 307 | Ga0495594_0031366 | 3300046499 | Bacteria | 2880 |
| 308 | Ga0495608_0012244 | 3300046511 | Bacteria | 5959 |
| 309 | Ga0495618_0202503 | 3300046514 | Bacteria | 1256 |
| 310 | Ga0495630_0038425 | 3300046517 | Bacteria | 3580 |
| 311 | Ga0495630_0156808 | 3300046517 | Bacteria | 1733 |
| 312 | Ga0495666_0004851 | 3300046526 | Bacteria | 6797 |
| 313 | Ga0495665_0200571 | 3300046531 | Bacteria | 1034 |
| 314 | Ga0495640_0023650 | 3300046533 | Bacteria | 4471 |
| 315 | Ga0495586_0113208 | 3300046535 | Bacteria | 1511 |
| 316 | Ga0495587_0042895 | 3300046536 | Unclassified | 2695 |
| 317 | Ga0495622_0275078 | 3300046557 | Unclassified | 737 |
| 318 | Ga0495667_0062678 | 3300046559 | Unclassified | 2436 |
| 319 | Ga0495635_0036079 | 3300046663 | Bacteria | 3428 |
| 320 | Ga0495657_0041682 | 3300046675 | Bacteria | 3140 |
| 321 | Ga0495623_0017209 | 3300046679 | Unclassified | 4670 |
| 322 | Ga0495623_0398906 | 3300046679 | Unclassified | 740 |
| 323 | Ga0495647_0021464 | 3300046681 | Bacteria | 2325 |
| 324 | Ga0495658_0014126 | 3300046683 | Bacteria | 4072 |
| 325 | Ga0495604_0004289 | 3300047317 | Bacteria | 11291 |
| 326 | Ga0495674_0104490 | 3300047319 | Unclassified | 2408 |
| 327 | Ga0495674_0223259 | 3300047319 | Bacteria | 1557 |
| 328 | Ga0495676_0026158 | 3300047321 | Bacteria | 5027 |
| 329 | Ga0495684_0046680 | 3300047471 | Bacteria | 3313 |
| 330 | Ga0495593_0062215 | 3300047673 | Bacteria | 1951 |
| 331 | Ga0495602_0036669 | 3300048088 | Bacteria | 4560 |
| 332 | Ga0495602_0163812 | 3300048088 | Bacteria | 1733 |
| 333 | Ga0496101_0088192 | 3300048904 | Bacteria | 2304 |
| 334 | Ga0496102_0444966 | 3300048905 | Unclassified | 1216 |
| 335 | Ga0496104_0121463 | 3300048907 | Unclassified | 2508 |
| 336 | Ga0496104_0135393 | 3300048907 | Bacteria | 2367 |
| 337 | Ga0496112_0052519 | 3300048915 | Bacteria | 4000 |
| 338 | Ga0496112_0053191 | 3300048915 | Bacteria | 3976 |
| 339 | Ga0496112_0120734 | 3300048915 | Bacteria | 2591 |
| 340 | Ga0496114_0003782 | 3300048917 | Bacteria | 11668 |
| 341 | Ga0496114_0087672 | 3300048917 | Bacteria | 2639 |
| 342 | Ga0496115_0026082 | 3300048918 | Bacteria | 4557 |
| 343 | nmdc:mga0n895_14256_c1 | 3300050512 | Bacteria | 7212 |
| 344 | nmdc:mga0n895_34219_c1 | 3300050512 | Bacteria | 4889 |
| 345 | nmdc:mga0n895_76213_c1 | 3300050512 | Bacteria | 3335 |
| 346 | nmdc:mga0rr50_121545_c1 | 3300050513 | Bacteria | 2079 |
| 347 | nmdc:mga0rr50_3575_c1 | 3300050513 | Bacteria | 8979 |
| 348 | nmdc:mga0rr50_77726_c1 | 3300050513 | Bacteria | 2551 |
| 349 | nmdc:mga08x19_408751_c1 | 3300050514 | Bacteria | 953 |
| 350 | nmdc:mga08x19_65667_c1 | 3300050514 | Bacteria | 2357 |
| 351 | nmdc:mga08x19_9583_c2 | 3300050514 | Bacteria | 4833 |
| 352 | nmdc:mga0a205_701543_c1 | 3300050515 | Unclassified | 862 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0712067 | Ga0453684_0712067_28_615 | 193 |
| 2 | 3300025915 | Ga0207693_10933846 | Ga0207693_109338461 | 202 |
| 3 | 3300039453 | Ga0436362_0334436 | Ga0436362_0334436_231_896 | 203 |
| 4 | 3300028379 | Ga0268266_10000204 | Ga0268266_1000020478 | 206 |
| 5 | 3300046557 | Ga0495622_0275078 | Ga0495622_0275078_13_645 | 208 |
| 6 | 3300005440 | Ga0070705_100023376 | Ga0070705_1000233762 | 210 |
| 7 | 3300005468 | Ga0070707_100127570 | Ga0070707_1001275702 | 210 |
| 8 | 3300005841 | Ga0068863_100086132 | Ga0068863_1000861324 | 210 |
| 9 | 3300005842 | Ga0068858_100303383 | Ga0068858_1003033831 | 210 |
| 10 | 3300006871 | Ga0075434_100045476 | Ga0075434_1000454763 | 210 |
| 11 | 3300006871 | Ga0075434_100193453 | Ga0075434_1001934532 | 210 |
| 12 | 3300007076 | Ga0075435_100014467 | Ga0075435_1000144676 | 210 |
| 13 | 3300025922 | Ga0207646_10197909 | Ga0207646_101979093 | 210 |
| 14 | 3300026035 | Ga0207703_10069166 | Ga0207703_100691663 | 210 |
| 15 | 3300026088 | Ga0207641_10078728 | Ga0207641_100787284 | 210 |
| 16 | 3300025915 | Ga0207693_10033637 | Ga0207693_100336374 | 215 |
| 17 | 3300046455 | Ga0495603_0013040 | Ga0495603_0013040_295_954 | 217 |
| 18 | 3300046461 | Ga0495641_0033594 | Ga0495641_0033594_400_1059 | 217 |
| 19 | 3300046472 | Ga0495580_0009426 | Ga0495580_0009426_5236_5895 | 217 |
| 20 | 3300046473 | Ga0495582_0000168 | Ga0495582_0000168_870_1529 | 217 |
| 21 | 3300005468 | Ga0070707_100491180 | Ga0070707_1004911801 | 218 |
| 22 | 3300007265 | Ga0099794_10003719 | Ga0099794_100037195 | 218 |
| 23 | 3300014969 | Ga0157376_10000462 | Ga0157376_1000046213 | 218 |
| 24 | 3300025922 | Ga0207646_10584695 | Ga0207646_105846951 | 218 |
| 25 | 3300048904 | Ga0496101_0088192 | Ga0496101_0088192_1051_1710 | 218 |
| 26 | 3300048907 | Ga0496104_0135393 | Ga0496104_0135393_1055_1729 | 218 |
| 27 | 3300048918 | Ga0496115_0026082 | Ga0496115_0026082_197_856 | 218 |
| 28 | 3300005434 | Ga0070709_10279872 | Ga0070709_102798722 | 219 |
| 29 | 3300005435 | Ga0070714_100228811 | Ga0070714_1002288112 | 219 |
| 30 | 3300005435 | Ga0070714_100305222 | Ga0070714_1003052222 | 219 |
| 31 | 3300005436 | Ga0070713_100080810 | Ga0070713_1000808102 | 219 |
| 32 | 3300005436 | Ga0070713_100125344 | Ga0070713_1001253442 | 219 |
| 33 | 3300005439 | Ga0070711_100106482 | Ga0070711_1001064822 | 219 |
| 34 | 3300005439 | Ga0070711_100226789 | Ga0070711_1002267893 | 219 |
| 35 | 3300005445 | Ga0070708_100002019 | Ga0070708_10000201912 | 219 |
| 36 | 3300005445 | Ga0070708_100064427 | Ga0070708_1000644273 | 219 |
| 37 | 3300005468 | Ga0070707_100103187 | Ga0070707_1001031872 | 219 |
| 38 | 3300005468 | Ga0070707_100517486 | Ga0070707_1005174862 | 219 |
| 39 | 3300005471 | Ga0070698_100012602 | Ga0070698_1000126026 | 219 |
| 40 | 3300005518 | Ga0070699_100043476 | Ga0070699_1000434763 | 219 |
| 41 | 3300005536 | Ga0070697_100019967 | Ga0070697_1000199671 | 219 |
| 42 | 3300005544 | Ga0070686_100060835 | Ga0070686_1000608352 | 219 |
| 43 | 3300005563 | Ga0068855_100357847 | Ga0068855_1003578472 | 219 |
| 44 | 3300005578 | Ga0068854_100085520 | Ga0068854_1000855202 | 219 |
| 45 | 3300005614 | Ga0068856_100087961 | Ga0068856_1000879612 | 219 |
| 46 | 3300005616 | Ga0068852_100011956 | Ga0068852_1000119562 | 219 |
| 47 | 3300005841 | Ga0068863_100176285 | Ga0068863_1001762854 | 219 |
| 48 | 3300005843 | Ga0068860_100016243 | Ga0068860_1000162435 | 219 |
| 49 | 3300005843 | Ga0068860_100777318 | Ga0068860_1007773182 | 219 |
| 50 | 3300005983 | Ga0081540_1039082 | Ga0081540_10390823 | 219 |
| 51 | 3300006028 | Ga0070717_10004158 | Ga0070717_100041583 | 219 |
| 52 | 3300006028 | Ga0070717_10151350 | Ga0070717_101513502 | 219 |
| 53 | 3300006028 | Ga0070717_10263480 | Ga0070717_102634802 | 219 |
| 54 | 3300006173 | Ga0070716_100015676 | Ga0070716_1000156762 | 219 |
| 55 | 3300006173 | Ga0070716_100545064 | Ga0070716_1005450642 | 219 |
| 56 | 3300006237 | Ga0097621_100002739 | Ga0097621_1000027395 | 219 |
| 57 | 3300006237 | Ga0097621_100003948 | Ga0097621_1000039485 | 219 |
| 58 | 3300006237 | Ga0097621_100249159 | Ga0097621_1002491591 | 219 |
| 59 | 3300006358 | Ga0068871_100012155 | Ga0068871_1000121553 | 219 |
| 60 | 3300006358 | Ga0068871_100092732 | Ga0068871_1000927322 | 219 |
| 61 | 3300006358 | Ga0068871_100152225 | Ga0068871_1001522252 | 219 |
| 62 | 3300006852 | Ga0075433_10591549 | Ga0075433_105915492 | 219 |
| 63 | 3300006871 | Ga0075434_100012218 | Ga0075434_1000122184 | 219 |
| 64 | 3300006871 | Ga0075434_100017276 | Ga0075434_1000172765 | 219 |
| 65 | 3300007076 | Ga0075435_100005304 | Ga0075435_1000053042 | 219 |
| 66 | 3300007076 | Ga0075435_100039481 | Ga0075435_1000394812 | 219 |
| 67 | 3300007265 | Ga0099794_10015509 | Ga0099794_100155092 | 219 |
| 68 | 3300007788 | Ga0099795_10002165 | Ga0099795_100021653 | 219 |
| 69 | 3300009093 | Ga0105240_10032699 | Ga0105240_100326992 | 219 |
| 70 | 3300009093 | Ga0105240_10038395 | Ga0105240_100383954 | 219 |
| 71 | 3300009093 | Ga0105240_10097442 | Ga0105240_100974422 | 219 |
| 72 | 3300009101 | Ga0105247_10161779 | Ga0105247_101617792 | 219 |
| 73 | 3300009174 | Ga0105241_10011619 | Ga0105241_100116195 | 219 |
| 74 | 3300009177 | Ga0105248_10015348 | Ga0105248_100153487 | 219 |
| 75 | 3300009177 | Ga0105248_10257754 | Ga0105248_102577543 | 219 |
| 76 | 3300009545 | Ga0105237_10015644 | Ga0105237_100156444 | 219 |
| 77 | 3300009545 | Ga0105237_10019843 | Ga0105237_100198435 | 219 |
| 78 | 3300009545 | Ga0105237_10300373 | Ga0105237_103003732 | 219 |
| 79 | 3300009551 | Ga0105238_10006729 | Ga0105238_100067297 | 219 |
| 80 | 3300009553 | Ga0105249_10427452 | Ga0105249_104274521 | 219 |
| 81 | 3300009553 | Ga0105249_10531370 | Ga0105249_105313702 | 219 |
| 82 | 3300010159 | Ga0099796_10014360 | Ga0099796_100143602 | 219 |
| 83 | 3300013100 | Ga0157373_10001055 | Ga0157373_1000105513 | 219 |
| 84 | 3300013104 | Ga0157370_10017861 | Ga0157370_100178611 | 219 |
| 85 | 3300013105 | Ga0157369_10009253 | Ga0157369_100092535 | 219 |
| 86 | 3300013105 | Ga0157369_10021941 | Ga0157369_100219415 | 219 |
| 87 | 3300013105 | Ga0157369_10032911 | Ga0157369_100329112 | 219 |
| 88 | 3300013105 | Ga0157369_10048297 | Ga0157369_100482973 | 219 |
| 89 | 3300013297 | Ga0157378_10000096 | Ga0157378_1000009662 | 219 |
| 90 | 3300013297 | Ga0157378_10071107 | Ga0157378_100711071 | 219 |
| 91 | 3300013297 | Ga0157378_10318656 | Ga0157378_103186562 | 219 |
| 92 | 3300013297 | Ga0157378_10343956 | Ga0157378_103439561 | 219 |
| 93 | 3300013306 | Ga0163162_10832279 | Ga0163162_108322792 | 219 |
| 94 | 3300013307 | Ga0157372_10001829 | Ga0157372_1000182910 | 219 |
| 95 | 3300013307 | Ga0157372_10011673 | Ga0157372_100116735 | 219 |
| 96 | 3300013307 | Ga0157372_10023041 | Ga0157372_100230415 | 219 |
| 97 | 3300013307 | Ga0157372_10028884 | Ga0157372_100288844 | 219 |
| 98 | 3300013307 | Ga0157372_10032055 | Ga0157372_100320555 | 219 |
| 99 | 3300013307 | Ga0157372_10173717 | Ga0157372_101737172 | 219 |
| 100 | 3300013308 | Ga0157375_10124899 | Ga0157375_101248992 | 219 |
| 101 | 3300013308 | Ga0157375_10244632 | Ga0157375_102446321 | 219 |
| 102 | 3300013308 | Ga0157375_11734135 | Ga0157375_117341351 | 219 |
| 103 | 3300014968 | Ga0157379_10112996 | Ga0157379_101129963 | 219 |
| 104 | 3300014969 | Ga0157376_10000014 | Ga0157376_10000014110 | 219 |
| 105 | 3300024227 | Ga0228598_1000362 | Ga0228598_10003621 | 219 |
| 106 | 3300025900 | Ga0207710_10131421 | Ga0207710_101314212 | 219 |
| 107 | 3300025906 | Ga0207699_10096009 | Ga0207699_100960092 | 219 |
| 108 | 3300025911 | Ga0207654_10008543 | Ga0207654_100085432 | 219 |
| 109 | 3300025913 | Ga0207695_10065669 | Ga0207695_100656693 | 219 |
| 110 | 3300025913 | Ga0207695_10073020 | Ga0207695_100730203 | 219 |
| 111 | 3300025914 | Ga0207671_10030492 | Ga0207671_100304924 | 219 |
| 112 | 3300025924 | Ga0207694_10098661 | Ga0207694_100986614 | 219 |
| 113 | 3300025928 | Ga0207700_10033559 | Ga0207700_100335592 | 219 |
| 114 | 3300025928 | Ga0207700_10474055 | Ga0207700_104740552 | 219 |
| 115 | 3300025929 | Ga0207664_10007506 | Ga0207664_100075062 | 219 |
| 116 | 3300025929 | Ga0207664_10107343 | Ga0207664_101073432 | 219 |
| 117 | 3300025929 | Ga0207664_10390970 | Ga0207664_103909702 | 219 |
| 118 | 3300025938 | Ga0207704_10033299 | Ga0207704_100332992 | 219 |
| 119 | 3300025939 | Ga0207665_10098430 | Ga0207665_100984303 | 219 |
| 120 | 3300025941 | Ga0207711_10057247 | Ga0207711_100572471 | 219 |
| 121 | 3300025949 | Ga0207667_10123205 | Ga0207667_101232053 | 219 |
| 122 | 3300025981 | Ga0207640_10050349 | Ga0207640_100503493 | 219 |
| 123 | 3300026088 | Ga0207641_10309710 | Ga0207641_103097101 | 219 |
| 124 | 3300027512 | Ga0209179_1001747 | Ga0209179_10017475 | 219 |
| 125 | 3300028381 | Ga0268264_10013668 | Ga0268264_100136684 | 219 |
| 126 | 3300028381 | Ga0268264_10543989 | Ga0268264_105439891 | 219 |
| 127 | 3300035086 | Ga0373934_0032778 | Ga0373934_0032778_880_1542 | 219 |
| 128 | 3300035111 | Ga0373923_0044735 | Ga0373923_0044735_79_750 | 219 |
| 129 | 3300035170 | Ga0373943_0062079 | Ga0373943_0062079_788_1459 | 219 |
| 130 | 3300035171 | Ga0373946_0254109 | Ga0373946_0254109_160_828 | 219 |
| 131 | 3300035691 | Ga0373931_0502148 | Ga0373931_0502148_43_708 | 219 |
| 132 | 3300035695 | Ga0373927_0110108 | Ga0373927_0110108_1003_1674 | 219 |
| 133 | 3300036401 | Ga0373937_0025470 | Ga0373937_0025470_4428_5090 | 219 |
| 134 | 3300036401 | Ga0373937_0216698 | Ga0373937_0216698_799_1467 | 219 |
| 135 | 3300037068 | Ga0373925_0005926 | Ga0373925_0005926_2164_2832 | 219 |
| 136 | 3300037418 | Ga0395900_1040208 | Ga0395900_1040208_25_699 | 219 |
| 137 | 3300039450 | Ga0436363_1655911 | Ga0436363_1655911_18_683 | 219 |
| 138 | 3300044684 | Ga0466966_0428471 | Ga0466966_0428471_52_717 | 219 |
| 139 | 3300046472 | Ga0495580_0004333 | Ga0495580_0004333_2735_3400 | 219 |
| 140 | 3300046472 | Ga0495580_0050069 | Ga0495580_0050069_2270_2938 | 219 |
| 141 | 3300046472 | Ga0495580_0204093 | Ga0495580_0204093_93_761 | 219 |
| 142 | 3300046476 | Ga0495662_0080452 | Ga0495662_0080452_61_729 | 219 |
| 143 | 3300046499 | Ga0495594_0031366 | Ga0495594_0031366_471_1139 | 219 |
| 144 | 3300046517 | Ga0495630_0038425 | Ga0495630_0038425_1459_2127 | 219 |
| 145 | 3300046517 | Ga0495630_0156808 | Ga0495630_0156808_803_1474 | 219 |
| 146 | 3300046531 | Ga0495665_0200571 | Ga0495665_0200571_344_1012 | 219 |
| 147 | 3300046533 | Ga0495640_0023650 | Ga0495640_0023650_2580_3248 | 219 |
| 148 | 3300046535 | Ga0495586_0113208 | Ga0495586_0113208_361_1029 | 219 |
| 149 | 3300046663 | Ga0495635_0036079 | Ga0495635_0036079_2135_2803 | 219 |
| 150 | 3300046679 | Ga0495623_0398906 | Ga0495623_0398906_24_689 | 219 |
| 151 | 3300046681 | Ga0495647_0021464 | Ga0495647_0021464_1615_2283 | 219 |
| 152 | 3300046683 | Ga0495658_0014126 | Ga0495658_0014126_2731_3399 | 219 |
| 153 | 3300047319 | Ga0495674_0104490 | Ga0495674_0104490_1335_1997 | 219 |
| 154 | 3300047319 | Ga0495674_0223259 | Ga0495674_0223259_712_1380 | 219 |
| 155 | 3300047321 | Ga0495676_0026158 | Ga0495676_0026158_356_1024 | 219 |
| 156 | 3300047471 | Ga0495684_0046680 | Ga0495684_0046680_2401_3069 | 219 |
| 157 | 3300048088 | Ga0495602_0163812 | Ga0495602_0163812_938_1603 | 219 |
| 158 | 3300048905 | Ga0496102_0444966 | Ga0496102_0444966_29_703 | 219 |
| 159 | 3300048915 | Ga0496112_0053191 | Ga0496112_0053191_1570_2238 | 219 |
| 160 | 3300048915 | Ga0496112_0120734 | Ga0496112_0120734_1721_2398 | 219 |
| 161 | 3300048917 | Ga0496114_0003782 | Ga0496114_0003782_7295_7960 | 219 |
| 162 | 3300048917 | Ga0496114_0087672 | Ga0496114_0087672_109_777 | 219 |
| 163 | 3300050512 | nmdc:mga0n895_14256_c1 | nmdc:mga0n895_14256_c1_4405_5070 | 219 |
| 164 | 3300050512 | nmdc:mga0n895_34219_c1 | nmdc:mga0n895_34219_c1_1225_1989 | 219 |
| 165 | 3300050513 | nmdc:mga0rr50_121545_c1 | nmdc:mga0rr50_121545_c1_1335_2000 | 219 |
| 166 | 3300050513 | nmdc:mga0rr50_3575_c1 | nmdc:mga0rr50_3575_c1_218_982 | 219 |
| 167 | 3300050514 | nmdc:mga08x19_408751_c1 | nmdc:mga08x19_408751_c1_143_820 | 219 |
| 168 | 3300050514 | nmdc:mga08x19_65667_c1 | nmdc:mga08x19_65667_c1_137_799 | 219 |
| 169 | 3300050514 | nmdc:mga08x19_9583_c2 | nmdc:mga08x19_9583_c2_2544_3308 | 219 |
| 170 | 3300050515 | nmdc:mga0a205_701543_c1 | nmdc:mga0a205_701543_c1_33_698 | 219 |
| 171 | 3300005336 | Ga0070680_100055067 | Ga0070680_1000550673 | 220 |
| 172 | 3300005338 | Ga0068868_100027134 | Ga0068868_1000271345 | 220 |
| 173 | 3300005355 | Ga0070671_100031817 | Ga0070671_1000318172 | 220 |
| 174 | 3300005435 | Ga0070714_100048704 | Ga0070714_1000487043 | 220 |
| 175 | 3300005436 | Ga0070713_100181121 | Ga0070713_1001811213 | 220 |
| 176 | 3300005437 | Ga0070710_10293668 | Ga0070710_102936681 | 220 |
| 177 | 3300005439 | Ga0070711_100345096 | Ga0070711_1003450962 | 220 |
| 178 | 3300005440 | Ga0070705_100326279 | Ga0070705_1003262792 | 220 |
| 179 | 3300005458 | Ga0070681_10241216 | Ga0070681_102412162 | 220 |
| 180 | 3300005530 | Ga0070679_100272537 | Ga0070679_1002725372 | 220 |
| 181 | 3300005535 | Ga0070684_100053890 | Ga0070684_1000538903 | 220 |
| 182 | 3300005547 | Ga0070693_100198585 | Ga0070693_1001985852 | 220 |
| 183 | 3300005563 | Ga0068855_100002871 | Ga0068855_10000287115 | 220 |
| 184 | 3300005564 | Ga0070664_100056829 | Ga0070664_1000568291 | 220 |
| 185 | 3300005614 | Ga0068856_100001245 | Ga0068856_10000124518 | 220 |
| 186 | 3300005615 | Ga0070702_100427094 | Ga0070702_1004270941 | 220 |
| 187 | 3300005616 | Ga0068852_100598890 | Ga0068852_1005988901 | 220 |
| 188 | 3300005618 | Ga0068864_100006890 | Ga0068864_1000068901 | 220 |
| 189 | 3300005718 | Ga0068866_10250552 | Ga0068866_102505521 | 220 |
| 190 | 3300005841 | Ga0068863_100040850 | Ga0068863_1000408502 | 220 |
| 191 | 3300006173 | Ga0070716_100214269 | Ga0070716_1002142691 | 220 |
| 192 | 3300006175 | Ga0070712_100496181 | Ga0070712_1004961811 | 220 |
| 193 | 3300006237 | Ga0097621_100000581 | Ga0097621_10000058118 | 220 |
| 194 | 3300006358 | Ga0068871_100000664 | Ga0068871_10000066418 | 220 |
| 195 | 3300006881 | Ga0068865_100702532 | Ga0068865_1007025321 | 220 |
| 196 | 3300009093 | Ga0105240_10043737 | Ga0105240_100437372 | 220 |
| 197 | 3300009093 | Ga0105240_10693811 | Ga0105240_106938112 | 220 |
| 198 | 3300009176 | Ga0105242_10175396 | Ga0105242_101753962 | 220 |
| 199 | 3300009551 | Ga0105238_10644257 | Ga0105238_106442572 | 220 |
| 200 | 3300010375 | Ga0105239_10030756 | Ga0105239_100307563 | 220 |
| 201 | 3300010375 | Ga0105239_10323704 | Ga0105239_103237042 | 220 |
| 202 | 3300011119 | Ga0105246_10023240 | Ga0105246_100232405 | 220 |
| 203 | 3300013102 | Ga0157371_10038309 | Ga0157371_100383095 | 220 |
| 204 | 3300013102 | Ga0157371_10165722 | Ga0157371_101657222 | 220 |
| 205 | 3300013105 | Ga0157369_10000170 | Ga0157369_1000017026 | 220 |
| 206 | 3300013105 | Ga0157369_10150584 | Ga0157369_101505844 | 220 |
| 207 | 3300013296 | Ga0157374_10000316 | Ga0157374_1000031618 | 220 |
| 208 | 3300013296 | Ga0157374_10000330 | Ga0157374_1000033026 | 220 |
| 209 | 3300013297 | Ga0157378_10000085 | Ga0157378_1000008557 | 220 |
| 210 | 3300013297 | Ga0157378_10103227 | Ga0157378_101032272 | 220 |
| 211 | 3300013307 | Ga0157372_10001563 | Ga0157372_100015632 | 220 |
| 212 | 3300013307 | Ga0157372_10002374 | Ga0157372_1000237415 | 220 |
| 213 | 3300014325 | Ga0163163_10401700 | Ga0163163_104017002 | 220 |
| 214 | 3300014969 | Ga0157376_10045908 | Ga0157376_100459082 | 220 |
| 215 | 3300014969 | Ga0157376_10166630 | Ga0157376_101666302 | 220 |
| 216 | 3300025898 | Ga0207692_10046164 | Ga0207692_100461642 | 220 |
| 217 | 3300025899 | Ga0207642_10109524 | Ga0207642_101095242 | 220 |
| 218 | 3300025912 | Ga0207707_10343213 | Ga0207707_103432132 | 220 |
| 219 | 3300025913 | Ga0207695_10489334 | Ga0207695_104893342 | 220 |
| 220 | 3300025915 | Ga0207693_10348186 | Ga0207693_103481861 | 220 |
| 221 | 3300025916 | Ga0207663_10131586 | Ga0207663_101315862 | 220 |
| 222 | 3300025927 | Ga0207687_10214937 | Ga0207687_102149372 | 220 |
| 223 | 3300025929 | Ga0207664_10042113 | Ga0207664_100421133 | 220 |
| 224 | 3300025938 | Ga0207704_10621055 | Ga0207704_106210551 | 220 |
| 225 | 3300025945 | Ga0207679_10260402 | Ga0207679_102604021 | 220 |
| 226 | 3300025949 | Ga0207667_10003707 | Ga0207667_100037074 | 220 |
| 227 | 3300026023 | Ga0207677_10004627 | Ga0207677_100046272 | 220 |
| 228 | 3300026078 | Ga0207702_10000759 | Ga0207702_1000075910 | 220 |
| 229 | 3300026088 | Ga0207641_10036769 | Ga0207641_100367693 | 220 |
| 230 | 3300026095 | Ga0207676_10008246 | Ga0207676_100082462 | 220 |
| 231 | 3300026142 | Ga0207698_11358952 | Ga0207698_113589521 | 220 |
| 232 | 3300035410 | Ga0373924_0091149 | Ga0373924_0091149_442_1149 | 220 |
| 233 | 3300045051 | Ga0451576_0605077 | Ga0451576_0605077_418_1080 | 220 |
| 234 | 3300048088 | Ga0495602_0036669 | Ga0495602_0036669_3529_4236 | 220 |
| 235 | 3300048907 | Ga0496104_0121463 | Ga0496104_0121463_178_840 | 220 |
| 236 | 3300048915 | Ga0496112_0052519 | Ga0496112_0052519_2827_3489 | 220 |
| 237 | 3300044693 | Ga0466961_0080159 | Ga0466961_0080159_1265_1993 | 223 |
| 238 | 3300044694 | Ga0466963_0122569 | Ga0466963_0122569_200_928 | 223 |
| 239 | 3300044719 | Ga0466971_0036988 | Ga0466971_0036988_821_1549 | 223 |
| 240 | 3300044842 | Ga0466957_0092398 | Ga0466957_0092398_40_768 | 223 |
| 241 | 3300045049 | Ga0466959_0105057 | Ga0466959_0105057_842_1570 | 223 |
| 242 | 3300045976 | Ga0466967_0175679 | Ga0466967_0175679_296_1024 | 223 |
| 243 | 3300035086 | Ga0373934_0000569 | Ga0373934_0000569_9263_10039 | 224 |
| 244 | 3300035118 | Ga0373954_0000253 | Ga0373954_0000253_11631_12407 | 224 |
| 245 | 3300035119 | Ga0373956_0003879 | Ga0373956_0003879_2528_3304 | 224 |
| 246 | 3300035172 | Ga0373955_0009722 | Ga0373955_0009722_978_1754 | 224 |
| 247 | 3300036401 | Ga0373937_0003091 | Ga0373937_0003091_10810_11586 | 224 |
| 248 | 3300046462 | Ga0495651_0069057 | Ga0495651_0069057_1561_2337 | 224 |
| 249 | 3300046463 | Ga0495653_0026708 | Ga0495653_0026708_3457_4233 | 224 |
| 250 | 3300046511 | Ga0495608_0012244 | Ga0495608_0012244_4965_5741 | 224 |
| 251 | 3300046536 | Ga0495587_0042895 | Ga0495587_0042895_36_812 | 224 |
| 252 | 3300046559 | Ga0495667_0062678 | Ga0495667_0062678_779_1555 | 224 |
| 253 | 3300046675 | Ga0495657_0041682 | Ga0495657_0041682_1200_1976 | 224 |
| 254 | 3300046679 | Ga0495623_0017209 | Ga0495623_0017209_1022_1798 | 224 |
| 255 | 3300047317 | Ga0495604_0004289 | Ga0495604_0004289_3499_4275 | 224 |
| 256 | 3300050512 | nmdc:mga0n895_76213_c1 | nmdc:mga0n895_76213_c1_1996_2721 | 225 |
| 257 | 3300050513 | nmdc:mga0rr50_77726_c1 | nmdc:mga0rr50_77726_c1_162_887 | 225 |
| 258 | 3300037068 | Ga0373925_0020882 | Ga0373925_0020882_1021_1758 | 228 |
| 259 | 3300046455 | Ga0495603_0024560 | Ga0495603_0024560_2623_3360 | 228 |
| 260 | 3300046472 | Ga0495580_0006128 | Ga0495580_0006128_83_820 | 228 |
| 261 | 3300046477 | Ga0495664_0032039 | Ga0495664_0032039_1204_1941 | 228 |
| 262 | 3300046514 | Ga0495618_0202503 | Ga0495618_0202503_24_761 | 228 |
| 263 | 3300046526 | Ga0495666_0004851 | Ga0495666_0004851_3500_4237 | 228 |
| 264 | 3300047673 | Ga0495593_0062215 | Ga0495593_0062215_402_1139 | 228 |
| 265 | 3300005467 | Ga0070706_100184021 | Ga0070706_1001840212 | 231 |
| 266 | 3300035695 | Ga0373927_0031526 | Ga0373927_0031526_2680_3390 | 231 |
| 267 | 3300006175 | Ga0070712_100039444 | Ga0070712_1000394442 | 232 |
| 268 | 3300025915 | Ga0207693_10027726 | Ga0207693_100277262 | 232 |
| 269 | 3300025928 | Ga0207700_10717773 | Ga0207700_107177731 | 232 |
| 270 | 3300005434 | Ga0070709_10003180 | Ga0070709_100031805 | 236 |
| 271 | 3300005436 | Ga0070713_100002231 | Ga0070713_1000022315 | 236 |
| 272 | 3300005437 | Ga0070710_10190895 | Ga0070710_101908952 | 236 |
| 273 | 3300005439 | Ga0070711_100230402 | Ga0070711_1002304021 | 236 |
| 274 | 3300006173 | Ga0070716_100002152 | Ga0070716_1000021523 | 236 |
| 275 | 3300006175 | Ga0070712_100077081 | Ga0070712_1000770813 | 236 |
| 276 | 3300025906 | Ga0207699_10002789 | Ga0207699_100027896 | 236 |
| 277 | 3300025928 | Ga0207700_10006558 | Ga0207700_100065584 | 236 |
| 278 | 3300025939 | Ga0207665_10004561 | Ga0207665_100045614 | 236 |
| 279 | 3300005329 | Ga0070683_100008769 | Ga0070683_1000087696 | 237 |
| 280 | 3300005334 | Ga0068869_100035638 | Ga0068869_1000356382 | 237 |
| 281 | 3300005338 | Ga0068868_100001960 | Ga0068868_1000019605 | 237 |
| 282 | 3300005338 | Ga0068868_100007353 | Ga0068868_1000073537 | 237 |
| 283 | 3300005343 | Ga0070687_100013685 | Ga0070687_1000136854 | 237 |
| 284 | 3300005354 | Ga0070675_100040046 | Ga0070675_1000400462 | 237 |
| 285 | 3300005436 | Ga0070713_100350603 | Ga0070713_1003506032 | 237 |
| 286 | 3300005458 | Ga0070681_10000055 | Ga0070681_1000005516 | 237 |
| 287 | 3300005458 | Ga0070681_10147148 | Ga0070681_101471482 | 237 |
| 288 | 3300005459 | Ga0068867_100011100 | Ga0068867_1000111004 | 237 |
| 289 | 3300005530 | Ga0070679_100069155 | Ga0070679_1000691551 | 237 |
| 290 | 3300005530 | Ga0070679_100088289 | Ga0070679_1000882892 | 237 |
| 291 | 3300005535 | Ga0070684_100021584 | Ga0070684_1000215844 | 237 |
| 292 | 3300005546 | Ga0070696_100245379 | Ga0070696_1002453792 | 237 |
| 293 | 3300005547 | Ga0070693_100018029 | Ga0070693_1000180295 | 237 |
| 294 | 3300005547 | Ga0070693_100105610 | Ga0070693_1001056103 | 237 |
| 295 | 3300005563 | Ga0068855_100001077 | Ga0068855_1000010777 | 237 |
| 296 | 3300005563 | Ga0068855_100061692 | Ga0068855_1000616925 | 237 |
| 297 | 3300005564 | Ga0070664_100001803 | Ga0070664_1000018039 | 237 |
| 298 | 3300005577 | Ga0068857_100000041 | Ga0068857_10000004138 | 237 |
| 299 | 3300005577 | Ga0068857_100007186 | Ga0068857_1000071865 | 237 |
| 300 | 3300005578 | Ga0068854_100006073 | Ga0068854_1000060737 | 237 |
| 301 | 3300005578 | Ga0068854_100072079 | Ga0068854_1000720794 | 237 |
| 302 | 3300005614 | Ga0068856_100000355 | Ga0068856_10000035518 | 237 |
| 303 | 3300005614 | Ga0068856_100001397 | Ga0068856_10000139720 | 237 |
| 304 | 3300005616 | Ga0068852_100026166 | Ga0068852_1000261662 | 237 |
| 305 | 3300005616 | Ga0068852_100307464 | Ga0068852_1003074642 | 237 |
| 306 | 3300005617 | Ga0068859_100000959 | Ga0068859_10000095911 | 237 |
| 307 | 3300005618 | Ga0068864_100005434 | Ga0068864_1000054348 | 237 |
| 308 | 3300005841 | Ga0068863_100058223 | Ga0068863_1000582232 | 237 |
| 309 | 3300005842 | Ga0068858_100043994 | Ga0068858_1000439942 | 237 |
| 310 | 3300005843 | Ga0068860_100085305 | Ga0068860_1000853053 | 237 |
| 311 | 3300006237 | Ga0097621_100000533 | Ga0097621_1000005335 | 237 |
| 312 | 3300006237 | Ga0097621_100051783 | Ga0097621_1000517833 | 237 |
| 313 | 3300006358 | Ga0068871_100000221 | Ga0068871_10000022126 | 237 |
| 314 | 3300006358 | Ga0068871_100007730 | Ga0068871_1000077307 | 237 |
| 315 | 3300006881 | Ga0068865_100022996 | Ga0068865_1000229962 | 237 |
| 316 | 3300006931 | Ga0097620_100000959 | Ga0097620_10000095916 | 237 |
| 317 | 3300013102 | Ga0157371_10045252 | Ga0157371_100452523 | 237 |
| 318 | 3300013296 | Ga0157374_10000533 | Ga0157374_1000053314 | 237 |
| 319 | 3300013297 | Ga0157378_10000182 | Ga0157378_100001827 | 237 |
| 320 | 3300013307 | Ga0157372_10000620 | Ga0157372_1000062021 | 237 |
| 321 | 3300014745 | Ga0157377_10040099 | Ga0157377_100400992 | 237 |
| 322 | 3300025904 | Ga0207647_10008021 | Ga0207647_100080214 | 237 |
| 323 | 3300025908 | Ga0207643_10067271 | Ga0207643_100672712 | 237 |
| 324 | 3300025912 | Ga0207707_10000739 | Ga0207707_1000073924 | 237 |
| 325 | 3300025912 | Ga0207707_10005345 | Ga0207707_100053453 | 237 |
| 326 | 3300025918 | Ga0207662_10073830 | Ga0207662_100738302 | 237 |
| 327 | 3300025921 | Ga0207652_10061025 | Ga0207652_100610253 | 237 |
| 328 | 3300025921 | Ga0207652_10689423 | Ga0207652_106894231 | 237 |
| 329 | 3300025925 | Ga0207650_10018697 | Ga0207650_100186971 | 237 |
| 330 | 3300025926 | Ga0207659_10032473 | Ga0207659_100324732 | 237 |
| 331 | 3300025928 | Ga0207700_10341974 | Ga0207700_103419741 | 237 |
| 332 | 3300025934 | Ga0207686_10352538 | Ga0207686_103525381 | 237 |
| 333 | 3300025936 | Ga0207670_10221419 | Ga0207670_102214191 | 237 |
| 334 | 3300025942 | Ga0207689_10006686 | Ga0207689_100066865 | 237 |
| 335 | 3300025944 | Ga0207661_10007877 | Ga0207661_100078774 | 237 |
| 336 | 3300025945 | Ga0207679_10006350 | Ga0207679_100063506 | 237 |
| 337 | 3300025949 | Ga0207667_10000785 | Ga0207667_1000078513 | 237 |
| 338 | 3300025949 | Ga0207667_10005364 | Ga0207667_1000536414 | 237 |
| 339 | 3300025960 | Ga0207651_10364096 | Ga0207651_103640962 | 237 |
| 340 | 3300025981 | Ga0207640_10009516 | Ga0207640_100095162 | 237 |
| 341 | 3300026023 | Ga0207677_10005454 | Ga0207677_100054545 | 237 |
| 342 | 3300026035 | Ga0207703_10020414 | Ga0207703_100204142 | 237 |
| 343 | 3300026041 | Ga0207639_10547362 | Ga0207639_105473622 | 237 |
| 344 | 3300026078 | Ga0207702_10000089 | Ga0207702_1000008925 | 237 |
| 345 | 3300026078 | Ga0207702_10010816 | Ga0207702_100108162 | 237 |
| 346 | 3300026088 | Ga0207641_10357469 | Ga0207641_103574692 | 237 |
| 347 | 3300026089 | Ga0207648_10005354 | Ga0207648_100053543 | 237 |
| 348 | 3300026095 | Ga0207676_10011245 | Ga0207676_100112455 | 237 |
| 349 | 3300026116 | Ga0207674_10000309 | Ga0207674_1000030923 | 237 |
| 350 | 3300026121 | Ga0207683_10109270 | Ga0207683_101092701 | 237 |
| 351 | 3300026142 | Ga0207698_10018594 | Ga0207698_100185942 | 237 |
| 352 | 3300028381 | Ga0268264_10075062 | Ga0268264_100750622 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gvx-assembly1.cif.gz_A | structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (otsb2) from mycobacterium tuberculosis | 0.9134 | 161 | 219 |
| 3d6j-assembly1.cif.gz_A | crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis | 0.8833 | 23 | 217 |
| 3s6j-assembly1.cif.gz_A | the crystal structure of a hydrolase from pseudomonas syringae | 0.8669 | 23 | 214 |
| 2qlt-assembly1.cif.gz_A | crystal structure of an isoform of dl-glycerol-3-phosphatase, rhr2p, from saccharomyces cerevisiae | 0.8636 | 18 | 237 |
| 3s6j-assembly2.cif.gz_B | the crystal structure of a hydrolase from pseudomonas syringae | 0.8547 | 24 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0KYK9_29_156_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9425 | 119 | 219 | 3.40.50.1000 |
| af_Q652P6_229_339_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9218 | 119 | 222 | 3.40.50.1000 |
| af_O17773_104_249_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8871 | 119 | 216 | 3.40.50.1000 |
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8772 | 104 | 196 | 3.40.50.1000 |
| af_Q84MD8_87_222_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8744 | 119 | 220 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9W8T1-F1-model_v4 | HAD family hydrolase | 0.9893 | 19 | 235 |
GO:0050308
|
| AF-A0A2V9W8T1-F1-model_v4 | HAD family hydrolase | 0.9758 | 19 | 235 |
GO:0050308
|
| AF-A0A836QI30-F1-model_v4 | HAD family phosphatase | 0.9697 | 119 | 220 |
GO:0050308
|
| AF-A0A3C1GCQ8-F1-model_v4 | HAD family phosphatase | 0.9681 | 119 | 219 |
GO:0050308
|
| AF-A0A7J7IQD3-F1-model_v4 | Uncharacterized protein | 0.9648 | 147 | 219 |
GO:0050308
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar