F418924

General Info

Members Datasets Scaffolds Average Seq Length
352 186 352 229

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10190895|Ga0070710_101908952
Length 272
Sequence MRSMRQLPRFQFRESAFQSPFCKCPTANCNLSVSPITGKPKLAIAAFLLSLIMVEISCRGLLFDLDGVLVDSTPAVARVWTKWALAHGFDPEETVRKAHGRPSLTTIKELLPNAADPIAENQVVLRGEIEDTDGIVPLPGVCDFLKALPQNRWALVTSCSKPLAHVRLSAAGIPIPEKIVTSDDVQHGKPDPEPYLKGAALLGLPASECVVFEDAPAGIRAGKAAGARVVALPTSSPENELKSSGADWVLPGYAHLSVMSANGFPGLKLRLR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.84
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100008769 3300005329 Bacteria 8596
2 Ga0068869_100035638 3300005334 Bacteria 3528
3 Ga0070680_100055067 3300005336 Bacteria 3250
4 Ga0068868_100001960 3300005338 Bacteria 14101
5 Ga0068868_100007353 3300005338 Bacteria 7843
6 Ga0068868_100027134 3300005338 Bacteria 4367
7 Ga0070687_100013685 3300005343 Bacteria 3623
8 Ga0070675_100040046 3300005354 Bacteria 3825
9 Ga0070671_100031817 3300005355 Unclassified 4361
10 Ga0070709_10003180 3300005434 Bacteria 8807
11 Ga0070709_10279872 3300005434 Bacteria 1212
12 Ga0070714_100048704 3300005435 Bacteria 3605
13 Ga0070714_100228811 3300005435 Unclassified 1712
14 Ga0070714_100305222 3300005435 Unclassified 1485
15 Ga0070713_100002231 3300005436 Bacteria 12564
16 Ga0070713_100080810 3300005436 Bacteria 2772
17 Ga0070713_100125344 3300005436 Bacteria 2258
18 Ga0070713_100181121 3300005436 Bacteria 1893
19 Ga0070713_100350603 3300005436 Unclassified 1369
20 Ga0070710_10190895 3300005437 Bacteria 1288
21 Ga0070710_10293668 3300005437 Bacteria 1059
22 Ga0070711_100106482 3300005439 Bacteria 2050
23 Ga0070711_100226789 3300005439 Unclassified 1455
24 Ga0070711_100230402 3300005439 Bacteria 1444
25 Ga0070711_100345096 3300005439 Bacteria 1196
26 Ga0070705_100023376 3300005440 Bacteria 3318
27 Ga0070705_100326279 3300005440 Unclassified 1110
28 Ga0070708_100002019 3300005445 Bacteria 15622
29 Ga0070708_100064427 3300005445 Bacteria 3284
30 Ga0070681_10000055 3300005458 Bacteria 80179
31 Ga0070681_10147148 3300005458 Bacteria 2284
32 Ga0070681_10241216 3300005458 Bacteria 1721
33 Ga0068867_100011100 3300005459 Bacteria 6355
34 Ga0070706_100184021 3300005467 Bacteria 1951
35 Ga0070707_100103187 3300005468 Unclassified 2763
36 Ga0070707_100127570 3300005468 Bacteria 2472
37 Ga0070707_100491180 3300005468 Bacteria 1189
38 Ga0070707_100517486 3300005468 Bacteria 1155
39 Ga0070698_100012602 3300005471 Bacteria 8955
40 Ga0070699_100043476 3300005518 Bacteria 3888
41 Ga0070679_100069155 3300005530 Bacteria 3522
42 Ga0070679_100088289 3300005530 Bacteria 3088
43 Ga0070679_100272537 3300005530 Bacteria 1646
44 Ga0070684_100021584 3300005535 Bacteria 5362
45 Ga0070684_100053890 3300005535 Bacteria 3503
46 Ga0070697_100019967 3300005536 Bacteria 5295
47 Ga0070686_100060835 3300005544 Bacteria 2438
48 Ga0070696_100245379 3300005546 Bacteria 1352
49 Ga0070693_100018029 3300005547 Bacteria 3681
50 Ga0070693_100105610 3300005547 Unclassified 1723
51 Ga0070693_100198585 3300005547 Unclassified 1301
52 Ga0068855_100001077 3300005563 Bacteria 33925
53 Ga0068855_100002871 3300005563 Bacteria 21140
54 Ga0068855_100061692 3300005563 Bacteria 4380
55 Ga0068855_100357847 3300005563 Unclassified 1607
56 Ga0070664_100001803 3300005564 Bacteria 17165
57 Ga0070664_100056829 3300005564 Unclassified 3325
58 Ga0068857_100000041 3300005577 Bacteria 70173
59 Ga0068857_100007186 3300005577 Bacteria 9591
60 Ga0068854_100006073 3300005578 Bacteria 7661
61 Ga0068854_100072079 3300005578 Unclassified 2529
62 Ga0068854_100085520 3300005578 Bacteria 2336
63 Ga0068856_100000355 3300005614 Bacteria 49986
64 Ga0068856_100001245 3300005614 Bacteria 26739
65 Ga0068856_100001397 3300005614 Bacteria 25289
66 Ga0068856_100087961 3300005614 Bacteria 3089
67 Ga0070702_100427094 3300005615 Unclassified 955
68 Ga0068852_100011956 3300005616 Bacteria 6566
69 Ga0068852_100026166 3300005616 Bacteria 4738
70 Ga0068852_100307464 3300005616 Bacteria 1536
71 Ga0068852_100598890 3300005616 Unclassified 1106
72 Ga0068859_100000959 3300005617 Bacteria 29530
73 Ga0068864_100005434 3300005618 Bacteria 10446
74 Ga0068864_100006890 3300005618 Bacteria 9315
75 Ga0068866_10250552 3300005718 Unclassified 1083
76 Ga0068863_100040850 3300005841 Bacteria 4410
77 Ga0068863_100058223 3300005841 Bacteria 3657
78 Ga0068863_100086132 3300005841 Bacteria 2977
79 Ga0068863_100176285 3300005841 Bacteria 2052
80 Ga0068858_100043994 3300005842 Bacteria 4140
81 Ga0068858_100303383 3300005842 Bacteria 1524
82 Ga0068860_100016243 3300005843 Bacteria 7258
83 Ga0068860_100085305 3300005843 Bacteria 3005
84 Ga0068860_100777318 3300005843 Bacteria 970
85 Ga0081540_1039082 3300005983 Bacteria 2491
86 Ga0070717_10004158 3300006028 Bacteria 10434
87 Ga0070717_10151350 3300006028 Bacteria 2007
88 Ga0070717_10263480 3300006028 Viruses 1525
89 Ga0070716_100002152 3300006173 Bacteria 9057
90 Ga0070716_100015676 3300006173 Bacteria 3899
91 Ga0070716_100214269 3300006173 Bacteria 1289
92 Ga0070716_100545064 3300006173 Unclassified 864
93 Ga0070712_100039444 3300006175 Bacteria 3232
94 Ga0070712_100077081 3300006175 Bacteria 2402
95 Ga0070712_100496181 3300006175 Unclassified 1023
96 Ga0097621_100000533 3300006237 Bacteria 26715
97 Ga0097621_100000581 3300006237 Bacteria 25739
98 Ga0097621_100002739 3300006237 Bacteria 12055
99 Ga0097621_100003948 3300006237 Bacteria 10274
100 Ga0097621_100051783 3300006237 Bacteria 3342
101 Ga0097621_100249159 3300006237 Bacteria 1555
102 Ga0068871_100000221 3300006358 Bacteria 40089
103 Ga0068871_100000664 3300006358 Bacteria 23618
104 Ga0068871_100007730 3300006358 Bacteria 7695
105 Ga0068871_100012155 3300006358 Bacteria 6336
106 Ga0068871_100092732 3300006358 Unclassified 2519
107 Ga0068871_100152225 3300006358 Unclassified 1973
108 Ga0075433_10591549 3300006852 Bacteria 974
109 Ga0075434_100012218 3300006871 Bacteria 8136
110 Ga0075434_100017276 3300006871 Bacteria 6948
111 Ga0075434_100045476 3300006871 Bacteria 4355
112 Ga0075434_100193453 3300006871 Bacteria 2055
113 Ga0068865_100022996 3300006881 Bacteria 4075
114 Ga0068865_100702532 3300006881 Unclassified 864
115 Ga0097620_100000959 3300006931 Bacteria 29530
116 Ga0075435_100005304 3300007076 Bacteria 8979
117 Ga0075435_100014467 3300007076 Bacteria 5899
118 Ga0075435_100039481 3300007076 Bacteria 3767
119 Ga0099794_10003719 3300007265 Bacteria 5871
120 Ga0099794_10015509 3300007265 Bacteria 3365
121 Ga0099795_10002165 3300007788 Bacteria 4534
122 Ga0105240_10032699 3300009093 Bacteria 6732
123 Ga0105240_10038395 3300009093 Bacteria 6142
124 Ga0105240_10043737 3300009093 Bacteria 5695
125 Ga0105240_10097442 3300009093 Bacteria 3583
126 Ga0105240_10693811 3300009093 Unclassified 1112
127 Ga0105247_10161779 3300009101 Bacteria 1483
128 Ga0105241_10011619 3300009174 Bacteria 6457
129 Ga0105242_10175396 3300009176 Bacteria 1887
130 Ga0105248_10015348 3300009177 Bacteria 8448
131 Ga0105248_10257754 3300009177 Bacteria 1963
132 Ga0105237_10015644 3300009545 Bacteria 7886
133 Ga0105237_10019843 3300009545 Bacteria 6939
134 Ga0105237_10300373 3300009545 Bacteria 1609
135 Ga0105238_10006729 3300009551 Bacteria 11474
136 Ga0105238_10644257 3300009551 Bacteria 1069
137 Ga0105249_10427452 3300009553 Bacteria 1359
138 Ga0105249_10531370 3300009553 Bacteria 1225
139 Ga0099796_10014360 3300010159 Bacteria 2286
140 Ga0105239_10030756 3300010375 Bacteria 5905
141 Ga0105239_10323704 3300010375 Bacteria 1739
142 Ga0105246_10023240 3300011119 Bacteria 4009
143 Ga0157373_10001055 3300013100 Bacteria 21221
144 Ga0157371_10038309 3300013102 Unclassified 3430
145 Ga0157371_10045252 3300013102 Bacteria 3132
146 Ga0157371_10165722 3300013102 Bacteria 1578
147 Ga0157370_10017861 3300013104 Bacteria 7148
148 Ga0157369_10000170 3300013105 Bacteria 91583
149 Ga0157369_10009253 3300013105 Bacteria 11271
150 Ga0157369_10021941 3300013105 Bacteria 7138
151 Ga0157369_10032911 3300013105 Bacteria 5698
152 Ga0157369_10048297 3300013105 Bacteria 4618
153 Ga0157369_10150584 3300013105 Bacteria 2459
154 Ga0157374_10000316 3300013296 Bacteria 44946
155 Ga0157374_10000330 3300013296 Bacteria 43615
156 Ga0157374_10000533 3300013296 Bacteria 34093
157 Ga0157378_10000085 3300013297 Bacteria 87651
158 Ga0157378_10000096 3300013297 Bacteria 83922
159 Ga0157378_10000182 3300013297 Bacteria 60024
160 Ga0157378_10071107 3300013297 Bacteria 3124
161 Ga0157378_10103227 3300013297 Bacteria 2605
162 Ga0157378_10318656 3300013297 Bacteria 1510
163 Ga0157378_10343956 3300013297 Bacteria 1455
164 Ga0163162_10832279 3300013306 Bacteria 1039
165 Ga0157372_10000620 3300013307 Bacteria 38778
166 Ga0157372_10001563 3300013307 Bacteria 24933
167 Ga0157372_10001829 3300013307 Bacteria 23049
168 Ga0157372_10002374 3300013307 Bacteria 20377
169 Ga0157372_10011673 3300013307 Bacteria 9352
170 Ga0157372_10023041 3300013307 Bacteria 6748
171 Ga0157372_10028884 3300013307 Bacteria 6052
172 Ga0157372_10032055 3300013307 Bacteria 5759
173 Ga0157372_10173717 3300013307 Bacteria 2493
174 Ga0157375_10124899 3300013308 Bacteria 2687
175 Ga0157375_10244632 3300013308 Bacteria 1954
176 Ga0157375_11734135 3300013308 Unclassified 740
177 Ga0163163_10401700 3300014325 Bacteria 1428
178 Ga0157377_10040099 3300014745 Bacteria 2592
179 Ga0157379_10112996 3300014968 Bacteria 2441
180 Ga0157376_10000014 3300014969 Bacteria 303001
181 Ga0157376_10000462 3300014969 Bacteria 26233
182 Ga0157376_10045908 3300014969 Bacteria 3600
183 Ga0157376_10166630 3300014969 Bacteria 2002
184 Ga0228598_1000362 3300024227 Bacteria 8988
185 Ga0207692_10046164 3300025898 Bacteria 2183
186 Ga0207642_10109524 3300025899 Bacteria 1403
187 Ga0207710_10131421 3300025900 Bacteria 1202
188 Ga0207647_10008021 3300025904 Bacteria 7593
189 Ga0207699_10002789 3300025906 Bacteria 8251
190 Ga0207699_10096009 3300025906 Bacteria 1871
191 Ga0207643_10067271 3300025908 Bacteria 2056
192 Ga0207654_10008543 3300025911 Bacteria 5186
193 Ga0207707_10000739 3300025912 Bacteria 32307
194 Ga0207707_10005345 3300025912 Bacteria 11220
195 Ga0207707_10343213 3300025912 Unclassified 1287
196 Ga0207695_10065669 3300025913 Bacteria 3730
197 Ga0207695_10073020 3300025913 Bacteria 3497
198 Ga0207695_10489334 3300025913 Unclassified 1112
199 Ga0207671_10030492 3300025914 Bacteria 4022
200 Ga0207693_10027726 3300025915 Bacteria 4477
201 Ga0207693_10033637 3300025915 Bacteria 4044
202 Ga0207693_10348186 3300025915 Unclassified 1159
203 Ga0207693_10933846 3300025915 Bacteria 665
204 Ga0207663_10131586 3300025916 Bacteria 1729
205 Ga0207662_10073830 3300025918 Bacteria 2070
206 Ga0207652_10061025 3300025921 Bacteria 3255
207 Ga0207652_10689423 3300025921 Bacteria 912
208 Ga0207646_10197909 3300025922 Bacteria 1815
209 Ga0207646_10584695 3300025922 Bacteria 1003
210 Ga0207694_10098661 3300025924 Bacteria 2313
211 Ga0207650_10018697 3300025925 Bacteria 4866
212 Ga0207659_10032473 3300025926 Bacteria 3583
213 Ga0207687_10214937 3300025927 Unclassified 1510
214 Ga0207700_10006558 3300025928 Bacteria 7043
215 Ga0207700_10033559 3300025928 Bacteria 3674
216 Ga0207700_10341974 3300025928 Unclassified 1301
217 Ga0207700_10474055 3300025928 Unclassified 1105
218 Ga0207700_10717773 3300025928 Bacteria 893
219 Ga0207664_10007506 3300025929 Bacteria 7564
220 Ga0207664_10042113 3300025929 Bacteria 3563
221 Ga0207664_10107343 3300025929 Bacteria 2316
222 Ga0207664_10390970 3300025929 Bacteria 1236
223 Ga0207686_10352538 3300025934 Bacteria 1108
224 Ga0207670_10221419 3300025936 Bacteria 1449
225 Ga0207704_10033299 3300025938 Bacteria 2928
226 Ga0207704_10621055 3300025938 Unclassified 887
227 Ga0207665_10004561 3300025939 Bacteria 9191
228 Ga0207665_10098430 3300025939 Bacteria 2038
229 Ga0207711_10057247 3300025941 Bacteria 3352
230 Ga0207689_10006686 3300025942 Bacteria 10172
231 Ga0207661_10007877 3300025944 Bacteria 7591
232 Ga0207679_10006350 3300025945 Bacteria 7470
233 Ga0207679_10260402 3300025945 Unclassified 1479
234 Ga0207667_10000785 3300025949 Bacteria 41249
235 Ga0207667_10003707 3300025949 Bacteria 18846
236 Ga0207667_10005364 3300025949 Bacteria 15629
237 Ga0207667_10123205 3300025949 Bacteria 2671
238 Ga0207651_10364096 3300025960 Bacteria 1221
239 Ga0207640_10009516 3300025981 Bacteria 5443
240 Ga0207640_10050349 3300025981 Bacteria 2702
241 Ga0207677_10004627 3300026023 Bacteria 7403
242 Ga0207677_10005454 3300026023 Bacteria 6906
243 Ga0207703_10020414 3300026035 Bacteria 5181
244 Ga0207703_10069166 3300026035 Bacteria 2911
245 Ga0207639_10547362 3300026041 Bacteria 1062
246 Ga0207702_10000089 3300026078 Bacteria 105440
247 Ga0207702_10000759 3300026078 Bacteria 34304
248 Ga0207702_10010816 3300026078 Bacteria 7612
249 Ga0207641_10036769 3300026088 Bacteria 4087
250 Ga0207641_10078728 3300026088 Bacteria 2855
251 Ga0207641_10309710 3300026088 Bacteria 1494
252 Ga0207641_10357469 3300026088 Bacteria 1393
253 Ga0207648_10005354 3300026089 Bacteria 12938
254 Ga0207676_10008246 3300026095 Bacteria 7411
255 Ga0207676_10011245 3300026095 Bacteria 6395
256 Ga0207674_10000309 3300026116 Bacteria 62067
257 Ga0207683_10109270 3300026121 Bacteria 2475
258 Ga0207698_10018594 3300026142 Bacteria 4740
259 Ga0207698_11358952 3300026142 Unclassified 725
260 Ga0209179_1001747 3300027512 Bacteria 2762
261 Ga0268266_10000204 3300028379 Bacteria 104000
262 Ga0268264_10013668 3300028381 Bacteria 6682
263 Ga0268264_10075062 3300028381 Bacteria 2874
264 Ga0268264_10543989 3300028381 Bacteria 1138
265 Ga0373934_0000569 3300035086 Bacteria 12980
266 Ga0373934_0032778 3300035086 Unclassified 2039
267 Ga0373923_0044735 3300035111 Bacteria 1837
268 Ga0373954_0000253 3300035118 Bacteria 19301
269 Ga0373956_0003879 3300035119 Bacteria 6007
270 Ga0373943_0062079 3300035170 Bacteria 1870
271 Ga0373946_0254109 3300035171 Unclassified 858
272 Ga0373955_0009722 3300035172 Bacteria 4517
273 Ga0373924_0091149 3300035410 Bacteria 1304
274 Ga0373931_0502148 3300035691 Bacteria 782
275 Ga0373927_0031526 3300035695 Bacteria 3455
276 Ga0373927_0110108 3300035695 Bacteria 1794
277 Ga0373937_0003091 3300036401 Bacteria 13926
278 Ga0373937_0025470 3300036401 Bacteria 5340
279 Ga0373937_0216698 3300036401 Bacteria 1802
280 Ga0373925_0005926 3300037068 Bacteria 9061
281 Ga0373925_0020882 3300037068 Bacteria 4773
282 Ga0395900_1040208 3300037418 Bacteria 738
283 Ga0436363_1655911 3300039450 Bacteria 700
284 Ga0436362_0334436 3300039453 Unclassified 912
285 Ga0466966_0428471 3300044684 Bacteria 795
286 Ga0466961_0080159 3300044693 Unclassified 2067
287 Ga0466963_0122569 3300044694 Bacteria 1790
288 Ga0453684_0712067 3300044712 Unclassified 1090
289 Ga0466971_0036988 3300044719 Unclassified 2189
290 Ga0466957_0092398 3300044842 Bacteria 1898
291 Ga0466959_0105057 3300045049 Bacteria 2020
292 Ga0451576_0605077 3300045051 Unclassified 1152
293 Ga0466967_0175679 3300045976 Bacteria 2018
294 Ga0495603_0013040 3300046455 Bacteria 5025
295 Ga0495603_0024560 3300046455 Bacteria 3646
296 Ga0495641_0033594 3300046461 Bacteria 2433
297 Ga0495651_0069057 3300046462 Unclassified 2692
298 Ga0495653_0026708 3300046463 Unclassified 4627
299 Ga0495580_0004333 3300046472 Bacteria 11913
300 Ga0495580_0006128 3300046472 Bacteria 9836
301 Ga0495580_0009426 3300046472 Bacteria 7681
302 Ga0495580_0050069 3300046472 Bacteria 2954
303 Ga0495580_0204093 3300046472 Bacteria 1361
304 Ga0495582_0000168 3300046473 Bacteria 35577
305 Ga0495662_0080452 3300046476 Bacteria 1584
306 Ga0495664_0032039 3300046477 Bacteria 3083
307 Ga0495594_0031366 3300046499 Bacteria 2880
308 Ga0495608_0012244 3300046511 Bacteria 5959
309 Ga0495618_0202503 3300046514 Bacteria 1256
310 Ga0495630_0038425 3300046517 Bacteria 3580
311 Ga0495630_0156808 3300046517 Bacteria 1733
312 Ga0495666_0004851 3300046526 Bacteria 6797
313 Ga0495665_0200571 3300046531 Bacteria 1034
314 Ga0495640_0023650 3300046533 Bacteria 4471
315 Ga0495586_0113208 3300046535 Bacteria 1511
316 Ga0495587_0042895 3300046536 Unclassified 2695
317 Ga0495622_0275078 3300046557 Unclassified 737
318 Ga0495667_0062678 3300046559 Unclassified 2436
319 Ga0495635_0036079 3300046663 Bacteria 3428
320 Ga0495657_0041682 3300046675 Bacteria 3140
321 Ga0495623_0017209 3300046679 Unclassified 4670
322 Ga0495623_0398906 3300046679 Unclassified 740
323 Ga0495647_0021464 3300046681 Bacteria 2325
324 Ga0495658_0014126 3300046683 Bacteria 4072
325 Ga0495604_0004289 3300047317 Bacteria 11291
326 Ga0495674_0104490 3300047319 Unclassified 2408
327 Ga0495674_0223259 3300047319 Bacteria 1557
328 Ga0495676_0026158 3300047321 Bacteria 5027
329 Ga0495684_0046680 3300047471 Bacteria 3313
330 Ga0495593_0062215 3300047673 Bacteria 1951
331 Ga0495602_0036669 3300048088 Bacteria 4560
332 Ga0495602_0163812 3300048088 Bacteria 1733
333 Ga0496101_0088192 3300048904 Bacteria 2304
334 Ga0496102_0444966 3300048905 Unclassified 1216
335 Ga0496104_0121463 3300048907 Unclassified 2508
336 Ga0496104_0135393 3300048907 Bacteria 2367
337 Ga0496112_0052519 3300048915 Bacteria 4000
338 Ga0496112_0053191 3300048915 Bacteria 3976
339 Ga0496112_0120734 3300048915 Bacteria 2591
340 Ga0496114_0003782 3300048917 Bacteria 11668
341 Ga0496114_0087672 3300048917 Bacteria 2639
342 Ga0496115_0026082 3300048918 Bacteria 4557
343 nmdc:mga0n895_14256_c1 3300050512 Bacteria 7212
344 nmdc:mga0n895_34219_c1 3300050512 Bacteria 4889
345 nmdc:mga0n895_76213_c1 3300050512 Bacteria 3335
346 nmdc:mga0rr50_121545_c1 3300050513 Bacteria 2079
347 nmdc:mga0rr50_3575_c1 3300050513 Bacteria 8979
348 nmdc:mga0rr50_77726_c1 3300050513 Bacteria 2551
349 nmdc:mga08x19_408751_c1 3300050514 Bacteria 953
350 nmdc:mga08x19_65667_c1 3300050514 Bacteria 2357
351 nmdc:mga08x19_9583_c2 3300050514 Bacteria 4833
352 nmdc:mga0a205_701543_c1 3300050515 Unclassified 862

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0712067 Ga0453684_0712067_28_615 193
2 3300025915 Ga0207693_10933846 Ga0207693_109338461 202
3 3300039453 Ga0436362_0334436 Ga0436362_0334436_231_896 203
4 3300028379 Ga0268266_10000204 Ga0268266_1000020478 206
5 3300046557 Ga0495622_0275078 Ga0495622_0275078_13_645 208
6 3300005440 Ga0070705_100023376 Ga0070705_1000233762 210
7 3300005468 Ga0070707_100127570 Ga0070707_1001275702 210
8 3300005841 Ga0068863_100086132 Ga0068863_1000861324 210
9 3300005842 Ga0068858_100303383 Ga0068858_1003033831 210
10 3300006871 Ga0075434_100045476 Ga0075434_1000454763 210
11 3300006871 Ga0075434_100193453 Ga0075434_1001934532 210
12 3300007076 Ga0075435_100014467 Ga0075435_1000144676 210
13 3300025922 Ga0207646_10197909 Ga0207646_101979093 210
14 3300026035 Ga0207703_10069166 Ga0207703_100691663 210
15 3300026088 Ga0207641_10078728 Ga0207641_100787284 210
16 3300025915 Ga0207693_10033637 Ga0207693_100336374 215
17 3300046455 Ga0495603_0013040 Ga0495603_0013040_295_954 217
18 3300046461 Ga0495641_0033594 Ga0495641_0033594_400_1059 217
19 3300046472 Ga0495580_0009426 Ga0495580_0009426_5236_5895 217
20 3300046473 Ga0495582_0000168 Ga0495582_0000168_870_1529 217
21 3300005468 Ga0070707_100491180 Ga0070707_1004911801 218
22 3300007265 Ga0099794_10003719 Ga0099794_100037195 218
23 3300014969 Ga0157376_10000462 Ga0157376_1000046213 218
24 3300025922 Ga0207646_10584695 Ga0207646_105846951 218
25 3300048904 Ga0496101_0088192 Ga0496101_0088192_1051_1710 218
26 3300048907 Ga0496104_0135393 Ga0496104_0135393_1055_1729 218
27 3300048918 Ga0496115_0026082 Ga0496115_0026082_197_856 218
28 3300005434 Ga0070709_10279872 Ga0070709_102798722 219
29 3300005435 Ga0070714_100228811 Ga0070714_1002288112 219
30 3300005435 Ga0070714_100305222 Ga0070714_1003052222 219
31 3300005436 Ga0070713_100080810 Ga0070713_1000808102 219
32 3300005436 Ga0070713_100125344 Ga0070713_1001253442 219
33 3300005439 Ga0070711_100106482 Ga0070711_1001064822 219
34 3300005439 Ga0070711_100226789 Ga0070711_1002267893 219
35 3300005445 Ga0070708_100002019 Ga0070708_10000201912 219
36 3300005445 Ga0070708_100064427 Ga0070708_1000644273 219
37 3300005468 Ga0070707_100103187 Ga0070707_1001031872 219
38 3300005468 Ga0070707_100517486 Ga0070707_1005174862 219
39 3300005471 Ga0070698_100012602 Ga0070698_1000126026 219
40 3300005518 Ga0070699_100043476 Ga0070699_1000434763 219
41 3300005536 Ga0070697_100019967 Ga0070697_1000199671 219
42 3300005544 Ga0070686_100060835 Ga0070686_1000608352 219
43 3300005563 Ga0068855_100357847 Ga0068855_1003578472 219
44 3300005578 Ga0068854_100085520 Ga0068854_1000855202 219
45 3300005614 Ga0068856_100087961 Ga0068856_1000879612 219
46 3300005616 Ga0068852_100011956 Ga0068852_1000119562 219
47 3300005841 Ga0068863_100176285 Ga0068863_1001762854 219
48 3300005843 Ga0068860_100016243 Ga0068860_1000162435 219
49 3300005843 Ga0068860_100777318 Ga0068860_1007773182 219
50 3300005983 Ga0081540_1039082 Ga0081540_10390823 219
51 3300006028 Ga0070717_10004158 Ga0070717_100041583 219
52 3300006028 Ga0070717_10151350 Ga0070717_101513502 219
53 3300006028 Ga0070717_10263480 Ga0070717_102634802 219
54 3300006173 Ga0070716_100015676 Ga0070716_1000156762 219
55 3300006173 Ga0070716_100545064 Ga0070716_1005450642 219
56 3300006237 Ga0097621_100002739 Ga0097621_1000027395 219
57 3300006237 Ga0097621_100003948 Ga0097621_1000039485 219
58 3300006237 Ga0097621_100249159 Ga0097621_1002491591 219
59 3300006358 Ga0068871_100012155 Ga0068871_1000121553 219
60 3300006358 Ga0068871_100092732 Ga0068871_1000927322 219
61 3300006358 Ga0068871_100152225 Ga0068871_1001522252 219
62 3300006852 Ga0075433_10591549 Ga0075433_105915492 219
63 3300006871 Ga0075434_100012218 Ga0075434_1000122184 219
64 3300006871 Ga0075434_100017276 Ga0075434_1000172765 219
65 3300007076 Ga0075435_100005304 Ga0075435_1000053042 219
66 3300007076 Ga0075435_100039481 Ga0075435_1000394812 219
67 3300007265 Ga0099794_10015509 Ga0099794_100155092 219
68 3300007788 Ga0099795_10002165 Ga0099795_100021653 219
69 3300009093 Ga0105240_10032699 Ga0105240_100326992 219
70 3300009093 Ga0105240_10038395 Ga0105240_100383954 219
71 3300009093 Ga0105240_10097442 Ga0105240_100974422 219
72 3300009101 Ga0105247_10161779 Ga0105247_101617792 219
73 3300009174 Ga0105241_10011619 Ga0105241_100116195 219
74 3300009177 Ga0105248_10015348 Ga0105248_100153487 219
75 3300009177 Ga0105248_10257754 Ga0105248_102577543 219
76 3300009545 Ga0105237_10015644 Ga0105237_100156444 219
77 3300009545 Ga0105237_10019843 Ga0105237_100198435 219
78 3300009545 Ga0105237_10300373 Ga0105237_103003732 219
79 3300009551 Ga0105238_10006729 Ga0105238_100067297 219
80 3300009553 Ga0105249_10427452 Ga0105249_104274521 219
81 3300009553 Ga0105249_10531370 Ga0105249_105313702 219
82 3300010159 Ga0099796_10014360 Ga0099796_100143602 219
83 3300013100 Ga0157373_10001055 Ga0157373_1000105513 219
84 3300013104 Ga0157370_10017861 Ga0157370_100178611 219
85 3300013105 Ga0157369_10009253 Ga0157369_100092535 219
86 3300013105 Ga0157369_10021941 Ga0157369_100219415 219
87 3300013105 Ga0157369_10032911 Ga0157369_100329112 219
88 3300013105 Ga0157369_10048297 Ga0157369_100482973 219
89 3300013297 Ga0157378_10000096 Ga0157378_1000009662 219
90 3300013297 Ga0157378_10071107 Ga0157378_100711071 219
91 3300013297 Ga0157378_10318656 Ga0157378_103186562 219
92 3300013297 Ga0157378_10343956 Ga0157378_103439561 219
93 3300013306 Ga0163162_10832279 Ga0163162_108322792 219
94 3300013307 Ga0157372_10001829 Ga0157372_1000182910 219
95 3300013307 Ga0157372_10011673 Ga0157372_100116735 219
96 3300013307 Ga0157372_10023041 Ga0157372_100230415 219
97 3300013307 Ga0157372_10028884 Ga0157372_100288844 219
98 3300013307 Ga0157372_10032055 Ga0157372_100320555 219
99 3300013307 Ga0157372_10173717 Ga0157372_101737172 219
100 3300013308 Ga0157375_10124899 Ga0157375_101248992 219
101 3300013308 Ga0157375_10244632 Ga0157375_102446321 219
102 3300013308 Ga0157375_11734135 Ga0157375_117341351 219
103 3300014968 Ga0157379_10112996 Ga0157379_101129963 219
104 3300014969 Ga0157376_10000014 Ga0157376_10000014110 219
105 3300024227 Ga0228598_1000362 Ga0228598_10003621 219
106 3300025900 Ga0207710_10131421 Ga0207710_101314212 219
107 3300025906 Ga0207699_10096009 Ga0207699_100960092 219
108 3300025911 Ga0207654_10008543 Ga0207654_100085432 219
109 3300025913 Ga0207695_10065669 Ga0207695_100656693 219
110 3300025913 Ga0207695_10073020 Ga0207695_100730203 219
111 3300025914 Ga0207671_10030492 Ga0207671_100304924 219
112 3300025924 Ga0207694_10098661 Ga0207694_100986614 219
113 3300025928 Ga0207700_10033559 Ga0207700_100335592 219
114 3300025928 Ga0207700_10474055 Ga0207700_104740552 219
115 3300025929 Ga0207664_10007506 Ga0207664_100075062 219
116 3300025929 Ga0207664_10107343 Ga0207664_101073432 219
117 3300025929 Ga0207664_10390970 Ga0207664_103909702 219
118 3300025938 Ga0207704_10033299 Ga0207704_100332992 219
119 3300025939 Ga0207665_10098430 Ga0207665_100984303 219
120 3300025941 Ga0207711_10057247 Ga0207711_100572471 219
121 3300025949 Ga0207667_10123205 Ga0207667_101232053 219
122 3300025981 Ga0207640_10050349 Ga0207640_100503493 219
123 3300026088 Ga0207641_10309710 Ga0207641_103097101 219
124 3300027512 Ga0209179_1001747 Ga0209179_10017475 219
125 3300028381 Ga0268264_10013668 Ga0268264_100136684 219
126 3300028381 Ga0268264_10543989 Ga0268264_105439891 219
127 3300035086 Ga0373934_0032778 Ga0373934_0032778_880_1542 219
128 3300035111 Ga0373923_0044735 Ga0373923_0044735_79_750 219
129 3300035170 Ga0373943_0062079 Ga0373943_0062079_788_1459 219
130 3300035171 Ga0373946_0254109 Ga0373946_0254109_160_828 219
131 3300035691 Ga0373931_0502148 Ga0373931_0502148_43_708 219
132 3300035695 Ga0373927_0110108 Ga0373927_0110108_1003_1674 219
133 3300036401 Ga0373937_0025470 Ga0373937_0025470_4428_5090 219
134 3300036401 Ga0373937_0216698 Ga0373937_0216698_799_1467 219
135 3300037068 Ga0373925_0005926 Ga0373925_0005926_2164_2832 219
136 3300037418 Ga0395900_1040208 Ga0395900_1040208_25_699 219
137 3300039450 Ga0436363_1655911 Ga0436363_1655911_18_683 219
138 3300044684 Ga0466966_0428471 Ga0466966_0428471_52_717 219
139 3300046472 Ga0495580_0004333 Ga0495580_0004333_2735_3400 219
140 3300046472 Ga0495580_0050069 Ga0495580_0050069_2270_2938 219
141 3300046472 Ga0495580_0204093 Ga0495580_0204093_93_761 219
142 3300046476 Ga0495662_0080452 Ga0495662_0080452_61_729 219
143 3300046499 Ga0495594_0031366 Ga0495594_0031366_471_1139 219
144 3300046517 Ga0495630_0038425 Ga0495630_0038425_1459_2127 219
145 3300046517 Ga0495630_0156808 Ga0495630_0156808_803_1474 219
146 3300046531 Ga0495665_0200571 Ga0495665_0200571_344_1012 219
147 3300046533 Ga0495640_0023650 Ga0495640_0023650_2580_3248 219
148 3300046535 Ga0495586_0113208 Ga0495586_0113208_361_1029 219
149 3300046663 Ga0495635_0036079 Ga0495635_0036079_2135_2803 219
150 3300046679 Ga0495623_0398906 Ga0495623_0398906_24_689 219
151 3300046681 Ga0495647_0021464 Ga0495647_0021464_1615_2283 219
152 3300046683 Ga0495658_0014126 Ga0495658_0014126_2731_3399 219
153 3300047319 Ga0495674_0104490 Ga0495674_0104490_1335_1997 219
154 3300047319 Ga0495674_0223259 Ga0495674_0223259_712_1380 219
155 3300047321 Ga0495676_0026158 Ga0495676_0026158_356_1024 219
156 3300047471 Ga0495684_0046680 Ga0495684_0046680_2401_3069 219
157 3300048088 Ga0495602_0163812 Ga0495602_0163812_938_1603 219
158 3300048905 Ga0496102_0444966 Ga0496102_0444966_29_703 219
159 3300048915 Ga0496112_0053191 Ga0496112_0053191_1570_2238 219
160 3300048915 Ga0496112_0120734 Ga0496112_0120734_1721_2398 219
161 3300048917 Ga0496114_0003782 Ga0496114_0003782_7295_7960 219
162 3300048917 Ga0496114_0087672 Ga0496114_0087672_109_777 219
163 3300050512 nmdc:mga0n895_14256_c1 nmdc:mga0n895_14256_c1_4405_5070 219
164 3300050512 nmdc:mga0n895_34219_c1 nmdc:mga0n895_34219_c1_1225_1989 219
165 3300050513 nmdc:mga0rr50_121545_c1 nmdc:mga0rr50_121545_c1_1335_2000 219
166 3300050513 nmdc:mga0rr50_3575_c1 nmdc:mga0rr50_3575_c1_218_982 219
167 3300050514 nmdc:mga08x19_408751_c1 nmdc:mga08x19_408751_c1_143_820 219
168 3300050514 nmdc:mga08x19_65667_c1 nmdc:mga08x19_65667_c1_137_799 219
169 3300050514 nmdc:mga08x19_9583_c2 nmdc:mga08x19_9583_c2_2544_3308 219
170 3300050515 nmdc:mga0a205_701543_c1 nmdc:mga0a205_701543_c1_33_698 219
171 3300005336 Ga0070680_100055067 Ga0070680_1000550673 220
172 3300005338 Ga0068868_100027134 Ga0068868_1000271345 220
173 3300005355 Ga0070671_100031817 Ga0070671_1000318172 220
174 3300005435 Ga0070714_100048704 Ga0070714_1000487043 220
175 3300005436 Ga0070713_100181121 Ga0070713_1001811213 220
176 3300005437 Ga0070710_10293668 Ga0070710_102936681 220
177 3300005439 Ga0070711_100345096 Ga0070711_1003450962 220
178 3300005440 Ga0070705_100326279 Ga0070705_1003262792 220
179 3300005458 Ga0070681_10241216 Ga0070681_102412162 220
180 3300005530 Ga0070679_100272537 Ga0070679_1002725372 220
181 3300005535 Ga0070684_100053890 Ga0070684_1000538903 220
182 3300005547 Ga0070693_100198585 Ga0070693_1001985852 220
183 3300005563 Ga0068855_100002871 Ga0068855_10000287115 220
184 3300005564 Ga0070664_100056829 Ga0070664_1000568291 220
185 3300005614 Ga0068856_100001245 Ga0068856_10000124518 220
186 3300005615 Ga0070702_100427094 Ga0070702_1004270941 220
187 3300005616 Ga0068852_100598890 Ga0068852_1005988901 220
188 3300005618 Ga0068864_100006890 Ga0068864_1000068901 220
189 3300005718 Ga0068866_10250552 Ga0068866_102505521 220
190 3300005841 Ga0068863_100040850 Ga0068863_1000408502 220
191 3300006173 Ga0070716_100214269 Ga0070716_1002142691 220
192 3300006175 Ga0070712_100496181 Ga0070712_1004961811 220
193 3300006237 Ga0097621_100000581 Ga0097621_10000058118 220
194 3300006358 Ga0068871_100000664 Ga0068871_10000066418 220
195 3300006881 Ga0068865_100702532 Ga0068865_1007025321 220
196 3300009093 Ga0105240_10043737 Ga0105240_100437372 220
197 3300009093 Ga0105240_10693811 Ga0105240_106938112 220
198 3300009176 Ga0105242_10175396 Ga0105242_101753962 220
199 3300009551 Ga0105238_10644257 Ga0105238_106442572 220
200 3300010375 Ga0105239_10030756 Ga0105239_100307563 220
201 3300010375 Ga0105239_10323704 Ga0105239_103237042 220
202 3300011119 Ga0105246_10023240 Ga0105246_100232405 220
203 3300013102 Ga0157371_10038309 Ga0157371_100383095 220
204 3300013102 Ga0157371_10165722 Ga0157371_101657222 220
205 3300013105 Ga0157369_10000170 Ga0157369_1000017026 220
206 3300013105 Ga0157369_10150584 Ga0157369_101505844 220
207 3300013296 Ga0157374_10000316 Ga0157374_1000031618 220
208 3300013296 Ga0157374_10000330 Ga0157374_1000033026 220
209 3300013297 Ga0157378_10000085 Ga0157378_1000008557 220
210 3300013297 Ga0157378_10103227 Ga0157378_101032272 220
211 3300013307 Ga0157372_10001563 Ga0157372_100015632 220
212 3300013307 Ga0157372_10002374 Ga0157372_1000237415 220
213 3300014325 Ga0163163_10401700 Ga0163163_104017002 220
214 3300014969 Ga0157376_10045908 Ga0157376_100459082 220
215 3300014969 Ga0157376_10166630 Ga0157376_101666302 220
216 3300025898 Ga0207692_10046164 Ga0207692_100461642 220
217 3300025899 Ga0207642_10109524 Ga0207642_101095242 220
218 3300025912 Ga0207707_10343213 Ga0207707_103432132 220
219 3300025913 Ga0207695_10489334 Ga0207695_104893342 220
220 3300025915 Ga0207693_10348186 Ga0207693_103481861 220
221 3300025916 Ga0207663_10131586 Ga0207663_101315862 220
222 3300025927 Ga0207687_10214937 Ga0207687_102149372 220
223 3300025929 Ga0207664_10042113 Ga0207664_100421133 220
224 3300025938 Ga0207704_10621055 Ga0207704_106210551 220
225 3300025945 Ga0207679_10260402 Ga0207679_102604021 220
226 3300025949 Ga0207667_10003707 Ga0207667_100037074 220
227 3300026023 Ga0207677_10004627 Ga0207677_100046272 220
228 3300026078 Ga0207702_10000759 Ga0207702_1000075910 220
229 3300026088 Ga0207641_10036769 Ga0207641_100367693 220
230 3300026095 Ga0207676_10008246 Ga0207676_100082462 220
231 3300026142 Ga0207698_11358952 Ga0207698_113589521 220
232 3300035410 Ga0373924_0091149 Ga0373924_0091149_442_1149 220
233 3300045051 Ga0451576_0605077 Ga0451576_0605077_418_1080 220
234 3300048088 Ga0495602_0036669 Ga0495602_0036669_3529_4236 220
235 3300048907 Ga0496104_0121463 Ga0496104_0121463_178_840 220
236 3300048915 Ga0496112_0052519 Ga0496112_0052519_2827_3489 220
237 3300044693 Ga0466961_0080159 Ga0466961_0080159_1265_1993 223
238 3300044694 Ga0466963_0122569 Ga0466963_0122569_200_928 223
239 3300044719 Ga0466971_0036988 Ga0466971_0036988_821_1549 223
240 3300044842 Ga0466957_0092398 Ga0466957_0092398_40_768 223
241 3300045049 Ga0466959_0105057 Ga0466959_0105057_842_1570 223
242 3300045976 Ga0466967_0175679 Ga0466967_0175679_296_1024 223
243 3300035086 Ga0373934_0000569 Ga0373934_0000569_9263_10039 224
244 3300035118 Ga0373954_0000253 Ga0373954_0000253_11631_12407 224
245 3300035119 Ga0373956_0003879 Ga0373956_0003879_2528_3304 224
246 3300035172 Ga0373955_0009722 Ga0373955_0009722_978_1754 224
247 3300036401 Ga0373937_0003091 Ga0373937_0003091_10810_11586 224
248 3300046462 Ga0495651_0069057 Ga0495651_0069057_1561_2337 224
249 3300046463 Ga0495653_0026708 Ga0495653_0026708_3457_4233 224
250 3300046511 Ga0495608_0012244 Ga0495608_0012244_4965_5741 224
251 3300046536 Ga0495587_0042895 Ga0495587_0042895_36_812 224
252 3300046559 Ga0495667_0062678 Ga0495667_0062678_779_1555 224
253 3300046675 Ga0495657_0041682 Ga0495657_0041682_1200_1976 224
254 3300046679 Ga0495623_0017209 Ga0495623_0017209_1022_1798 224
255 3300047317 Ga0495604_0004289 Ga0495604_0004289_3499_4275 224
256 3300050512 nmdc:mga0n895_76213_c1 nmdc:mga0n895_76213_c1_1996_2721 225
257 3300050513 nmdc:mga0rr50_77726_c1 nmdc:mga0rr50_77726_c1_162_887 225
258 3300037068 Ga0373925_0020882 Ga0373925_0020882_1021_1758 228
259 3300046455 Ga0495603_0024560 Ga0495603_0024560_2623_3360 228
260 3300046472 Ga0495580_0006128 Ga0495580_0006128_83_820 228
261 3300046477 Ga0495664_0032039 Ga0495664_0032039_1204_1941 228
262 3300046514 Ga0495618_0202503 Ga0495618_0202503_24_761 228
263 3300046526 Ga0495666_0004851 Ga0495666_0004851_3500_4237 228
264 3300047673 Ga0495593_0062215 Ga0495593_0062215_402_1139 228
265 3300005467 Ga0070706_100184021 Ga0070706_1001840212 231
266 3300035695 Ga0373927_0031526 Ga0373927_0031526_2680_3390 231
267 3300006175 Ga0070712_100039444 Ga0070712_1000394442 232
268 3300025915 Ga0207693_10027726 Ga0207693_100277262 232
269 3300025928 Ga0207700_10717773 Ga0207700_107177731 232
270 3300005434 Ga0070709_10003180 Ga0070709_100031805 236
271 3300005436 Ga0070713_100002231 Ga0070713_1000022315 236
272 3300005437 Ga0070710_10190895 Ga0070710_101908952 236
273 3300005439 Ga0070711_100230402 Ga0070711_1002304021 236
274 3300006173 Ga0070716_100002152 Ga0070716_1000021523 236
275 3300006175 Ga0070712_100077081 Ga0070712_1000770813 236
276 3300025906 Ga0207699_10002789 Ga0207699_100027896 236
277 3300025928 Ga0207700_10006558 Ga0207700_100065584 236
278 3300025939 Ga0207665_10004561 Ga0207665_100045614 236
279 3300005329 Ga0070683_100008769 Ga0070683_1000087696 237
280 3300005334 Ga0068869_100035638 Ga0068869_1000356382 237
281 3300005338 Ga0068868_100001960 Ga0068868_1000019605 237
282 3300005338 Ga0068868_100007353 Ga0068868_1000073537 237
283 3300005343 Ga0070687_100013685 Ga0070687_1000136854 237
284 3300005354 Ga0070675_100040046 Ga0070675_1000400462 237
285 3300005436 Ga0070713_100350603 Ga0070713_1003506032 237
286 3300005458 Ga0070681_10000055 Ga0070681_1000005516 237
287 3300005458 Ga0070681_10147148 Ga0070681_101471482 237
288 3300005459 Ga0068867_100011100 Ga0068867_1000111004 237
289 3300005530 Ga0070679_100069155 Ga0070679_1000691551 237
290 3300005530 Ga0070679_100088289 Ga0070679_1000882892 237
291 3300005535 Ga0070684_100021584 Ga0070684_1000215844 237
292 3300005546 Ga0070696_100245379 Ga0070696_1002453792 237
293 3300005547 Ga0070693_100018029 Ga0070693_1000180295 237
294 3300005547 Ga0070693_100105610 Ga0070693_1001056103 237
295 3300005563 Ga0068855_100001077 Ga0068855_1000010777 237
296 3300005563 Ga0068855_100061692 Ga0068855_1000616925 237
297 3300005564 Ga0070664_100001803 Ga0070664_1000018039 237
298 3300005577 Ga0068857_100000041 Ga0068857_10000004138 237
299 3300005577 Ga0068857_100007186 Ga0068857_1000071865 237
300 3300005578 Ga0068854_100006073 Ga0068854_1000060737 237
301 3300005578 Ga0068854_100072079 Ga0068854_1000720794 237
302 3300005614 Ga0068856_100000355 Ga0068856_10000035518 237
303 3300005614 Ga0068856_100001397 Ga0068856_10000139720 237
304 3300005616 Ga0068852_100026166 Ga0068852_1000261662 237
305 3300005616 Ga0068852_100307464 Ga0068852_1003074642 237
306 3300005617 Ga0068859_100000959 Ga0068859_10000095911 237
307 3300005618 Ga0068864_100005434 Ga0068864_1000054348 237
308 3300005841 Ga0068863_100058223 Ga0068863_1000582232 237
309 3300005842 Ga0068858_100043994 Ga0068858_1000439942 237
310 3300005843 Ga0068860_100085305 Ga0068860_1000853053 237
311 3300006237 Ga0097621_100000533 Ga0097621_1000005335 237
312 3300006237 Ga0097621_100051783 Ga0097621_1000517833 237
313 3300006358 Ga0068871_100000221 Ga0068871_10000022126 237
314 3300006358 Ga0068871_100007730 Ga0068871_1000077307 237
315 3300006881 Ga0068865_100022996 Ga0068865_1000229962 237
316 3300006931 Ga0097620_100000959 Ga0097620_10000095916 237
317 3300013102 Ga0157371_10045252 Ga0157371_100452523 237
318 3300013296 Ga0157374_10000533 Ga0157374_1000053314 237
319 3300013297 Ga0157378_10000182 Ga0157378_100001827 237
320 3300013307 Ga0157372_10000620 Ga0157372_1000062021 237
321 3300014745 Ga0157377_10040099 Ga0157377_100400992 237
322 3300025904 Ga0207647_10008021 Ga0207647_100080214 237
323 3300025908 Ga0207643_10067271 Ga0207643_100672712 237
324 3300025912 Ga0207707_10000739 Ga0207707_1000073924 237
325 3300025912 Ga0207707_10005345 Ga0207707_100053453 237
326 3300025918 Ga0207662_10073830 Ga0207662_100738302 237
327 3300025921 Ga0207652_10061025 Ga0207652_100610253 237
328 3300025921 Ga0207652_10689423 Ga0207652_106894231 237
329 3300025925 Ga0207650_10018697 Ga0207650_100186971 237
330 3300025926 Ga0207659_10032473 Ga0207659_100324732 237
331 3300025928 Ga0207700_10341974 Ga0207700_103419741 237
332 3300025934 Ga0207686_10352538 Ga0207686_103525381 237
333 3300025936 Ga0207670_10221419 Ga0207670_102214191 237
334 3300025942 Ga0207689_10006686 Ga0207689_100066865 237
335 3300025944 Ga0207661_10007877 Ga0207661_100078774 237
336 3300025945 Ga0207679_10006350 Ga0207679_100063506 237
337 3300025949 Ga0207667_10000785 Ga0207667_1000078513 237
338 3300025949 Ga0207667_10005364 Ga0207667_1000536414 237
339 3300025960 Ga0207651_10364096 Ga0207651_103640962 237
340 3300025981 Ga0207640_10009516 Ga0207640_100095162 237
341 3300026023 Ga0207677_10005454 Ga0207677_100054545 237
342 3300026035 Ga0207703_10020414 Ga0207703_100204142 237
343 3300026041 Ga0207639_10547362 Ga0207639_105473622 237
344 3300026078 Ga0207702_10000089 Ga0207702_1000008925 237
345 3300026078 Ga0207702_10010816 Ga0207702_100108162 237
346 3300026088 Ga0207641_10357469 Ga0207641_103574692 237
347 3300026089 Ga0207648_10005354 Ga0207648_100053543 237
348 3300026095 Ga0207676_10011245 Ga0207676_100112455 237
349 3300026116 Ga0207674_10000309 Ga0207674_1000030923 237
350 3300026121 Ga0207683_10109270 Ga0207683_101092701 237
351 3300026142 Ga0207698_10018594 Ga0207698_100185942 237
352 3300028381 Ga0268264_10075062 Ga0268264_100750622 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

61

232

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

58

226

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvx-assembly1.cif.gz_A structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (otsb2) from mycobacterium tuberculosis 0.9134 161 219
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.8833 23 217
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.8669 23 214
2qlt-assembly1.cif.gz_A crystal structure of an isoform of dl-glycerol-3-phosphatase, rhr2p, from saccharomyces cerevisiae 0.8636 18 237
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.8547 24 214
ID Description Score Start End Superfamily
af_A0A0R0KYK9_29_156_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9425 119 219 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9218 119 222 3.40.50.1000
af_O17773_104_249_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8871 119 216 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8772 104 196 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8744 119 220 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V9W8T1-F1-model_v4 HAD family hydrolase 0.9893 19 235 GO:0050308
AF-A0A2V9W8T1-F1-model_v4 HAD family hydrolase 0.9758 19 235 GO:0050308
AF-A0A836QI30-F1-model_v4 HAD family phosphatase 0.9697 119 220 GO:0050308
AF-A0A3C1GCQ8-F1-model_v4 HAD family phosphatase 0.9681 119 219 GO:0050308
AF-A0A7J7IQD3-F1-model_v4 Uncharacterized protein 0.9648 147 219 GO:0050308

Feature Viewer

pLDDT pTM Quality
91.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map