F418901

General Info

Members Datasets Scaffolds Average Seq Length
352 155 704 318

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100008630|Ga0070660_1000086302
Length 385
Sequence VLLDVDEQAPGGHRDAGRLELAPDEVGDGLAGEEGGQEDVQPVVEHGRIIPVPAVICIFHILMYTYPQMTTAAILGCAGYTGQETLDRVLAHPDLEPIALGSDSLAGRPAAALDPRLNRALPAFTTNAEAVAAGADLLFLCLGGDEAAAFEPPSGAVVVDLSGAHRLTDPDVACAWYGNAPGAWSYGLPELYPPAGNLIANPGCYATAALLALGPLAGEIENVVVDAKSGVSGAGKALKQSSHAGFVLENLSPYAVGAHRHAPEIAQQLGAPVCFVPHLLPVRRGLLATCYVQTEVDVRELLEDAYASSPVVRVLPDGTTPELARVQSTDGAEIGVFTDSATGTAIVICALDNLGKGAAGQAVQNANLALGLDETAGLRLHGVLV

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
153 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 1.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.93
Rhizosphere 87.22
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100008630 3300005339 Bacteria 7136
2 Ga0070658_10101882 3300005327 Bacteria 2374
3 Ga0070658_10194304 3300005327 Bacteria 1711
4 Ga0070683_100022473 3300005329 Bacteria 5636
5 Ga0070683_100067250 3300005329 Bacteria 3338
6 Ga0070680_100021204 3300005336 Bacteria 5162
7 Ga0070680_100021963 3300005336 Bacteria 5075
8 Ga0070680_100046837 3300005336 Bacteria 3518
9 Ga0070680_100081897 3300005336 Bacteria 2663
10 Ga0070680_100202653 3300005336 Bacteria 1673
11 Ga0070660_100206550 3300005339 Bacteria 1594
12 Ga0070660_100311461 3300005339 Bacteria 1292
13 Ga0070660_100380262 3300005339 Bacteria 1165
14 Ga0070661_100018310 3300005344 Bacteria 4978
15 Ga0070661_100023398 3300005344 Bacteria 4427
16 Ga0070659_100026166 3300005366 Bacteria 4487
17 Ga0070659_100120802 3300005366 Bacteria 2122
18 Ga0070667_100116634 3300005367 Bacteria 2319
19 Ga0070714_100129529 3300005435 Bacteria 2254
20 Ga0070714_100253447 3300005435 Bacteria 1628
21 Ga0070713_100008202 3300005436 Bacteria 7399
22 Ga0070713_100217313 3300005436 Bacteria 1733
23 Ga0070710_10168041 3300005437 Bacteria 1365
24 Ga0070711_100086221 3300005439 Bacteria 2251
25 Ga0070711_100086513 3300005439 Bacteria 2248
26 Ga0070711_100166310 3300005439 Bacteria 1677
27 Ga0070708_100051746 3300005445 Bacteria 3639
28 Ga0070681_10006856 3300005458 Bacteria 11085
29 Ga0070681_10016795 3300005458 Bacteria 7309
30 Ga0070681_10046517 3300005458 Bacteria 4338
31 Ga0070681_10105668 3300005458 Bacteria 2758
32 Ga0070681_10135626 3300005458 Bacteria 2392
33 Ga0070681_10166694 3300005458 Bacteria 2125
34 Ga0070681_10206035 3300005458 Bacteria 1884
35 Ga0070706_100077503 3300005467 Bacteria 3076
36 Ga0070707_100001665 3300005468 Bacteria 21503
37 Ga0070699_100323659 3300005518 Bacteria 1386
38 Ga0070679_100015519 3300005530 Bacteria 7319
39 Ga0070679_100017870 3300005530 Bacteria 6869
40 Ga0070679_100114738 3300005530 Bacteria 2679
41 Ga0070679_100134184 3300005530 Bacteria 2457
42 Ga0070679_100351974 3300005530 Bacteria 1420
43 Ga0070684_100033283 3300005535 Bacteria 4400
44 Ga0070684_100036222 3300005535 Bacteria 4227
45 Ga0070684_100372592 3300005535 Bacteria 1315
46 Ga0070697_100257492 3300005536 Bacteria 1493
47 Ga0068853_100031830 3300005539 Bacteria 4464
48 Ga0068855_100089722 3300005563 Bacteria 3549
49 Ga0068855_100156416 3300005563 Bacteria 2589
50 Ga0068855_100169656 3300005563 Bacteria 2472
51 Ga0068855_100196684 3300005563 Bacteria 2271
52 Ga0068855_100217774 3300005563 Bacteria 2143
53 Ga0068855_100227236 3300005563 Bacteria 2091
54 Ga0068855_100273103 3300005563 Bacteria 1879
55 Ga0068857_100027802 3300005577 Bacteria 4987
56 Ga0068854_100158326 3300005578 Bacteria 1752
57 Ga0068856_100024535 3300005614 Bacteria 5870
58 Ga0068856_100129605 3300005614 Bacteria 2527
59 Ga0068856_100177883 3300005614 Bacteria 2140
60 Ga0068858_100267404 3300005842 Bacteria 1626
61 Ga0081455_10216596 3300005937 Bacteria 1423
62 Ga0070717_10089396 3300006028 Bacteria 2598
63 Ga0070717_10101382 3300006028 Bacteria 2445
64 Ga0070717_10318591 3300006028 Bacteria 1385
65 Ga0075436_100070593 3300006914 Bacteria 2415
66 Ga0075435_100092173 3300007076 Bacteria 2502
67 Ga0105240_10011387 3300009093 Bacteria 12389
68 Ga0105240_10016409 3300009093 Bacteria 10027
69 Ga0105240_10484505 3300009093 Bacteria 1378
70 Ga0105241_10373969 3300009174 Bacteria 1243
71 Ga0105237_10050590 3300009545 Bacteria 4175
72 Ga0105237_10122916 3300009545 Bacteria 2590
73 Ga0105238_10029775 3300009551 Bacteria 5561
74 Ga0105239_10285465 3300010375 Bacteria 1859
75 Ga0157373_10104484 3300013100 Bacteria 1992
76 Ga0157370_10009810 3300013104 Bacteria 10154
77 Ga0157370_10040414 3300013104 Bacteria 4503
78 Ga0157370_10056545 3300013104 Bacteria 3734
79 Ga0157370_10152062 3300013104 Bacteria 2153
80 Ga0157369_10001071 3300013105 Bacteria 34352
81 Ga0157369_10008750 3300013105 Bacteria 11593
82 Ga0157369_10016070 3300013105 Bacteria 8421
83 Ga0157369_10041221 3300013105 Bacteria 5040
84 Ga0157369_10476403 3300013105 Bacteria 1292
85 Ga0157372_10045163 3300013307 Bacteria 4885
86 Ga0182008_10103423 3300014497 Bacteria 1409
87 Ga0206356_10930650 3300020070 Bacteria 8554
88 Ga0206354_11688397 3300020081 Bacteria 1541
89 Ga0206353_10177896 3300020082 Bacteria 2223
90 Ga0206353_10750580 3300020082 Bacteria 6566
91 Ga0206353_11002139 3300020082 Bacteria 2260
92 Ga0206353_11451303 3300020082 Bacteria 3727
93 Ga0207705_10031478 3300025909 Bacteria 3788
94 Ga0207705_10285384 3300025909 Bacteria 1264
95 Ga0207707_10017243 3300025912 Bacteria 6294
96 Ga0207707_10019697 3300025912 Bacteria 5889
97 Ga0207707_10082282 3300025912 Bacteria 2811
98 Ga0207707_10093506 3300025912 Bacteria 2627
99 Ga0207707_10165890 3300025912 Bacteria 1930
100 Ga0207707_10214038 3300025912 Bacteria 1678
101 Ga0207707_10304546 3300025912 Bacteria 1377
102 Ga0207693_10089269 3300025915 Bacteria 2415
103 Ga0207663_10035097 3300025916 Bacteria 3005
104 Ga0207663_10044983 3300025916 Bacteria 2713
105 Ga0207660_10026092 3300025917 Bacteria 3975
106 Ga0207660_10063735 3300025917 Bacteria 2659
107 Ga0207660_10089814 3300025917 Bacteria 2275
108 Ga0207657_10000220 3300025919 Bacteria 59453
109 Ga0207657_10001478 3300025919 Bacteria 25119
110 Ga0207657_10034915 3300025919 Bacteria 4514
111 Ga0207657_10066788 3300025919 Bacteria 3060
112 Ga0207657_10098596 3300025919 Bacteria 2428
113 Ga0207657_10152211 3300025919 Bacteria 1883
114 Ga0207657_10298909 3300025919 Bacteria 1275
115 Ga0207649_10072171 3300025920 Bacteria 2208
116 Ga0207652_10008064 3300025921 Bacteria 8454
117 Ga0207652_10072437 3300025921 Bacteria 2996
118 Ga0207652_10123576 3300025921 Bacteria 2305
119 Ga0207652_10194619 3300025921 Bacteria 1824
120 Ga0207646_10239926 3300025922 Bacteria 1638
121 Ga0207694_10128082 3300025924 Bacteria 2033
122 Ga0207700_10336304 3300025928 Bacteria 1312
123 Ga0207664_10018750 3300025929 Bacteria 5103
124 Ga0207664_10059681 3300025929 Bacteria 3039
125 Ga0207664_10472676 3300025929 Bacteria 1121
126 Ga0207690_10020074 3300025932 Bacteria 4123
127 Ga0207661_10029984 3300025944 Bacteria 4184
128 Ga0207661_10071702 3300025944 Bacteria 2832
129 Ga0207667_10103166 3300025949 Bacteria 2942
130 Ga0207667_10138198 3300025949 Bacteria 2509
131 Ga0207667_10176831 3300025949 Bacteria 2192
132 Ga0207667_10183700 3300025949 Bacteria 2147
133 Ga0207667_10215526 3300025949 Bacteria 1967
134 Ga0207667_10349713 3300025949 Bacteria 1507
135 Ga0207667_10390926 3300025949 Bacteria 1416
136 Ga0207658_10092946 3300025986 Bacteria 2344
137 Ga0207703_10147777 3300026035 Bacteria 2046
138 Ga0207639_10052526 3300026041 Bacteria 3106
139 Ga0207639_10243321 3300026041 Bacteria 1565
140 Ga0207678_10090577 3300026067 Bacteria 2614
141 Ga0207678_10119205 3300026067 Bacteria 2252
142 Ga0207678_10302461 3300026067 Bacteria 1374
143 Ga0207702_10097886 3300026078 Bacteria 2583
144 Ga0207702_10160842 3300026078 Bacteria 2050
145 Ga0207702_10303060 3300026078 Bacteria 1517
146 Ga0207702_10463190 3300026078 Bacteria 1231
147 Ga0207674_10053046 3300026116 Bacteria 4133
148 Ga0207674_10072595 3300026116 Bacteria 3457
149 Ga0207698_10167847 3300026142 Bacteria 1929
150 Ga0207698_10340537 3300026142 Bacteria 1412
151 Ga0265338_10008826 3300028800 Bacteria 12160
152 Ga0265338_10016001 3300028800 Bacteria 8196
153 Ga0265338_10047304 3300028800 Bacteria 3930
154 Ga0265330_10037143 3300031235 Bacteria 2169
155 Ga0265332_10012911 3300031238 Bacteria 3704
156 Ga0265325_10019010 3300031241 Bacteria 3806
157 Ga0265340_10054843 3300031247 Bacteria 1922
158 Ga0265339_10141853 3300031249 Bacteria 1221
159 Ga0265327_10035591 3300031251 Bacteria 2749
160 Ga0265313_10011937 3300031595 Bacteria 5359
161 Ga0265313_10017094 3300031595 Bacteria 4138
162 Ga0265314_10024414 3300031711 Bacteria 4584
163 Ga0265314_10035080 3300031711 Bacteria 3658
164 Ga0265342_10032704 3300031712 Bacteria 3206
165 Ga0265342_10099195 3300031712 Bacteria 1661
166 Ga0265342_10162911 3300031712 Bacteria 1232
167 Ga0373936_0017067 3300035113 Bacteria 2793
168 Ga0373954_0057137 3300035118 Bacteria 1838
169 Ga0373927_0010416 3300035695 Bacteria 6201
170 Ga0373947_0009840 3300035725 Bacteria 5487
171 Ga0373947_0012947 3300035725 Bacteria 4784
172 Ga0373925_0007457 3300037068 Bacteria 7977
173 Ga0395899_0222676 3300037312 Bacteria 1306
174 Ga0395900_0228319 3300037418 Bacteria 1873
175 Ga0395900_0383295 3300037418 Bacteria 1373
176 Ga0395900_0460315 3300037418 Bacteria 1227
177 Ga0395898_0005749 3300037466 Bacteria 13347
178 Ga0395898_0020761 3300037466 Bacteria 6667
179 Ga0395898_0082824 3300037466 Bacteria 3092
180 Ga0395898_0205790 3300037466 Bacteria 1878
181 Ga0395898_0274751 3300037466 Bacteria 1607
182 Ga0395901_0003165 3300038443 Bacteria 16560
183 Ga0395901_0013865 3300038443 Bacteria 8199
184 Ga0395901_0031375 3300038443 Bacteria 5480
185 Ga0395901_0044500 3300038443 Bacteria 4604
186 Ga0395901_0054371 3300038443 Bacteria 4161
187 Ga0395901_0075852 3300038443 Bacteria 3508
188 Ga0395901_0445064 3300038443 Bacteria 1326
189 Ga0436365_0551269 3300039437 Bacteria 2633
190 Ga0436360_0320361 3300039438 Bacteria 1545
191 Ga0436363_1212970 3300039450 Bacteria 3088
192 Ga0436363_1292249 3300039450 Bacteria 1123
193 Ga0466966_0032460 3300044684 Bacteria 3384
194 Ga0466966_0135142 3300044684 Bacteria 1508
195 Ga0466961_0005199 3300044693 Bacteria 8192
196 Ga0466961_0022297 3300044693 Bacteria 4074
197 Ga0466963_0002744 3300044694 Bacteria 9935
198 Ga0466963_0024890 3300044694 Bacteria 3812
199 Ga0466963_0030662 3300044694 Bacteria 3471
200 Ga0466963_0037691 3300044694 Bacteria 3159
201 Ga0466963_0066960 3300044694 Bacteria 2410
202 Ga0466971_0001989 3300044719 Bacteria 8654
203 Ga0466971_0009427 3300044719 Bacteria 4263
204 Ga0466968_0003500 3300044735 Bacteria 5806
205 Ga0466968_0096946 3300044735 Bacteria 1313
206 Ga0466957_0057033 3300044842 Bacteria 2389
207 Ga0466959_0015296 3300045049 Bacteria 5587
208 Ga0466958_0073913 3300045836 Bacteria 2088
209 Ga0466967_0001721 3300045976 Bacteria 13042
210 Ga0466967_0004710 3300045976 Bacteria 9273
211 Ga0466967_0037270 3300045976 Bacteria 4160
212 Ga0466967_0048778 3300045976 Bacteria 3700
213 Ga0466967_0061987 3300045976 Bacteria 3319
214 Ga0466967_0087871 3300045976 Bacteria 2819
215 Ga0466967_0105094 3300045976 Bacteria 2586
216 Ga0466967_0136246 3300045976 Bacteria 2283
217 Ga0466967_0256370 3300045976 Bacteria 1672
218 Ga0466967_0272530 3300045976 Bacteria 1622
219 Ga0466967_0285778 3300045976 Bacteria 1583
220 Ga0495592_0047218 3300046454 Bacteria 3207
221 Ga0495592_0091248 3300046454 Bacteria 2185
222 Ga0495592_0100692 3300046454 Bacteria 2059
223 Ga0495603_0018056 3300046455 Bacteria 4267
224 Ga0495629_0000665 3300046459 Bacteria 27803
225 Ga0495629_0033167 3300046459 Bacteria 3654
226 Ga0495629_0043628 3300046459 Bacteria 3148
227 Ga0495641_0005923 3300046461 Bacteria 8062
228 Ga0495641_0046090 3300046461 Bacteria 2006
229 Ga0495641_0049907 3300046461 Bacteria 1914
230 Ga0495651_0027880 3300046462 Bacteria 4402
231 Ga0495651_0059154 3300046462 Bacteria 2939
232 Ga0495651_0253965 3300046462 Bacteria 1199
233 Ga0495653_0018927 3300046463 Bacteria 5588
234 Ga0495653_0040690 3300046463 Bacteria 3631
235 Ga0495653_0112326 3300046463 Bacteria 1956
236 Ga0495662_0000116 3300046476 Bacteria 30019
237 Ga0495662_0029421 3300046476 Bacteria 2653
238 Ga0495664_0009644 3300046477 Bacteria 5406
239 Ga0495664_0014643 3300046477 Bacteria 4448
240 Ga0495608_0082606 3300046511 Bacteria 2086
241 Ga0495608_0119370 3300046511 Bacteria 1692
242 Ga0495618_0028676 3300046514 Bacteria 3470
243 Ga0495618_0124825 3300046514 Bacteria 1648
244 Ga0495628_0073582 3300046516 Bacteria 2662
245 Ga0495628_0115103 3300046516 Bacteria 2065
246 Ga0495628_0115846 3300046516 Bacteria 2058
247 Ga0495628_0284174 3300046516 Unclassified 1228
248 Ga0495630_0004843 3300046517 Bacteria 9443
249 Ga0495630_0133254 3300046517 Bacteria 1887
250 Ga0495652_0042623 3300046529 Bacteria 3912
251 Ga0495652_0046982 3300046529 Bacteria 3704
252 Ga0495652_0073817 3300046529 Bacteria 2839
253 Ga0495652_0109253 3300046529 Bacteria 2227
254 Ga0495665_0004522 3300046531 Bacteria 7506
255 Ga0495640_0007990 3300046533 Bacteria 8315
256 Ga0495640_0155426 3300046533 Bacteria 1468
257 Ga0495587_0021913 3300046536 Bacteria 3939
258 Ga0495667_0052985 3300046559 Bacteria 2672
259 Ga0495634_0018522 3300046642 Bacteria 4957
260 Ga0495634_0077979 3300046642 Bacteria 2171
261 Ga0495635_0007372 3300046663 Bacteria 7674
262 Ga0495635_0237752 3300046663 Bacteria 1229
263 Ga0495599_0074085 3300046678 Bacteria 2125
264 Ga0495599_0212013 3300046678 Unclassified 1187
265 Ga0495623_0042470 3300046679 Bacteria 2896
266 Ga0495646_0068236 3300046680 Bacteria 2100
267 Ga0495646_0079645 3300046680 Bacteria 1912
268 Ga0495658_0003106 3300046683 Bacteria 8290
269 Ga0495658_0036820 3300046683 Bacteria 2702
270 Ga0495613_0007454 3300046689 Bacteria 8152
271 Ga0495613_0113327 3300046689 Bacteria 1952
272 Ga0495600_0013447 3300046809 Bacteria 5144
273 Ga0495581_0002081 3300047315 Bacteria 11262
274 Ga0495674_0014116 3300047319 Bacteria 7482
275 Ga0495674_0028845 3300047319 Bacteria 5056
276 Ga0495680_0001597 3300047322 Bacteria 24161
277 Ga0495680_0006465 3300047322 Bacteria 10877
278 Ga0495675_0058939 3300047444 Bacteria 2434
279 Ga0495675_0119876 3300047444 Bacteria 1639
280 Ga0495684_0007129 3300047471 Bacteria 8673
281 Ga0495684_0033338 3300047471 Bacteria 3951
282 Ga0495684_0042817 3300047471 Bacteria 3467
283 Ga0495684_0068936 3300047471 Bacteria 2689
284 Ga0495684_0193862 3300047471 Bacteria 1501
285 Ga0495593_0047612 3300047673 Bacteria 2280
286 Ga0495602_0121721 3300048088 Bacteria 2098
287 Ga0495602_0153729 3300048088 Bacteria 1805
288 Ga0496100_0010210 3300048903 Bacteria 5310
289 Ga0496100_0031810 3300048903 Bacteria 3284
290 Ga0496100_0083635 3300048903 Bacteria 2161
291 Ga0496100_0114416 3300048903 Bacteria 1879
292 Ga0496100_0239990 3300048903 Bacteria 1337
293 Ga0496100_0263244 3300048903 Bacteria 1279
294 Ga0496101_0008746 3300048904 Bacteria 6623
295 Ga0496101_0068526 3300048904 Bacteria 2594
296 Ga0496101_0125822 3300048904 Bacteria 1942
297 Ga0496102_0169824 3300048905 Bacteria 2053
298 Ga0496102_0221345 3300048905 Bacteria 1784
299 Ga0496102_0460591 3300048905 Bacteria 1192
300 Ga0496102_0481289 3300048905 Bacteria 1163
301 Ga0496103_0232761 3300048906 Bacteria 1185
302 Ga0496104_0179022 3300048907 Bacteria 2030
303 Ga0496105_0012543 3300048908 Bacteria 6712
304 Ga0496105_0026913 3300048908 Bacteria 4694
305 Ga0496105_0029749 3300048908 Bacteria 4472
306 Ga0496105_0147222 3300048908 Bacteria 1936
307 Ga0496106_0000302 3300048909 Bacteria 34606
308 Ga0496106_0100643 3300048909 Bacteria 2241
309 Ga0496107_0009933 3300048910 Bacteria 6605
310 Ga0496107_0014825 3300048910 Bacteria 5457
311 Ga0496107_0058286 3300048910 Bacteria 2792
312 Ga0496108_0047222 3300048911 Bacteria 3599
313 Ga0496109_0027412 3300048912 Bacteria 5085
314 Ga0496110_0033392 3300048913 Bacteria 4451
315 Ga0496111_0022436 3300048914 Bacteria 4420
316 Ga0496112_0007327 3300048915 Bacteria 9786
317 Ga0496112_0031244 3300048915 Bacteria 5163
318 Ga0496112_0081613 3300048915 Bacteria 3198
319 Ga0496112_0107603 3300048915 Bacteria 2758
320 Ga0496112_0574166 3300048915 Bacteria 1060
321 Ga0496113_0022085 3300048916 Bacteria 4496
322 Ga0496113_0405824 3300048916 Bacteria 1094
323 Ga0496114_0010884 3300048917 Bacteria 7248
324 Ga0496114_0014778 3300048917 Bacteria 6275
325 Ga0496114_0023573 3300048917 Bacteria 5024
326 Ga0496114_0024245 3300048917 Bacteria 4950
327 Ga0496114_0193417 3300048917 Bacteria 1780
328 Ga0496115_0001139 3300048918 Bacteria 19188
329 Ga0496115_0008270 3300048918 Bacteria 7690
330 Ga0501047_0056154 3300049581 Bacteria 3807
331 Ga0501047_0190738 3300049581 Bacteria 1913
332 Ga0501067_0019783 3300049583 Bacteria 3726
333 Ga0501067_0081995 3300049583 Bacteria 1788
334 Ga0501068_0298645 3300049584 Bacteria 1031
335 Ga0501069_0001355 3300049585 Bacteria 12016
336 Ga0501070_0004258 3300049586 Bacteria 12303
337 Ga0501070_0047688 3300049586 Bacteria 3560
338 Ga0501070_0172150 3300049586 Bacteria 1783
339 Ga0501070_0217762 3300049586 Bacteria 1566
340 Ga0501073_0267345 3300049589 Bacteria 1180
341 Ga0501080_0060971 3300049742 Bacteria 3512
342 Ga0495601_0029378 3300053077 Bacteria 3410
343 Ga0495601_0037229 3300053077 Bacteria 3041
344 Ga0495601_0058040 3300053077 Bacteria 2452
345 Ga0495601_0097377 3300053077 Bacteria 1898
346 Ga0495612_0086951 3300053078 Bacteria 1319
347 Ga0495595_0005765 3300053084 Bacteria 5015
348 Ga0495619_0004194 3300053085 Bacteria 9197
349 Ga0495619_0021883 3300053085 Bacteria 4086
350 Ga0495619_0026047 3300053085 Bacteria 3760
351 Ga0495619_0207342 3300053085 Bacteria 1357
352 Ga0530510_0089830 3300061734 Bacteria 2240
353 Ga0070660_100008630
354 Ga0070658_10101882
355 Ga0070658_10194304
356 Ga0070683_100022473
357 Ga0070683_100067250
358 Ga0070680_100021204
359 Ga0070680_100021963
360 Ga0070680_100046837
361 Ga0070680_100081897
362 Ga0070680_100202653
363 Ga0070660_100206550
364 Ga0070660_100311461
365 Ga0070660_100380262
366 Ga0070661_100018310
367 Ga0070661_100023398
368 Ga0070659_100026166
369 Ga0070659_100120802
370 Ga0070667_100116634
371 Ga0070714_100129529
372 Ga0070714_100253447
373 Ga0070713_100008202
374 Ga0070713_100217313
375 Ga0070710_10168041
376 Ga0070711_100086221
377 Ga0070711_100086513
378 Ga0070711_100166310
379 Ga0070708_100051746
380 Ga0070681_10006856
381 Ga0070681_10016795
382 Ga0070681_10046517
383 Ga0070681_10105668
384 Ga0070681_10135626
385 Ga0070681_10166694
386 Ga0070681_10206035
387 Ga0070706_100077503
388 Ga0070707_100001665
389 Ga0070699_100323659
390 Ga0070679_100015519
391 Ga0070679_100017870
392 Ga0070679_100114738
393 Ga0070679_100134184
394 Ga0070679_100351974
395 Ga0070684_100033283
396 Ga0070684_100036222
397 Ga0070684_100372592
398 Ga0070697_100257492
399 Ga0068853_100031830
400 Ga0068855_100089722
401 Ga0068855_100156416
402 Ga0068855_100169656
403 Ga0068855_100196684
404 Ga0068855_100217774
405 Ga0068855_100227236
406 Ga0068855_100273103
407 Ga0068857_100027802
408 Ga0068854_100158326
409 Ga0068856_100024535
410 Ga0068856_100129605
411 Ga0068856_100177883
412 Ga0068858_100267404
413 Ga0081455_10216596
414 Ga0070717_10089396
415 Ga0070717_10101382
416 Ga0070717_10318591
417 Ga0075436_100070593
418 Ga0075435_100092173
419 Ga0105240_10011387
420 Ga0105240_10016409
421 Ga0105240_10484505
422 Ga0105241_10373969
423 Ga0105237_10050590
424 Ga0105237_10122916
425 Ga0105238_10029775
426 Ga0105239_10285465
427 Ga0157373_10104484
428 Ga0157370_10009810
429 Ga0157370_10040414
430 Ga0157370_10056545
431 Ga0157370_10152062
432 Ga0157369_10001071
433 Ga0157369_10008750
434 Ga0157369_10016070
435 Ga0157369_10041221
436 Ga0157369_10476403
437 Ga0157372_10045163
438 Ga0182008_10103423
439 Ga0206356_10930650
440 Ga0206354_11688397
441 Ga0206353_10177896
442 Ga0206353_10750580
443 Ga0206353_11002139
444 Ga0206353_11451303
445 Ga0207705_10031478
446 Ga0207705_10285384
447 Ga0207707_10017243
448 Ga0207707_10019697
449 Ga0207707_10082282
450 Ga0207707_10093506
451 Ga0207707_10165890
452 Ga0207707_10214038
453 Ga0207707_10304546
454 Ga0207693_10089269
455 Ga0207663_10035097
456 Ga0207663_10044983
457 Ga0207660_10026092
458 Ga0207660_10063735
459 Ga0207660_10089814
460 Ga0207657_10000220
461 Ga0207657_10001478
462 Ga0207657_10034915
463 Ga0207657_10066788
464 Ga0207657_10098596
465 Ga0207657_10152211
466 Ga0207657_10298909
467 Ga0207649_10072171
468 Ga0207652_10008064
469 Ga0207652_10072437
470 Ga0207652_10123576
471 Ga0207652_10194619
472 Ga0207646_10239926
473 Ga0207694_10128082
474 Ga0207700_10336304
475 Ga0207664_10018750
476 Ga0207664_10059681
477 Ga0207664_10472676
478 Ga0207690_10020074
479 Ga0207661_10029984
480 Ga0207661_10071702
481 Ga0207667_10103166
482 Ga0207667_10138198
483 Ga0207667_10176831
484 Ga0207667_10183700
485 Ga0207667_10215526
486 Ga0207667_10349713
487 Ga0207667_10390926
488 Ga0207658_10092946
489 Ga0207703_10147777
490 Ga0207639_10052526
491 Ga0207639_10243321
492 Ga0207678_10090577
493 Ga0207678_10119205
494 Ga0207678_10302461
495 Ga0207702_10097886
496 Ga0207702_10160842
497 Ga0207702_10303060
498 Ga0207702_10463190
499 Ga0207674_10053046
500 Ga0207674_10072595
501 Ga0207698_10167847
502 Ga0207698_10340537
503 Ga0265338_10008826
504 Ga0265338_10016001
505 Ga0265338_10047304
506 Ga0265330_10037143
507 Ga0265332_10012911
508 Ga0265325_10019010
509 Ga0265340_10054843
510 Ga0265339_10141853
511 Ga0265327_10035591
512 Ga0265313_10011937
513 Ga0265313_10017094
514 Ga0265314_10024414
515 Ga0265314_10035080
516 Ga0265342_10032704
517 Ga0265342_10099195
518 Ga0265342_10162911
519 Ga0373936_0017067
520 Ga0373954_0057137
521 Ga0373927_0010416
522 Ga0373947_0009840
523 Ga0373947_0012947
524 Ga0373925_0007457
525 Ga0395899_0222676
526 Ga0395900_0228319
527 Ga0395900_0383295
528 Ga0395900_0460315
529 Ga0395898_0005749
530 Ga0395898_0020761
531 Ga0395898_0082824
532 Ga0395898_0205790
533 Ga0395898_0274751
534 Ga0395901_0003165
535 Ga0395901_0013865
536 Ga0395901_0031375
537 Ga0395901_0044500
538 Ga0395901_0054371
539 Ga0395901_0075852
540 Ga0395901_0445064
541 Ga0436365_0551269
542 Ga0436360_0320361
543 Ga0436363_1212970
544 Ga0436363_1292249
545 Ga0466966_0032460
546 Ga0466966_0135142
547 Ga0466961_0005199
548 Ga0466961_0022297
549 Ga0466963_0002744
550 Ga0466963_0024890
551 Ga0466963_0030662
552 Ga0466963_0037691
553 Ga0466963_0066960
554 Ga0466971_0001989
555 Ga0466971_0009427
556 Ga0466968_0003500
557 Ga0466968_0096946
558 Ga0466957_0057033
559 Ga0466959_0015296
560 Ga0466958_0073913
561 Ga0466967_0001721
562 Ga0466967_0004710
563 Ga0466967_0037270
564 Ga0466967_0048778
565 Ga0466967_0061987
566 Ga0466967_0087871
567 Ga0466967_0105094
568 Ga0466967_0136246
569 Ga0466967_0256370
570 Ga0466967_0272530
571 Ga0466967_0285778
572 Ga0495592_0047218
573 Ga0495592_0091248
574 Ga0495592_0100692
575 Ga0495603_0018056
576 Ga0495629_0000665
577 Ga0495629_0033167
578 Ga0495629_0043628
579 Ga0495641_0005923
580 Ga0495641_0046090
581 Ga0495641_0049907
582 Ga0495651_0027880
583 Ga0495651_0059154
584 Ga0495651_0253965
585 Ga0495653_0018927
586 Ga0495653_0040690
587 Ga0495653_0112326
588 Ga0495662_0000116
589 Ga0495662_0029421
590 Ga0495664_0009644
591 Ga0495664_0014643
592 Ga0495608_0082606
593 Ga0495608_0119370
594 Ga0495618_0028676
595 Ga0495618_0124825
596 Ga0495628_0073582
597 Ga0495628_0115103
598 Ga0495628_0115846
599 Ga0495628_0284174
600 Ga0495630_0004843
601 Ga0495630_0133254
602 Ga0495652_0042623
603 Ga0495652_0046982
604 Ga0495652_0073817
605 Ga0495652_0109253
606 Ga0495665_0004522
607 Ga0495640_0007990
608 Ga0495640_0155426
609 Ga0495587_0021913
610 Ga0495667_0052985
611 Ga0495634_0018522
612 Ga0495634_0077979
613 Ga0495635_0007372
614 Ga0495635_0237752
615 Ga0495599_0074085
616 Ga0495599_0212013
617 Ga0495623_0042470
618 Ga0495646_0068236
619 Ga0495646_0079645
620 Ga0495658_0003106
621 Ga0495658_0036820
622 Ga0495613_0007454
623 Ga0495613_0113327
624 Ga0495600_0013447
625 Ga0495581_0002081
626 Ga0495674_0014116
627 Ga0495674_0028845
628 Ga0495680_0001597
629 Ga0495680_0006465
630 Ga0495675_0058939
631 Ga0495675_0119876
632 Ga0495684_0007129
633 Ga0495684_0033338
634 Ga0495684_0042817
635 Ga0495684_0068936
636 Ga0495684_0193862
637 Ga0495593_0047612
638 Ga0495602_0121721
639 Ga0495602_0153729
640 Ga0496100_0010210
641 Ga0496100_0031810
642 Ga0496100_0083635
643 Ga0496100_0114416
644 Ga0496100_0239990
645 Ga0496100_0263244
646 Ga0496101_0008746
647 Ga0496101_0068526
648 Ga0496101_0125822
649 Ga0496102_0169824
650 Ga0496102_0221345
651 Ga0496102_0460591
652 Ga0496102_0481289
653 Ga0496103_0232761
654 Ga0496104_0179022
655 Ga0496105_0012543
656 Ga0496105_0026913
657 Ga0496105_0029749
658 Ga0496105_0147222
659 Ga0496106_0000302
660 Ga0496106_0100643
661 Ga0496107_0009933
662 Ga0496107_0014825
663 Ga0496107_0058286
664 Ga0496108_0047222
665 Ga0496109_0027412
666 Ga0496110_0033392
667 Ga0496111_0022436
668 Ga0496112_0007327
669 Ga0496112_0031244
670 Ga0496112_0081613
671 Ga0496112_0107603
672 Ga0496112_0574166
673 Ga0496113_0022085
674 Ga0496113_0405824
675 Ga0496114_0010884
676 Ga0496114_0014778
677 Ga0496114_0023573
678 Ga0496114_0024245
679 Ga0496114_0193417
680 Ga0496115_0001139
681 Ga0496115_0008270
682 Ga0501047_0056154
683 Ga0501047_0190738
684 Ga0501067_0019783
685 Ga0501067_0081995
686 Ga0501068_0298645
687 Ga0501069_0001355
688 Ga0501070_0004258
689 Ga0501070_0047688
690 Ga0501070_0172150
691 Ga0501070_0217762
692 Ga0501073_0267345
693 Ga0501080_0060971
694 Ga0495601_0029378
695 Ga0495601_0037229
696 Ga0495601_0058040
697 Ga0495601_0097377
698 Ga0495612_0086951
699 Ga0495595_0005765
700 Ga0495619_0004194
701 Ga0495619_0021883
702 Ga0495619_0026047
703 Ga0495619_0207342
704 Ga0530510_0089830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

204

353

0.98

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

213

356

0.93

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

71

198

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.8914 2 317
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.8853 1 317
7npj-assembly2.cif.gz_F crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine 0.8837 2 317
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.8809 2 317
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8798 4 312
ID Description Score Start End Superfamily
af_Q93Z70_59_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8768 4 134 3.40.50.720
af_Q2G1H4_5_166_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8661 7 151 3.40.50.720
af_P9WPZ9_6_155_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8564 2 125 3.40.50.720
af_Q2G1H4_2_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8521 4 135 3.40.50.720
af_P9WPZ9_10_289_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8453 4 256 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6I3G015-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9702 234 312
AF-A0A353TVG2-F1-model_v4 deleted 0.9654 232 317
AF-A0A349AYU2-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9551 232 317
AF-M1X4F9-F1-model_v4 deleted 0.9548 231 317
AF-A0A7G1IFY7-F1-model_v4 Uncharacterized protein 0.9439 223 317

Map