F418809

General Info

Members Datasets Scaffolds Average Seq Length
351 198 702 127

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0222451|Ga0501076_0222451_855_1292
Length 128
Sequence MNRLSFDVDIGGKSDMNLVLWILQVILALAFLAHGWLFLAPPPEIAELMNASLPRWFQLFLGVAEWLITWAAVGIMMVTISATVYHVARSEWSSALITLLLFVMAAFLAYMRHQIPILPRRGRTPVAG

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
151 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0
Rhizoplane 1.14
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 37.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0222451 3300049592 Unclassified 1543
2 Ga0065712_10014534 3300005290 Bacteria 2771
3 Ga0065712_10098382 3300005290 Bacteria 2121
4 Ga0065715_10008698 3300005293 Bacteria 4504
5 Ga0065715_10016320 3300005293 Bacteria 1921
6 Ga0065715_10115015 3300005293 Bacteria 2430
7 Ga0065715_10856763 3300005293 Bacteria 589
8 Ga0070658_10059393 3300005327 Bacteria 3114
9 Ga0070676_10068105 3300005328 Unclassified 2130
10 Ga0070690_100186016 3300005330 Bacteria 1437
11 Ga0070690_100391173 3300005330 Bacteria 1019
12 Ga0070670_100273549 3300005331 Unclassified 1474
13 Ga0070677_10076803 3300005333 Bacteria 1419
14 Ga0070677_10120890 3300005333 Unclassified 1183
15 Ga0070677_10909219 3300005333 Unclassified 509
16 Ga0068869_100135970 3300005334 Unclassified 1894
17 Ga0070666_10069190 3300005335 Unclassified 2400
18 Ga0070660_100102071 3300005339 Bacteria 2273
19 Ga0070660_100118628 3300005339 Bacteria 2110
20 Ga0070689_100107326 3300005340 Unclassified 2217
21 Ga0070689_100523244 3300005340 Bacteria 1019
22 Ga0070689_101623408 3300005340 Bacteria 587
23 Ga0070691_10069597 3300005341 Bacteria 1706
24 Ga0070687_100338892 3300005343 Unclassified 966
25 Ga0070661_101097445 3300005344 Unclassified 663
26 Ga0070668_100122560 3300005347 Unclassified 2079
27 Ga0070669_100045269 3300005353 Bacteria 3206
28 Ga0070669_100047096 3300005353 Bacteria 3145
29 Ga0070669_100098383 3300005353 Bacteria 2203
30 Ga0070675_100000308 3300005354 Bacteria 32848
31 Ga0070675_100058788 3300005354 Bacteria 3171
32 Ga0070675_100172663 3300005354 Bacteria 1865
33 Ga0070675_100385029 3300005354 Unclassified 1249
34 Ga0070671_100010169 3300005355 Bacteria 7551
35 Ga0070674_101360458 3300005356 Unclassified 635
36 Ga0070673_100003053 3300005364 Bacteria 10361
37 Ga0070673_101493228 3300005364 Unclassified 637
38 Ga0070673_101765601 3300005364 Bacteria 586
39 Ga0070688_100978406 3300005365 Unclassified 671
40 Ga0070688_101809554 3300005365 Unclassified 501
41 Ga0070659_100047974 3300005366 Unclassified 3353
42 Ga0070701_10119365 3300005438 Unclassified 1484
43 Ga0070705_100274894 3300005440 Unclassified 1195
44 Ga0070705_100280775 3300005440 Bacteria 1184
45 Ga0070705_100340664 3300005440 Bacteria 1090
46 Ga0070700_100013776 3300005441 Bacteria 4549
47 Ga0070700_100394178 3300005441 Bacteria 1039
48 Ga0070700_100402293 3300005441 Unclassified 1030
49 Ga0070700_101472883 3300005441 Unclassified 578
50 Ga0070694_100144412 3300005444 Unclassified 1732
51 Ga0070694_100956670 3300005444 Unclassified 709
52 Ga0070694_101563501 3300005444 Unclassified 559
53 Ga0070708_100800359 3300005445 Unclassified 886
54 Ga0070678_100778163 3300005456 Unclassified 867
55 Ga0070678_101081491 3300005456 Bacteria 740
56 Ga0070662_100048225 3300005457 Bacteria 3068
57 Ga0070662_100076381 3300005457 Unclassified 2483
58 Ga0070681_10162758 3300005458 Unclassified 2155
59 Ga0068867_100027944 3300005459 Bacteria 4058
60 Ga0068867_101111149 3300005459 Unclassified 722
61 Ga0070706_100951209 3300005467 Unclassified 793
62 Ga0070706_100991107 3300005467 Unclassified 775
63 Ga0070707_100121618 3300005468 Bacteria 2535
64 Ga0070698_100007777 3300005471 Bacteria 11602
65 Ga0070697_100090099 3300005536 Bacteria 2534
66 Ga0068853_101679317 3300005539 Unclassified 616
67 Ga0070672_100004659 3300005543 Bacteria 8991
68 Ga0070672_100620534 3300005543 Bacteria 943
69 Ga0070686_100453352 3300005544 Unclassified 986
70 Ga0070686_100788921 3300005544 Bacteria 765
71 Ga0070695_100025573 3300005545 Unclassified 3647
72 Ga0070695_100429857 3300005545 Unclassified 1007
73 Ga0070695_100634588 3300005545 Unclassified 842
74 Ga0070695_100750763 3300005545 Unclassified 778
75 Ga0070693_100043847 3300005547 Unclassified 2528
76 Ga0070693_100255441 3300005547 Unclassified 1163
77 Ga0070665_100003140 3300005548 Bacteria 17787
78 Ga0070704_100118315 3300005549 Bacteria 2030
79 Ga0068855_100166134 3300005563 Bacteria 2501
80 Ga0070664_101037379 3300005564 Bacteria 771
81 Ga0068854_100181476 3300005578 Unclassified 1644
82 Ga0070702_100017923 3300005615 Unclassified 3662
83 Ga0068852_100200872 3300005616 Bacteria 1887
84 Ga0068859_100061847 3300005617 Bacteria 3773
85 Ga0068864_101677990 3300005618 Bacteria 640
86 Ga0068861_100704302 3300005719 Bacteria 939
87 Ga0068861_100705659 3300005719 Bacteria 938
88 Ga0068870_10933427 3300005840 Unclassified 615
89 Ga0068863_100372273 3300005841 Bacteria 1394
90 Ga0068858_100044540 3300005842 Bacteria 4112
91 Ga0068858_100833722 3300005842 Bacteria 900
92 Ga0068858_100916452 3300005842 Unclassified 857
93 Ga0068860_100926753 3300005843 Bacteria 888
94 Ga0068860_101751436 3300005843 Bacteria 643
95 Ga0068862_100006232 3300005844 Bacteria 9932
96 Ga0068862_100022908 3300005844 Bacteria 5228
97 Ga0068862_100077441 3300005844 Unclassified 2879
98 Ga0068862_101175449 3300005844 Unclassified 765
99 Ga0075365_10118266 3300006038 Bacteria 1826
100 Ga0075367_10009559 3300006178 Bacteria 5073
101 Ga0075367_10130982 3300006178 Bacteria 1550
102 Ga0075369_10545921 3300006186 Unclassified 553
103 Ga0075366_10002492 3300006195 Bacteria 9444
104 Ga0075370_10028310 3300006353 Unclassified 3114
105 Ga0075370_10823301 3300006353 Unclassified 566
106 Ga0068871_100229401 3300006358 Bacteria 1611
107 Ga0075428_100161007 3300006844 Bacteria 2436
108 Ga0075428_100203217 3300006844 Bacteria 2141
109 Ga0075428_100576668 3300006844 Bacteria 1202
110 Ga0075428_100970496 3300006844 Viruses 900
111 Ga0075428_100996642 3300006844 Bacteria 887
112 Ga0075430_100757908 3300006846 Bacteria 800
113 Ga0075430_100797618 3300006846 Bacteria 778
114 Ga0075431_100117182 3300006847 Bacteria 2748
115 Ga0075431_100238447 3300006847 Bacteria 1851
116 Ga0075431_100552849 3300006847 Bacteria 1138
117 Ga0075431_100667399 3300006847 Bacteria 1019
118 Ga0075433_10037357 3300006852 Bacteria 4190
119 Ga0075433_10278275 3300006852 Bacteria 1483
120 Ga0075434_100000372 3300006871 Bacteria 32615
121 Ga0075434_100027777 3300006871 Bacteria 5556
122 Ga0075434_100037722 3300006871 Bacteria 4784
123 Ga0075434_100051333 3300006871 Bacteria 4099
124 Ga0075434_101992739 3300006871 Unclassified 586
125 Ga0075429_100013757 3300006880 Bacteria 7016
126 Ga0075429_100017795 3300006880 Bacteria 6147
127 Ga0075429_100332042 3300006880 Bacteria 1331
128 Ga0075429_100855479 3300006880 Bacteria 796
129 Ga0068865_100107859 3300006881 Bacteria 2049
130 Ga0075436_100024045 3300006914 Bacteria 4188
131 Ga0075436_100067025 3300006914 Bacteria 2481
132 Ga0075436_100522988 3300006914 Bacteria 869
133 Ga0097620_100061847 3300006931 Bacteria 3773
134 Ga0075435_100009558 3300007076 Bacteria 7031
135 Ga0075435_100064067 3300007076 Bacteria 2986
136 Ga0075435_100072616 3300007076 Bacteria 2811
137 Ga0105240_10037082 3300009093 Bacteria 6267
138 Ga0111539_10157032 3300009094 Bacteria 2662
139 Ga0111539_10356959 3300009094 Bacteria 1701
140 Ga0111539_10383485 3300009094 Bacteria 1636
141 Ga0111539_10504203 3300009094 Viruses 1410
142 Ga0111539_10622263 3300009094 Bacteria 1257
143 Ga0111539_10709990 3300009094 Bacteria 1170
144 Ga0105245_10378798 3300009098 Bacteria 1409
145 Ga0105245_10754024 3300009098 Bacteria 1009
146 Ga0105247_10788468 3300009101 Unclassified 724
147 Ga0114129_10014461 3300009147 Bacteria 11246
148 Ga0114129_10046184 3300009147 Bacteria 6122
149 Ga0114129_10122889 3300009147 Bacteria 3572
150 Ga0114129_10260805 3300009147 Unclassified 2323
151 Ga0114129_10338203 3300009147 Bacteria 1997
152 Ga0114129_12060252 3300009147 Unclassified 689
153 Ga0105243_10216157 3300009148 Unclassified 1691
154 Ga0105242_10423659 3300009176 Bacteria 1248
155 Ga0105248_10023052 3300009177 Bacteria 6914
156 Ga0105248_10302132 3300009177 Bacteria 1802
157 Ga0105248_10539791 3300009177 Bacteria 1315
158 Ga0105238_10089377 3300009551 Bacteria 3067
159 Ga0105238_10290400 3300009551 Unclassified 1617
160 Ga0105238_12712717 3300009551 Bacteria 532
161 Ga0105249_10150649 3300009553 Unclassified 2239
162 Ga0105249_10518572 3300009553 Bacteria 1239
163 Ga0105249_11254168 3300009553 Bacteria 813
164 Ga0105249_11682729 3300009553 Bacteria 707
165 Ga0105239_10486108 3300010375 Bacteria 1403
166 Ga0163162_12572971 3300013306 Unclassified 585
167 Ga0157372_11896803 3300013307 Unclassified 685
168 Ga0157375_10065968 3300013308 Bacteria 3611
169 Ga0157375_10646322 3300013308 Bacteria 1214
170 Ga0157375_13144710 3300013308 Unclassified 551
171 Ga0163163_10708925 3300014325 Bacteria 1070
172 Ga0157380_10129907 3300014326 Bacteria 2147
173 Ga0157380_12627227 3300014326 Unclassified 570
174 Ga0157377_10670007 3300014745 Unclassified 749
175 Ga0207682_10113250 3300025893 Unclassified 1196
176 Ga0207682_10230705 3300025893 Bacteria 858
177 Ga0207688_10338510 3300025901 Unclassified 925
178 Ga0207688_11042200 3300025901 Bacteria 517
179 Ga0207680_10272066 3300025903 Bacteria 1175
180 Ga0207705_10097826 3300025909 Bacteria 2156
181 Ga0207654_10101645 3300025911 Bacteria 1772
182 Ga0207707_10109772 3300025912 Bacteria 2411
183 Ga0207707_10243473 3300025912 Unclassified 1563
184 Ga0207662_10025026 3300025918 Unclassified 3437
185 Ga0207662_10688276 3300025918 Bacteria 716
186 Ga0207657_10010747 3300025919 Bacteria 9114
187 Ga0207657_10143380 3300025919 Unclassified 1950
188 Ga0207652_11860463 3300025921 Unclassified 507
189 Ga0207646_10379982 3300025922 Bacteria 1276
190 Ga0207681_10514671 3300025923 Bacteria 981
191 Ga0207681_10720666 3300025923 Bacteria 830
192 Ga0207694_10328767 3300025924 Unclassified 1263
193 Ga0207694_10615075 3300025924 Unclassified 914
194 Ga0207650_10359925 3300025925 Unclassified 1198
195 Ga0207659_10000417 3300025926 Bacteria 25664
196 Ga0207659_10145654 3300025926 Bacteria 1844
197 Ga0207659_10512420 3300025926 Unclassified 1016
198 Ga0207687_10131024 3300025927 Bacteria 1890
199 Ga0207644_10080601 3300025931 Unclassified 2404
200 Ga0207706_10042655 3300025933 Bacteria 4021
201 Ga0207706_10095212 3300025933 Bacteria 2619
202 Ga0207706_10201506 3300025933 Unclassified 1746
203 Ga0207686_10535641 3300025934 Bacteria 913
204 Ga0207709_10034629 3300025935 Unclassified 2978
205 Ga0207670_10522887 3300025936 Bacteria 966
206 Ga0207669_10024470 3300025937 Bacteria 3246
207 Ga0207691_10010646 3300025940 Bacteria 8826
208 Ga0207691_10077300 3300025940 Bacteria 2999
209 Ga0207691_10318301 3300025940 Bacteria 1334
210 Ga0207711_10024401 3300025941 Bacteria 5065
211 Ga0207711_11596570 3300025941 Unclassified 596
212 Ga0207689_10061373 3300025942 Bacteria 3091
213 Ga0207661_11148653 3300025944 Unclassified 715
214 Ga0207679_10649391 3300025945 Unclassified 954
215 Ga0207679_11003357 3300025945 Bacteria 765
216 Ga0207667_10108485 3300025949 Bacteria 2864
217 Ga0207651_10002569 3300025960 Bacteria 8676
218 Ga0207651_10458545 3300025960 Bacteria 1095
219 Ga0207651_11206746 3300025960 Unclassified 679
220 Ga0207712_10693264 3300025961 Unclassified 888
221 Ga0207668_10039846 3300025972 Bacteria 3166
222 Ga0207640_10043629 3300025981 Unclassified 2867
223 Ga0207703_10350178 3300026035 Unclassified 1360
224 Ga0207678_11443780 3300026067 Unclassified 608
225 Ga0207708_10061373 3300026075 Unclassified 2870
226 Ga0207708_10199703 3300026075 Bacteria 1595
227 Ga0207708_10276862 3300026075 Unclassified 1359
228 Ga0207708_10887480 3300026075 Bacteria 771
229 Ga0207708_11298663 3300026075 Unclassified 637
230 Ga0207641_10340529 3300026088 Unclassified 1427
231 Ga0207648_10002325 3300026089 Bacteria 20507
232 Ga0207648_11280851 3300026089 Bacteria 689
233 Ga0207648_11593508 3300026089 Unclassified 614
234 Ga0207675_100053877 3300026118 Bacteria 3753
235 Ga0207675_100197502 3300026118 Bacteria 1931
236 Ga0207675_100472108 3300026118 Unclassified 1246
237 Ga0207675_100987155 3300026118 Bacteria 860
238 Ga0207683_10508189 3300026121 Unclassified 1113
239 Ga0207683_10924575 3300026121 Unclassified 810
240 Ga0207683_11597240 3300026121 Bacteria 601
241 Ga0209971_1050730 3300027682 Bacteria 1003
242 Ga0207428_10019731 3300027907 Bacteria 5744
243 Ga0207428_10020232 3300027907 Bacteria 5658
244 Ga0207428_10674415 3300027907 Bacteria 741
245 Ga0268266_10078345 3300028379 Bacteria 2875
246 Ga0268265_10060411 3300028380 Bacteria 2904
247 Ga0268265_10079053 3300028380 Unclassified 2589
248 Ga0268265_10122400 3300028380 Unclassified 2146
249 Ga0268265_10140356 3300028380 Bacteria 2022
250 Ga0307511_10148130 3300030521 Bacteria 1356
251 Ga0307408_100550481 3300031548 Bacteria 1018
252 Ga0307408_101914452 3300031548 Unclassified 569
253 Ga0307405_10258963 3300031731 Unclassified 1298
254 Ga0307410_10147819 3300031852 Bacteria 1746
255 Ga0307406_11214856 3300031901 Unclassified 655
256 Ga0307412_12278103 3300031911 Bacteria 505
257 Ga0307409_102055915 3300031995 Bacteria 601
258 Ga0307416_100005417 3300032002 Bacteria 7833
259 Ga0307416_100174325 3300032002 Unclassified 2007
260 Ga0307416_100183717 3300032002 Bacteria 1963
261 Ga0307414_10105975 3300032004 Bacteria 2127
262 Ga0307411_10304782 3300032005 Bacteria 1279
263 Ga0307415_101043589 3300032126 Unclassified 762
264 Ga0307415_102395013 3300032126 Unclassified 519
265 Ga0373943_0997555 3300035170 Bacteria 502
266 Ga0373955_0738221 3300035172 Bacteria 605
267 Ga0373931_0406436 3300035691 Unclassified 863
268 Ga0373927_0809765 3300035695 Bacteria 619
269 Ga0373947_0884842 3300035725 Bacteria 610
270 Ga0373925_0385275 3300037068 Bacteria 1142
271 Ga0395900_1619939 3300037418 Unclassified 559
272 Ga0439453_0094550 3300041408 Unclassified 660
273 Ga0450905_055137 3300042142 Unclassified 655
274 Ga0439446_0127378 3300042156 Bacteria 824
275 Ga0439434_0360719 3300042435 Unclassified 508
276 Ga0439460_0188026 3300042461 Unclassified 700
277 Ga0439460_0369025 3300042461 Unclassified 507
278 Ga0451576_1220271 3300045051 Bacteria 785
279 Ga0495582_0449895 3300046473 Bacteria 744
280 Ga0495584_0711430 3300046491 Unclassified 512
281 Ga0495598_0012106 3300046537 Bacteria 2108
282 Ga0495659_0090960 3300046664 Unclassified 1171
283 Ga0495669_0672151 3300046684 Unclassified 503
284 Ga0495677_0130513 3300047445 Bacteria 962
285 Ga0495593_0683611 3300047673 Bacteria 515
286 Ga0496100_0310181 3300048903 Bacteria 1183
287 Ga0496104_0960137 3300048907 Bacteria 759
288 Ga0496109_0872065 3300048912 Bacteria 838
289 Ga0496113_0680508 3300048916 Bacteria 822
290 Ga0501031_0384651 3300049568 Bacteria 908
291 Ga0501031_0422513 3300049568 Bacteria 862
292 Ga0501037_0916617 3300049573 Unclassified 574
293 Ga0501039_1139085 3300049575 Unclassified 604
294 Ga0501039_1407100 3300049575 Unclassified 537
295 Ga0501040_0410234 3300049576 Bacteria 973
296 Ga0501040_0791132 3300049576 Unclassified 686
297 Ga0501041_0760685 3300049577 Unclassified 621
298 Ga0501071_0015179 3300049587 Bacteria 5284
299 Ga0501072_0151319 3300049588 Bacteria 1850
300 Ga0501217_052663 3300049661 Unclassified 1068
301 Ga0501235_088665 3300049669 Unclassified 745
302 Ga0501239_090156 3300049672 Unclassified 505
303 Ga0501079_0097374 3300049741 Bacteria 2281
304 Ga0501079_0172860 3300049741 Bacteria 1685
305 Ga0501080_0974468 3300049742 Unclassified 736
306 Ga0501081_0031384 3300049743 Bacteria 3601
307 Ga0501081_0092773 3300049743 Bacteria 2125
308 Ga0501081_0265723 3300049743 Unclassified 1254
309 Ga0501045_0250671 3300049824 Bacteria 1318
310 Ga0501045_0459700 3300049824 Bacteria 946
311 nmdc:mga03683_25253_c1 3300050489 Unclassified 2332
312 nmdc:mga00v17_121739_c1 3300050491 Unclassified 1662
313 nmdc:mga0yw44_56132_c1 3300050492 Unclassified 2398
314 nmdc:mga0k408_16556_c1 3300050493 Unclassified 4092
315 nmdc:mga0k408_575717_c1 3300050493 Unclassified 665
316 nmdc:mga06z11_191714_c1 3300050494 Bacteria 1183
317 nmdc:mga06z11_19647_c1 3300050494 Unclassified 3110
318 nmdc:mga07m45_66064_c1 3300050496 Unclassified 2054
319 nmdc:mga05p37_12043_c1 3300050507 Bacteria 10321
320 nmdc:mga05p37_140069_c1 3300050507 Bacteria 2964
321 nmdc:mga05p37_605721_c1 3300050507 Bacteria 1236
322 nmdc:mga05p37_625455_c1 3300050507 Bacteria 1211
323 nmdc:mga05p37_7304_c1 3300050507 Bacteria 13033
324 nmdc:mga05p37_882316_c1 3300050507 Bacteria 967
325 nmdc:mga09592_1256856_c1 3300050508 Bacteria 610
326 nmdc:mga09592_148351_c1 3300050508 Unclassified 2023
327 nmdc:mga09592_75658_c1 3300050508 Bacteria 2863
328 nmdc:mga09592_803120_c1 3300050508 Bacteria 796
329 nmdc:mga0qj67_1116568_c1 3300050509 Unclassified 615
330 nmdc:mga0qj67_742429_c1 3300050509 Bacteria 779
331 nmdc:mga0qj67_870731_c1 3300050509 Bacteria 711
332 nmdc:mga06r32_63278_c1 3300050510 Bacteria 3565
333 nmdc:mga06r32_773439_c1 3300050510 Bacteria 922
334 nmdc:mga06r32_964722_c1 3300050510 Unclassified 806
335 nmdc:mga08y16_1001896_c1 3300050511 Bacteria 815
336 nmdc:mga08y16_235195_c1 3300050511 Bacteria 1895
337 nmdc:mga08y16_257284_c1 3300050511 Bacteria 1803
338 nmdc:mga08y16_593903_c1 3300050511 Bacteria 1116
339 nmdc:mga0n895_127718_c1 3300050512 Bacteria 2566
340 nmdc:mga0n895_49020_c1 3300050512 Bacteria 4136
341 nmdc:mga0n895_938_c1 3300050512 Bacteria 21062
342 nmdc:mga0rr50_17782_c1 3300050513 Bacteria 4758
343 nmdc:mga0rr50_19422_c1 3300050513 Bacteria 4587
344 nmdc:mga0rr50_393723_c1 3300050513 Unclassified 1170
345 nmdc:mga08x19_8386_c1 3300050514 Bacteria 6155
346 nmdc:mga0a205_3004_c1 3300050515 Bacteria 14949
347 nmdc:mga0a205_606868_c1 3300050515 Bacteria 947
348 nmdc:mga0a205_776871_c1 3300050515 Unclassified 806
349 Ga0501084_0318185 3300054114 Unclassified 1314
350 Ga0590071_040256 3300059421 Bacteria 1124
351 Ga0501082_0744674 3300060353 Bacteria 858
352 Ga0501076_0222451
353 Ga0065712_10014534
354 Ga0065712_10098382
355 Ga0065715_10008698
356 Ga0065715_10016320
357 Ga0065715_10115015
358 Ga0065715_10856763
359 Ga0070658_10059393
360 Ga0070676_10068105
361 Ga0070690_100186016
362 Ga0070690_100391173
363 Ga0070670_100273549
364 Ga0070677_10076803
365 Ga0070677_10120890
366 Ga0070677_10909219
367 Ga0068869_100135970
368 Ga0070666_10069190
369 Ga0070660_100102071
370 Ga0070660_100118628
371 Ga0070689_100107326
372 Ga0070689_100523244
373 Ga0070689_101623408
374 Ga0070691_10069597
375 Ga0070687_100338892
376 Ga0070661_101097445
377 Ga0070668_100122560
378 Ga0070669_100045269
379 Ga0070669_100047096
380 Ga0070669_100098383
381 Ga0070675_100000308
382 Ga0070675_100058788
383 Ga0070675_100172663
384 Ga0070675_100385029
385 Ga0070671_100010169
386 Ga0070674_101360458
387 Ga0070673_100003053
388 Ga0070673_101493228
389 Ga0070673_101765601
390 Ga0070688_100978406
391 Ga0070688_101809554
392 Ga0070659_100047974
393 Ga0070701_10119365
394 Ga0070705_100274894
395 Ga0070705_100280775
396 Ga0070705_100340664
397 Ga0070700_100013776
398 Ga0070700_100394178
399 Ga0070700_100402293
400 Ga0070700_101472883
401 Ga0070694_100144412
402 Ga0070694_100956670
403 Ga0070694_101563501
404 Ga0070708_100800359
405 Ga0070678_100778163
406 Ga0070678_101081491
407 Ga0070662_100048225
408 Ga0070662_100076381
409 Ga0070681_10162758
410 Ga0068867_100027944
411 Ga0068867_101111149
412 Ga0070706_100951209
413 Ga0070706_100991107
414 Ga0070707_100121618
415 Ga0070698_100007777
416 Ga0070697_100090099
417 Ga0068853_101679317
418 Ga0070672_100004659
419 Ga0070672_100620534
420 Ga0070686_100453352
421 Ga0070686_100788921
422 Ga0070695_100025573
423 Ga0070695_100429857
424 Ga0070695_100634588
425 Ga0070695_100750763
426 Ga0070693_100043847
427 Ga0070693_100255441
428 Ga0070665_100003140
429 Ga0070704_100118315
430 Ga0068855_100166134
431 Ga0070664_101037379
432 Ga0068854_100181476
433 Ga0070702_100017923
434 Ga0068852_100200872
435 Ga0068859_100061847
436 Ga0068864_101677990
437 Ga0068861_100704302
438 Ga0068861_100705659
439 Ga0068870_10933427
440 Ga0068863_100372273
441 Ga0068858_100044540
442 Ga0068858_100833722
443 Ga0068858_100916452
444 Ga0068860_100926753
445 Ga0068860_101751436
446 Ga0068862_100006232
447 Ga0068862_100022908
448 Ga0068862_100077441
449 Ga0068862_101175449
450 Ga0075365_10118266
451 Ga0075367_10009559
452 Ga0075367_10130982
453 Ga0075369_10545921
454 Ga0075366_10002492
455 Ga0075370_10028310
456 Ga0075370_10823301
457 Ga0068871_100229401
458 Ga0075428_100161007
459 Ga0075428_100203217
460 Ga0075428_100576668
461 Ga0075428_100970496
462 Ga0075428_100996642
463 Ga0075430_100757908
464 Ga0075430_100797618
465 Ga0075431_100117182
466 Ga0075431_100238447
467 Ga0075431_100552849
468 Ga0075431_100667399
469 Ga0075433_10037357
470 Ga0075433_10278275
471 Ga0075434_100000372
472 Ga0075434_100027777
473 Ga0075434_100037722
474 Ga0075434_100051333
475 Ga0075434_101992739
476 Ga0075429_100013757
477 Ga0075429_100017795
478 Ga0075429_100332042
479 Ga0075429_100855479
480 Ga0068865_100107859
481 Ga0075436_100024045
482 Ga0075436_100067025
483 Ga0075436_100522988
484 Ga0097620_100061847
485 Ga0075435_100009558
486 Ga0075435_100064067
487 Ga0075435_100072616
488 Ga0105240_10037082
489 Ga0111539_10157032
490 Ga0111539_10356959
491 Ga0111539_10383485
492 Ga0111539_10504203
493 Ga0111539_10622263
494 Ga0111539_10709990
495 Ga0105245_10378798
496 Ga0105245_10754024
497 Ga0105247_10788468
498 Ga0114129_10014461
499 Ga0114129_10046184
500 Ga0114129_10122889
501 Ga0114129_10260805
502 Ga0114129_10338203
503 Ga0114129_12060252
504 Ga0105243_10216157
505 Ga0105242_10423659
506 Ga0105248_10023052
507 Ga0105248_10302132
508 Ga0105248_10539791
509 Ga0105238_10089377
510 Ga0105238_10290400
511 Ga0105238_12712717
512 Ga0105249_10150649
513 Ga0105249_10518572
514 Ga0105249_11254168
515 Ga0105249_11682729
516 Ga0105239_10486108
517 Ga0163162_12572971
518 Ga0157372_11896803
519 Ga0157375_10065968
520 Ga0157375_10646322
521 Ga0157375_13144710
522 Ga0163163_10708925
523 Ga0157380_10129907
524 Ga0157380_12627227
525 Ga0157377_10670007
526 Ga0207682_10113250
527 Ga0207682_10230705
528 Ga0207688_10338510
529 Ga0207688_11042200
530 Ga0207680_10272066
531 Ga0207705_10097826
532 Ga0207654_10101645
533 Ga0207707_10109772
534 Ga0207707_10243473
535 Ga0207662_10025026
536 Ga0207662_10688276
537 Ga0207657_10010747
538 Ga0207657_10143380
539 Ga0207652_11860463
540 Ga0207646_10379982
541 Ga0207681_10514671
542 Ga0207681_10720666
543 Ga0207694_10328767
544 Ga0207694_10615075
545 Ga0207650_10359925
546 Ga0207659_10000417
547 Ga0207659_10145654
548 Ga0207659_10512420
549 Ga0207687_10131024
550 Ga0207644_10080601
551 Ga0207706_10042655
552 Ga0207706_10095212
553 Ga0207706_10201506
554 Ga0207686_10535641
555 Ga0207709_10034629
556 Ga0207670_10522887
557 Ga0207669_10024470
558 Ga0207691_10010646
559 Ga0207691_10077300
560 Ga0207691_10318301
561 Ga0207711_10024401
562 Ga0207711_11596570
563 Ga0207689_10061373
564 Ga0207661_11148653
565 Ga0207679_10649391
566 Ga0207679_11003357
567 Ga0207667_10108485
568 Ga0207651_10002569
569 Ga0207651_10458545
570 Ga0207651_11206746
571 Ga0207712_10693264
572 Ga0207668_10039846
573 Ga0207640_10043629
574 Ga0207703_10350178
575 Ga0207678_11443780
576 Ga0207708_10061373
577 Ga0207708_10199703
578 Ga0207708_10276862
579 Ga0207708_10887480
580 Ga0207708_11298663
581 Ga0207641_10340529
582 Ga0207648_10002325
583 Ga0207648_11280851
584 Ga0207648_11593508
585 Ga0207675_100053877
586 Ga0207675_100197502
587 Ga0207675_100472108
588 Ga0207675_100987155
589 Ga0207683_10508189
590 Ga0207683_10924575
591 Ga0207683_11597240
592 Ga0209971_1050730
593 Ga0207428_10019731
594 Ga0207428_10020232
595 Ga0207428_10674415
596 Ga0268266_10078345
597 Ga0268265_10060411
598 Ga0268265_10079053
599 Ga0268265_10122400
600 Ga0268265_10140356
601 Ga0307511_10148130
602 Ga0307408_100550481
603 Ga0307408_101914452
604 Ga0307405_10258963
605 Ga0307410_10147819
606 Ga0307406_11214856
607 Ga0307412_12278103
608 Ga0307409_102055915
609 Ga0307416_100005417
610 Ga0307416_100174325
611 Ga0307416_100183717
612 Ga0307414_10105975
613 Ga0307411_10304782
614 Ga0307415_101043589
615 Ga0307415_102395013
616 Ga0373943_0997555
617 Ga0373955_0738221
618 Ga0373931_0406436
619 Ga0373927_0809765
620 Ga0373947_0884842
621 Ga0373925_0385275
622 Ga0395900_1619939
623 Ga0439453_0094550
624 Ga0450905_055137
625 Ga0439446_0127378
626 Ga0439434_0360719
627 Ga0439460_0188026
628 Ga0439460_0369025
629 Ga0451576_1220271
630 Ga0495582_0449895
631 Ga0495584_0711430
632 Ga0495598_0012106
633 Ga0495659_0090960
634 Ga0495669_0672151
635 Ga0495677_0130513
636 Ga0495593_0683611
637 Ga0496100_0310181
638 Ga0496104_0960137
639 Ga0496109_0872065
640 Ga0496113_0680508
641 Ga0501031_0384651
642 Ga0501031_0422513
643 Ga0501037_0916617
644 Ga0501039_1139085
645 Ga0501039_1407100
646 Ga0501040_0410234
647 Ga0501040_0791132
648 Ga0501041_0760685
649 Ga0501071_0015179
650 Ga0501072_0151319
651 Ga0501217_052663
652 Ga0501235_088665
653 Ga0501239_090156
654 Ga0501079_0097374
655 Ga0501079_0172860
656 Ga0501080_0974468
657 Ga0501081_0031384
658 Ga0501081_0092773
659 Ga0501081_0265723
660 Ga0501045_0250671
661 Ga0501045_0459700
662 nmdc:mga03683_25253_c1
663 nmdc:mga00v17_121739_c1
664 nmdc:mga0yw44_56132_c1
665 nmdc:mga0k408_16556_c1
666 nmdc:mga0k408_575717_c1
667 nmdc:mga06z11_191714_c1
668 nmdc:mga06z11_19647_c1
669 nmdc:mga07m45_66064_c1
670 nmdc:mga05p37_12043_c1
671 nmdc:mga05p37_140069_c1
672 nmdc:mga05p37_605721_c1
673 nmdc:mga05p37_625455_c1
674 nmdc:mga05p37_7304_c1
675 nmdc:mga05p37_882316_c1
676 nmdc:mga09592_1256856_c1
677 nmdc:mga09592_148351_c1
678 nmdc:mga09592_75658_c1
679 nmdc:mga09592_803120_c1
680 nmdc:mga0qj67_1116568_c1
681 nmdc:mga0qj67_742429_c1
682 nmdc:mga0qj67_870731_c1
683 nmdc:mga06r32_63278_c1
684 nmdc:mga06r32_773439_c1
685 nmdc:mga06r32_964722_c1
686 nmdc:mga08y16_1001896_c1
687 nmdc:mga08y16_235195_c1
688 nmdc:mga08y16_257284_c1
689 nmdc:mga08y16_593903_c1
690 nmdc:mga0n895_127718_c1
691 nmdc:mga0n895_49020_c1
692 nmdc:mga0n895_938_c1
693 nmdc:mga0rr50_17782_c1
694 nmdc:mga0rr50_19422_c1
695 nmdc:mga0rr50_393723_c1
696 nmdc:mga08x19_8386_c1
697 nmdc:mga0a205_3004_c1
698 nmdc:mga0a205_606868_c1
699 nmdc:mga0a205_776871_c1
700 Ga0501084_0318185
701 Ga0590071_040256
702 Ga0501082_0744674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uhq-assembly1.cif.gz_A structure of a semisweet q20a mutant 0.6811 48 115
5arn-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.6313 5 114
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5837 1 116
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.5649 1 116
8e0m-assembly4.cif.gz_J homotrimeric variant of tctrp9, bgl15 0.56 29 110
ID Description Score Start End Superfamily
af_K7K9I2_184_266_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.9853 71 116 1.20.1280.20
1f4nA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9814 74 119 1.10.287.230
1f4mA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9499 74 116 1.10.287.230
af_P38962_15_156_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.914 69 112 3.30.300.30
af_P53193_97_182_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.9052 67 120 1.20.1280.20
ID Description Score Start End GO Terms
AF-A0A6A7LP67-F1-model_v4 DoxX family protein 0.9603 3 120 GO:0016020
AF-A0A7R8AU85-F1-model_v4 deleted 0.9531 1 120
AF-A0A2W4RS06-F1-model_v4 DoxX family protein 0.9501 1 120 GO:0016020
AF-A0A843T712-F1-model_v4 Alpha/beta fold hydrolase 0.9479 1 120 GO:0016020
GO:0016787
AF-A0A317HQ70-F1-model_v4 DoxX family protein 0.9462 1 120 GO:0016020

Map