F418793

General Info

Members Datasets Scaffolds Average Seq Length
351 260 236 181

Family's Representative Sequence

Representative Sequence 3300049550|Ga0501334_10158|Ga0501334_10158_41_667
Length 202
Sequence MKRLLIHFQPYISSVGKKKRRSSLMNYNIRGENIEVTPAIREYIEKKITKLERYFTETPNAKTYSDKTAKVEVTIPMQNLVLRAEEVHNDMYAGVDLITDKLERQIRKHKTKVNRKFREKGGKDTLFTNAAAEPGSPIIEEENDLEVVRQKSFDLKPMDSEEAILQMNMLGHNFYVFTNADSNRTNVVYKRKDGRYGLIEAQ

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
3 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
4 2554235283 Bacillus safensis VK Isolate Rhizosphere
5 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
6 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
7 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
8 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
9 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
10 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
11 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
12 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
13 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
14 2643221731 Bacillus sp. Root147 Isolate Unclassified
15 2643221732 Bacillus sp. Root239 Isolate Unclassified
16 2643221735 Bacillus sp. Root920 Isolate Unclassified
17 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
18 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
19 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
20 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
21 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
22 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
23 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
24 2738541295 Bacillus sp. OK085 Isolate Unclassified
25 2738543010 Bacillus sp. YR335 Isolate Unclassified
26 2738543017 Bacillus sp. OV186 Isolate Unclassified
27 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
28 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
29 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
30 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
31 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
32 2811994870 Bacillus sp. JB4 Isolate Unclassified
33 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
34 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
35 2818991441 Niallia circulans 3243 Isolate Rhizosphere
36 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
37 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
38 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
39 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
40 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
41 2842682962 Bacillus sp. R-72492 Isolate Unclassified
42 2842882022 Bacillus sp. R-71893 Isolate Unclassified
43 2849139964 Bacillus sp. R-71875 Isolate Unclassified
44 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
45 2857581216 Bacillus sp. R-71922 Isolate Unclassified
46 2857586860 Bacillus sp. R-71935 Isolate Unclassified
47 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
48 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
49 2860837431 Bacillus sp. WR11 Isolate Unclassified
50 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
51 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
52 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
53 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
54 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
55 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
56 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
57 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
58 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
59 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
60 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
61 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
62 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
63 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
64 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
65 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
66 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
67 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
68 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
69 2919720352 Priestia megaterium 4340 Isolate Unclassified
70 2919726948 Bacillus pumilus 4489 Isolate Unclassified
71 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
72 2929004312 Priestia megaterium 1104 Isolate Unclassified
73 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
74 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
75 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
76 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
77 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
78 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
79 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
80 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
81 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
82 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
83 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
84 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
85 2969141011 Bacillus velezensis MH25 Isolate Unclassified
86 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
87 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
88 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
89 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
90 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
91 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
92 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
93 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
94 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
95 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
96 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
97 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
98 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
99 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
100 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
101 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
102 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
103 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
104 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
105 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
106 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
107 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
108 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
109 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
110 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
111 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
112 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
113 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
114 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
115 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
116 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
117 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
118 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
122 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
225 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
243 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
247 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
248 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
249 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
252 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
253 8022653035 Bacillus sp. Rc4 Isolate Unclassified
254 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
255 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
256 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
257 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
258 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
259 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
260 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 49.29
Metatranscriptomes 17.66
Isolates 33.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.98
Nodule 0
Rhizoplane 9.97
Rhizosphere 58.97
Stem 0
Stem Tuber 0
Unclassified 23.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000011 3300003187 Bacteria 264206
2 JGI25151J46595_10004714 3300003187 Bacteria 7168
3 JGI25151J46595_10012788 3300003187 Bacteria 3802
4 JGI25151J46595_10078846 3300003187 Bacteria 962
5 rootH1_10004929 3300003316 Bacteria 39919
6 rootH1_10004929 3300003323 Bacteria 12397
7 rootH2_10197881 3300003320 Bacteria 5960
8 rootL2_10001438 3300003322 Bacteria 42537
9 rootH1_10335462 3300003323 Bacteria 2766
10 Ga0006554J51385_1018500 3300003567 Bacteria 624
11 Ga0006562J51391_1000031 3300003578 Bacteria 7883
12 Ga0006562J51391_1000939 3300003578 Bacteria 662
13 Ga0055538_1000553 3300003751 Bacteria 12934
14 Ga0055532_1000081 3300003758 Bacteria 118795
15 Ga0055536_1033620 3300003781 Bacteria 1308
16 Ga0055536_1039216 3300003781 Bacteria 1140
17 Ga0055528_1004027 3300003790 Bacteria 7186
18 Ga0070676_10270026 3300005328 Bacteria 1142
19 Ga0070669_100369891 3300005353 Bacteria 1167
20 Ga0070675_100050020 3300005354 Bacteria 3432
21 Ga0070671_100393727 3300005355 Bacteria 1185
22 Ga0070714_100363856 3300005435 Bacteria 1360
23 Ga0068860_100828612 3300005843 Bacteria 939
24 Ga0105251_10009354 3300009011 Bacteria 5793
25 Ga0105244_10024826 3300009036 Bacteria 3266
26 Ga0105244_10269168 3300009036 Bacteria 791
27 Ga0105250_10285096 3300009092 Bacteria 711
28 Ga0105245_10013725 3300009098 Bacteria 7056
29 Ga0105247_10036879 3300009101 Bacteria 2981
30 Ga0105243_10001105 3300009148 Bacteria 24500
31 Ga0105241_10297234 3300009174 Bacteria 1384
32 Ga0105242_10003356 3300009176 Bacteria 12456
33 Ga0105249_10622680 3300009553 Bacteria 1135
34 Ga0105246_10044413 3300011119 Bacteria 3020
35 Ga0157371_10007792 3300013102 Bacteria 8605
36 Ga0157369_10100855 3300013105 Bacteria 3077
37 Ga0157374_10111120 3300013296 Bacteria 2636
38 Ga0157378_10599586 3300013297 Bacteria 1112
39 Ga0157372_10812978 3300013307 Bacteria 1086
40 Ga0157377_10001631 3300014745 Bacteria 9778
41 Ga0157376_10019209 3300014969 Bacteria 5261
42 Ga0206356_11743289 3300020070 Bacteria 591
43 Ga0206351_10228536 3300020077 Bacteria 616
44 Ga0206350_10791016 3300020080 Bacteria 601
45 Ga0209784_100201 3300025224 Bacteria 42900
46 Ga0209147_100028 3300025229 Bacteria 383994
47 Ga0209147_101382 3300025229 Bacteria 8997
48 Ga0209437_100453 3300025233 Bacteria 33692
49 Ga0209673_1002583 3300025273 Bacteria 12256
50 Ga0209130_1022298 3300025284 Bacteria 1415
51 Ga0209676_1000684 3300025292 Bacteria 47908
52 Ga0209676_1001534 3300025292 Bacteria 20949
53 Ga0209676_1013191 3300025292 Bacteria 3193
54 Ga0209676_1033592 3300025292 Bacteria 1526
55 Ga0209025_1000011 3300025294 Bacteria 976387
56 Ga0209025_1000599 3300025294 Bacteria 65048
57 Ga0209025_1005230 3300025294 Bacteria 10698
58 Ga0209025_1006697 3300025294 Bacteria 8843
59 Ga0209025_1019760 3300025294 Bacteria 3726
60 Ga0209025_1022014 3300025294 Bacteria 3403
61 Ga0207426_1013350 3300025302 Bacteria 3048
62 Ga0207696_1021115 3300025711 Bacteria 2089
63 Ga0207655_1002723 3300025728 Bacteria 13813
64 Ga0207655_1033182 3300025728 Bacteria 2344
65 Ga0207713_1006642 3300025735 Bacteria 7007
66 Ga0207713_1021180 3300025735 Bacteria 3123
67 Ga0207710_10134392 3300025900 Bacteria 1190
68 Ga0207659_10159773 3300025926 Bacteria 1768
69 Ga0207687_10446562 3300025927 Bacteria 1072
70 Ga0207644_10378468 3300025931 Bacteria 1154
71 Ga0207686_10028804 3300025934 Bacteria 3268
72 Ga0207709_10026484 3300025935 Bacteria 3332
73 Ga0209371_1020309 3300027312 Bacteria 1637
74 Ga0268256_1002710 3300030500 Bacteria 8701
75 Ga0307408_100529510 3300031548 Bacteria 1036
76 Ga0307408_101158269 3300031548 Bacteria 720
77 Ga0307407_10427320 3300031903 Bacteria 956
78 Ga0307409_100613540 3300031995 Bacteria 1077
79 Ga0307409_100782917 3300031995 Bacteria 960
80 Ga0307416_100046870 3300032002 Bacteria 3416
81 Ga0307416_100055648 3300032002 Bacteria 3188
82 Ga0307416_100363942 3300032002 Bacteria 1469
83 Ga0307416_101540588 3300032002 Bacteria 770
84 Ga0316596_1038052 3300033541 Bacteria 1260
85 Ga0373925_0252738 3300037068 Bacteria 1414
86 Ga0373925_0574398 3300037068 Bacteria 928
87 Ga0395898_0676881 3300037466 Bacteria 974
88 Ga0395898_1323504 3300037466 Bacteria 649
89 Ga0395901_0513842 3300038443 Bacteria 1218
90 Ga0400483_119558 3300039062 Bacteria 1876
91 Ga0400483_223143 3300039062 Bacteria 11832
92 Ga0451789_0533794 3300041443 Bacteria 777
93 Ga0451795_1241727 3300041456 Unclassified 788
94 Ga0466958_0427607 3300045836 Bacteria 856
95 Ga0495590_0071071 3300046457 Bacteria 1221
96 Ga0495629_0236445 3300046459 Bacteria 1258
97 Ga0495629_0400846 3300046459 Bacteria 932
98 Ga0495582_0035815 3300046473 Bacteria 2730
99 Ga0495605_0141585 3300046474 Bacteria 1078
100 Ga0495584_0013173 3300046491 Bacteria 4220
101 Ga0495585_0046659 3300046492 Bacteria 2415
102 Ga0495620_0094688 3300046515 Bacteria 1195
103 Ga0495637_0068460 3300046520 Bacteria 1438
104 Ga0495654_0135244 3300046530 Bacteria 1103
105 Ga0495609_0166530 3300046538 Bacteria 932
106 Ga0495633_0207239 3300046558 Bacteria 899
107 Ga0495611_0279818 3300046648 Bacteria 771
108 Ga0495661_0167427 3300046665 Bacteria 1175
109 Ga0495661_0179022 3300046665 Bacteria 1125
110 Ga0495658_0015843 3300046683 Bacteria 3874
111 Ga0495613_0139854 3300046689 Bacteria 1730
112 Ga0495670_0255460 3300046691 Bacteria 935
113 Ga0495589_0381543 3300046794 Bacteria 648
114 Ga0495660_0011995 3300046810 Bacteria 5027
115 Ga0495676_0136199 3300047321 Bacteria 1766
116 Ga0495676_0236398 3300047321 Bacteria 1253
117 Ga0495676_0474887 3300047321 Bacteria 823
118 Ga0495626_0024055 3300048091 Bacteria 2990
119 Ga0496100_0000664 3300048903 Bacteria 16338
120 Ga0496100_0173450 3300048903 Bacteria 1555
121 Ga0496101_0002358 3300048904 Bacteria 11588
122 Ga0496101_0173509 3300048904 Bacteria 1658
123 Ga0496102_0008385 3300048905 Bacteria 8851
124 Ga0496102_0010434 3300048905 Bacteria 7991
125 Ga0496102_0492986 3300048905 Bacteria 1147
126 Ga0496102_1280995 3300048905 Bacteria 652
127 Ga0496103_0019968 3300048906 Bacteria 4023
128 Ga0496103_0021075 3300048906 Bacteria 3921
129 Ga0496104_0000326 3300048907 Bacteria 42402
130 Ga0496105_0014810 3300048908 Bacteria 6208
131 Ga0496105_0123093 3300048908 Bacteria 2138
132 Ga0496106_0002828 3300048909 Bacteria 12874
133 Ga0496107_0017466 3300048910 Bacteria 5046
134 Ga0496108_0000285 3300048911 Bacteria 43437
135 Ga0496109_0000604 3300048912 Bacteria 30011
136 Ga0496109_0139347 3300048912 Bacteria 2268
137 Ga0496110_0018237 3300048913 Bacteria 5881
138 Ga0496110_0049450 3300048913 Bacteria 3688
139 Ga0496110_0136925 3300048913 Bacteria 2213
140 Ga0496111_0003779 3300048914 Bacteria 9435
141 Ga0496111_0075787 3300048914 Bacteria 2451
142 Ga0496111_0591604 3300048914 Bacteria 813
143 Ga0496112_0008531 3300048915 Bacteria 9182
144 Ga0496112_0016554 3300048915 Bacteria 6912
145 Ga0496112_0086357 3300048915 Bacteria 3104
146 Ga0496113_0040384 3300048916 Bacteria 3438
147 Ga0496113_0365496 3300048916 Bacteria 1158
148 Ga0496116_0002717 3300048919 Bacteria 18216
149 Ga0496116_0006138 3300048919 Bacteria 10986
150 Ga0496116_0020436 3300048919 Bacteria 5028
151 Ga0496116_0065301 3300048919 Bacteria 2335
152 Ga0496116_0154029 3300048919 Bacteria 1272
153 Ga0496117_0000087 3300048920 Bacteria 211708
154 Ga0496117_0019254 3300048920 Bacteria 5614
155 Ga0496119_0000316 3300048922 Bacteria 67705
156 Ga0496119_0049758 3300048922 Bacteria 2588
157 Ga0496120_0002022 3300048923 Bacteria 22050
158 Ga0496121_0103177 3300048924 Bacteria 2195
159 Ga0496122_0006515 3300048925 Bacteria 13371
160 Ga0496122_0129358 3300048925 Bacteria 1608
161 Ga0496122_0149720 3300048925 Bacteria 1443
162 Ga0496122_0190593 3300048925 Bacteria 1211
163 Ga0496123_0206275 3300048926 Bacteria 1003
164 Ga0496124_0000360 3300048927 Bacteria 83057
165 Ga0496124_0301272 3300048927 Bacteria 1158
166 Ga0496125_0262221 3300048928 Bacteria 1082
167 Ga0496126_0174185 3300048929 Bacteria 1831
168 Ga0496126_0232719 3300048929 Bacteria 1543
169 Ga0501306_001245 3300049127 Bacteria 2340
170 Ga0501309_001299 3300049129 Bacteria 2402
171 Ga0501343_013848 3300049132 Bacteria 678
172 Ga0501344_04087 3300049133 Bacteria 794
173 Ga0501344_04862 3300049133 Bacteria 747
174 Ga0501305_003734 3300049161 Bacteria 1745
175 Ga0501305_038968 3300049161 Bacteria 768
176 Ga0501305_043781 3300049161 Bacteria 735
177 Ga0501305_051003 3300049161 Bacteria 694
178 Ga0501305_051682 3300049161 Bacteria 691
179 Ga0501305_068728 3300049161 Bacteria 620
180 Ga0501305_069314 3300049161 Bacteria 618
181 Ga0501305_075922 3300049161 Bacteria 597
182 Ga0501305_082646 3300049161 Bacteria 579
183 Ga0501290_045093 3300049513 Bacteria 672
184 Ga0501311_006216 3300049527 Bacteria 1337
185 Ga0501311_046183 3300049527 Bacteria 672
186 Ga0501312_008242 3300049528 Bacteria 1350
187 Ga0501312_043814 3300049528 Bacteria 738
188 Ga0501312_046068 3300049528 Bacteria 724
189 Ga0501312_048999 3300049528 Bacteria 708
190 Ga0501312_051333 3300049528 Bacteria 696
191 Ga0501312_070143 3300049528 Bacteria 620
192 Ga0501312_070982 3300049528 Bacteria 617
193 Ga0501313_035932 3300049529 Bacteria 655
194 Ga0501314_034304 3300049530 Bacteria 574
195 Ga0501315_031751 3300049531 Bacteria 764
196 Ga0501315_043374 3300049531 Bacteria 687
197 Ga0501316_018347 3300049532 Bacteria 864
198 Ga0501316_018723 3300049532 Bacteria 858
199 Ga0501316_020436 3300049532 Bacteria 831
200 Ga0501316_023346 3300049532 Bacteria 793
201 Ga0501316_026502 3300049532 Bacteria 759
202 Ga0501316_031702 3300049532 Bacteria 709
203 Ga0501316_031735 3300049532 Bacteria 709
204 Ga0501316_045699 3300049532 Bacteria 620
205 Ga0501317_057092 3300049533 Bacteria 633
206 Ga0501318_019827 3300049534 Bacteria 842
207 Ga0501321_028034 3300049537 Bacteria 739
208 Ga0501321_036665 3300049537 Bacteria 676
209 Ga0501323_035301 3300049539 Bacteria 716
210 Ga0501323_044917 3300049539 Bacteria 657
211 Ga0501324_027908 3300049540 Bacteria 605
212 Ga0501331_05033 3300049547 Bacteria 748
213 Ga0501334_10158 3300049550 Bacteria 677
214 Ga0501334_14802 3300049550 Bacteria 593
215 Ga0501334_16456 3300049550 Bacteria 571
216 Ga0501335_009911 3300049551 Bacteria 914
217 Ga0501335_017268 3300049551 Bacteria 748
218 Ga0501336_006882 3300049552 Bacteria 853
219 Ga0501336_009468 3300049552 Bacteria 768
220 Ga0501336_015344 3300049552 Bacteria 656
221 Ga0501336_015963 3300049552 Bacteria 648
222 Ga0501336_020286 3300049552 Bacteria 601
223 Ga0501337_008755 3300049553 Bacteria 721
224 Ga0501337_010163 3300049553 Bacteria 683
225 Ga0501067_0067161 3300049583 Bacteria 1985
226 Ga0501202_042571 3300049652 Bacteria 985
227 Ga0501208_002216 3300049655 Bacteria 1998
228 Ga0501208_054256 3300049655 Bacteria 771
229 Ga0501216_081716 3300049660 Bacteria 685
230 Ga0501217_014844 3300049661 Bacteria 1766
231 Ga0501217_053380 3300049661 Bacteria 1062
232 Ga0501233_026547 3300049668 Bacteria 1280
233 Ga0501251_003583 3300049681 Bacteria 1560
234 Ga0501276_012243 3300049773 Bacteria 740
235 Ga0500566_0011628 3300053094 Bacteria 5182
236 Ga0500637_0000938 3300053178 Bacteria 11811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049528 Ga0501312_046068 Ga0501312_046068_115_672 152
2 3300003187 JGI25151J46595_10004714 JGI25151J46595_100047145 163
3 3300025294 Ga0209025_1000599 Ga0209025_100059944 163
4 3300049583 Ga0501067_0067161 Ga0501067_0067161_1282_1842 164
5 3300009174 Ga0105241_10297234 Ga0105241_102972342 165
6 3300013105 Ga0157369_10100855 Ga0157369_101008552 165
7 3300048908 Ga0496105_0123093 Ga0496105_0123093_1070_1633 165
8 3300032002 Ga0307416_100055648 Ga0307416_1000556483 167
9 3300049133 Ga0501344_04862 Ga0501344_04862_158_706 167
10 3300049161 Ga0501305_051003 Ga0501305_051003_15_563 167
11 3300049528 Ga0501312_051333 Ga0501312_051333_15_563 167
12 3300049532 Ga0501316_018723 Ga0501316_018723_170_718 167
13 3300049552 Ga0501336_009468 Ga0501336_009468_48_596 167
14 3300049668 Ga0501233_026547 Ga0501233_026547_43_591 167
15 iso_pu_bacteria 8007371054 8007374215 167
16 iso_pu_bacteria 2857460504 2857464768 168
17 3300038443 Ga0395901_0513842 Ga0395901_0513842_467_1039 171
18 3300037068 Ga0373925_0252738 Ga0373925_0252738_414_974 172
19 3300046459 Ga0495629_0236445 Ga0495629_0236445_280_840 172
20 3300046459 Ga0495629_0400846 Ga0495629_0400846_129_689 172
21 3300046473 Ga0495582_0035815 Ga0495582_0035815_1948_2508 172
22 3300046683 Ga0495658_0015843 Ga0495658_0015843_1064_1624 172
23 3300046689 Ga0495613_0139854 Ga0495613_0139854_488_1048 172
24 3300047321 Ga0495676_0236398 Ga0495676_0236398_320_880 172
25 3300048915 Ga0496112_0016554 Ga0496112_0016554_5177_5740 172
26 iso_pu_bacteria 2939615513 2939617518 172
27 3300003187 JGI25151J46595_10078846 JGI25151J46595_100788461 173
28 3300003751 Ga0055538_1000553 Ga0055538_10005531 173
29 3300003781 Ga0055536_1033620 Ga0055536_10336202 173
30 3300003781 Ga0055536_1039216 Ga0055536_10392161 173
31 3300025224 Ga0209784_100201 Ga0209784_1002011 173
32 3300025292 Ga0209676_1000684 Ga0209676_100068426 173
33 3300025292 Ga0209676_1013191 Ga0209676_10131913 173
34 3300025292 Ga0209676_1033592 Ga0209676_10335922 173
35 3300025294 Ga0209025_1019760 Ga0209025_10197602 173
36 3300033541 Ga0316596_1038052 Ga0316596_10380522 173
37 3300039062 Ga0400483_119558 Ga0400483_119558_24_557 173
38 3300039062 Ga0400483_223143 Ga0400483_223143_1345_1878 173
39 3300041443 Ga0451789_0533794 Ga0451789_0533794_108_662 173
40 3300048919 Ga0496116_0002717 Ga0496116_0002717_3795_4358 173
41 3300048925 Ga0496122_0190593 Ga0496122_0190593_89_652 173
42 3300048929 Ga0496126_0232719 Ga0496126_0232719_52_603 173
43 3300049528 Ga0501312_043814 Ga0501312_043814_143_706 173
44 3300005435 Ga0070714_100363856 Ga0070714_1003638562 174
45 3300009036 Ga0105244_10024826 Ga0105244_100248262 174
46 iso_pu_bacteria 2600255229 2601445307 174
47 3300025233 Ga0209437_100453 Ga0209437_10045320 175
48 3300025728 Ga0207655_1033182 Ga0207655_10331822 175
49 3300048920 Ga0496117_0000087 Ga0496117_0000087_86911_87468 175
50 iso_pu_bacteria 2857586860 2857588773 175
51 iso_pu_bacteria 3001892409 3001895061 175
52 3300031548 Ga0307408_101158269 Ga0307408_1011582691 176
53 3300041456 Ga0451795_1241727 Ga0451795_1241727_137_676 176
54 iso_pu_bacteria 2593339131 2595090402 176
55 iso_pu_bacteria 2757320391 2757567153 176
56 iso_pu_bacteria 2775507177 2777761656 176
57 iso_pu_bacteria 2775507192 2777837399 176
58 iso_pu_bacteria 2936340661 2936344630 176
59 iso_pu_bacteria 2936361878 2936362741 176
60 iso_pu_bacteria 2964375228 2964376299 176
61 iso_pu_bacteria 8057632132 8057636352 176
62 3300009011 Ga0105251_10009354 Ga0105251_100093545 177
63 3300025728 Ga0207655_1002723 Ga0207655_10027231 177
64 3300025735 Ga0207713_1021180 Ga0207713_10211803 177
65 3300037466 Ga0395898_0676881 Ga0395898_0676881_48_620 177
66 3300048928 Ga0496125_0262221 Ga0496125_0262221_461_1021 177
67 3300049532 Ga0501316_031735 Ga0501316_031735_123_677 177
68 3300049532 Ga0501316_045699 Ga0501316_045699_53_592 177
69 3300049550 Ga0501334_10158 Ga0501334_10158_41_667 177
70 3300049553 Ga0501337_008755 Ga0501337_008755_101_655 177
71 3300053094 Ga0500566_0011628 Ga0500566_0011628_2272_2817 177
72 iso_pu_bacteria 2576861424 2578339013 177
73 iso_pu_bacteria 2600255286 2601640445 177
74 iso_pu_bacteria 2643221731 2644720383 177
75 iso_pu_bacteria 2643221732 2644726533 177
76 iso_pu_bacteria 2738541295 2738817355 177
77 iso_pu_bacteria 2738543010 2739233378 177
78 iso_pu_bacteria 2738543017 2739269600 177
79 iso_pu_bacteria 2818991441 2819566757 177
80 iso_pu_bacteria 2818991465 2819711117 177
81 iso_pu_bacteria 2831905167 2831908615 177
82 iso_pu_bacteria 2842882022 2842886322 177
83 iso_pu_bacteria 2881636855 2881638040 177
84 iso_pu_bacteria 2904524088 2904528736 177
85 iso_pu_bacteria 2919143609 2919148367 177
86 iso_pu_bacteria 2919414237 2919415495 177
87 iso_pu_bacteria 2919517244 2919521866 177
88 iso_pu_bacteria 2919720352 2919724998 177
89 iso_pu_bacteria 2928093941 2928098289 177
90 iso_pu_bacteria 2929004312 2929007719 177
91 iso_pu_bacteria 2960319331 2960321304 177
92 iso_pu_bacteria 2960375949 2960378575 177
93 iso_pu_bacteria 2971511577 2971514392 177
94 iso_pu_bacteria 2977254563 2977255856 177
95 iso_pu_bacteria 2980176882 2980180606 177
96 iso_pu_bacteria 2980182181 2980190053 177
97 iso_pu_bacteria 2990275345 2990276653 177
98 iso_pu_bacteria 8022893055 8022894353 177
99 iso_pu_bacteria 8022914991 8022918536 177
100 3300045836 Ga0466958_0427607 Ga0466958_0427607_84_626 178
101 3300048905 Ga0496102_0492986 Ga0496102_0492986_516_1058 178
102 iso_pu_bacteria 2643221543 2643736920 178
103 iso_pu_bacteria 2671180330 2672338553 178
104 iso_pu_bacteria 2816332186 2816865511 178
105 iso_pu_bacteria 2816332295 2817481836 178
106 iso_pu_bacteria 2821111986 2821118208 178
107 iso_pu_bacteria 2842682962 2842686532 178
108 iso_pu_bacteria 2849139964 2849142831 178
109 iso_pu_bacteria 2857581216 2857583311 178
110 iso_pu_bacteria 2857604169 2857606414 178
111 iso_pu_bacteria 2857609550 2857610029 178
112 iso_pu_bacteria 2885526491 2885529831 178
113 iso_pu_bacteria 2889042446 2889048101 178
114 iso_pu_bacteria 2904162308 2904168058 178
115 iso_pu_bacteria 2904490793 2904494371 178
116 iso_pu_bacteria 2916971899 2916975307 178
117 iso_pu_bacteria 2919160200 2919165112 178
118 iso_pu_bacteria 2931384279 2931385207 178
119 iso_pu_bacteria 2945991243 2945996150 178
120 iso_pu_bacteria 2946053406 2946058839 178
121 iso_pu_bacteria 3006858327 3006862267 178
122 iso_pu_bacteria 3006978542 3006980687 178
123 iso_pu_bacteria 8022948649 8022953382 178
124 3300003187 JGI25151J46595_10012788 JGI25151J46595_100127882 179
125 3300025284 Ga0209130_1022298 Ga0209130_10222982 179
126 3300025292 Ga0209676_1001534 Ga0209676_100153412 179
127 3300037466 Ga0395898_1323504 Ga0395898_1323504_82_624 179
128 iso_pu_bacteria 2599185353 2600199527 179
129 iso_pu_bacteria 2600254943 2600402453 179
130 iso_pu_bacteria 2980125574 2980128739 179
131 iso_pu_bacteria 3001267043 3001269250 179
132 iso_pu_bacteria 3001272096 3001274647 179
133 iso_pu_bacteria 3006973921 3006976669 179
134 iso_pu_bacteria 3006988479 3006991352 179
135 3300003758 Ga0055532_1000081 Ga0055532_100008132 180
136 3300005843 Ga0068860_100828612 Ga0068860_1008286121 180
137 3300009092 Ga0105250_10285096 Ga0105250_102850961 180
138 3300009098 Ga0105245_10013725 Ga0105245_100137255 180
139 3300009101 Ga0105247_10036879 Ga0105247_100368792 180
140 3300009148 Ga0105243_10001105 Ga0105243_100011058 180
141 3300009176 Ga0105242_10003356 Ga0105242_100033569 180
142 3300009553 Ga0105249_10622680 Ga0105249_106226801 180
143 3300011119 Ga0105246_10044413 Ga0105246_100444134 180
144 3300013296 Ga0157374_10111120 Ga0157374_101111203 180
145 3300013297 Ga0157378_10599586 Ga0157378_105995862 180
146 3300013307 Ga0157372_10812978 Ga0157372_108129782 180
147 3300014745 Ga0157377_10001631 Ga0157377_100016317 180
148 3300025229 Ga0209147_100028 Ga0209147_10002863 180
149 3300046457 Ga0495590_0071071 Ga0495590_0071071_28_573 180
150 3300046491 Ga0495584_0013173 Ga0495584_0013173_2205_2753 180
151 3300046492 Ga0495585_0046659 Ga0495585_0046659_295_843 180
152 3300046558 Ga0495633_0207239 Ga0495633_0207239_249_797 180
153 3300046648 Ga0495611_0279818 Ga0495611_0279818_203_751 180
154 3300046665 Ga0495661_0179022 Ga0495661_0179022_240_788 180
155 3300046691 Ga0495670_0255460 Ga0495670_0255460_114_662 180
156 3300046794 Ga0495589_0381543 Ga0495589_0381543_76_624 180
157 3300047321 Ga0495676_0136199 Ga0495676_0136199_1065_1613 180
158 3300047321 Ga0495676_0474887 Ga0495676_0474887_189_737 180
159 3300048903 Ga0496100_0000664 Ga0496100_0000664_3089_3637 180
160 3300048904 Ga0496101_0002358 Ga0496101_0002358_542_1090 180
161 3300048905 Ga0496102_0008385 Ga0496102_0008385_6533_7081 180
162 3300048905 Ga0496102_0010434 Ga0496102_0010434_2308_2871 180
163 3300048906 Ga0496103_0019968 Ga0496103_0019968_3062_3610 180
164 3300048906 Ga0496103_0021075 Ga0496103_0021075_1764_2327 180
165 3300048907 Ga0496104_0000326 Ga0496104_0000326_2029_2577 180
166 3300048908 Ga0496105_0014810 Ga0496105_0014810_2991_3539 180
167 3300048909 Ga0496106_0002828 Ga0496106_0002828_2058_2606 180
168 3300048910 Ga0496107_0017466 Ga0496107_0017466_2288_2836 180
169 3300048911 Ga0496108_0000285 Ga0496108_0000285_27391_27939 180
170 3300048912 Ga0496109_0000604 Ga0496109_0000604_1775_2323 180
171 3300048913 Ga0496110_0018237 Ga0496110_0018237_1989_2537 180
172 3300048914 Ga0496111_0003779 Ga0496111_0003779_8498_9046 180
173 3300048915 Ga0496112_0008531 Ga0496112_0008531_3898_4446 180
174 3300048916 Ga0496113_0040384 Ga0496113_0040384_2008_2556 180
175 3300048919 Ga0496116_0006138 Ga0496116_0006138_3008_3556 180
176 3300048919 Ga0496116_0020436 Ga0496116_0020436_2099_2644 180
177 3300048920 Ga0496117_0019254 Ga0496117_0019254_3000_3545 180
178 3300048922 Ga0496119_0000316 Ga0496119_0000316_26087_26632 180
179 3300048922 Ga0496119_0049758 Ga0496119_0049758_101_649 180
180 3300048923 Ga0496120_0002022 Ga0496120_0002022_21196_21741 180
181 3300048925 Ga0496122_0006515 Ga0496122_0006515_11053_11601 180
182 3300048925 Ga0496122_0129358 Ga0496122_0129358_660_1205 180
183 3300048927 Ga0496124_0000360 Ga0496124_0000360_11437_11982 180
184 3300048927 Ga0496124_0301272 Ga0496124_0301272_538_1086 180
185 3300048929 Ga0496126_0174185 Ga0496126_0174185_614_1162 180
186 3300049127 Ga0501306_001245 Ga0501306_001245_54_599 180
187 3300049129 Ga0501309_001299 Ga0501309_001299_173_718 180
188 3300049161 Ga0501305_051682 Ga0501305_051682_99_647 180
189 3300049161 Ga0501305_075922 Ga0501305_075922_14_559 180
190 3300049513 Ga0501290_045093 Ga0501290_045093_102_650 180
191 3300049527 Ga0501311_006216 Ga0501311_006216_560_1105 180
192 3300049528 Ga0501312_008242 Ga0501312_008242_562_1107 180
193 3300049528 Ga0501312_070143 Ga0501312_070143_44_592 180
194 3300049529 Ga0501313_035932 Ga0501313_035932_10_555 180
195 3300049532 Ga0501316_023346 Ga0501316_023346_234_779 180
196 3300049533 Ga0501317_057092 Ga0501317_057092_50_595 180
197 3300049540 Ga0501324_027908 Ga0501324_027908_12_557 180
198 3300049550 Ga0501334_16456 Ga0501334_16456_14_559 180
199 3300049655 Ga0501208_002216 Ga0501208_002216_1438_1983 180
200 3300049655 Ga0501208_054256 Ga0501208_054256_140_688 180
201 3300049661 Ga0501217_014844 Ga0501217_014844_837_1385 180
202 3300053178 Ga0500637_0000938 Ga0500637_0000938_11095_11652 180
203 iso_pu_bacteria 2808606364 2808870341 180
204 iso_pu_bacteria 2881633906 2881634641 180
205 iso_pu_bacteria 2881644220 2881646455 180
206 iso_pu_bacteria 3006826541 3006828545 180
207 iso_pu_bacteria 3006969106 3006971414 180
208 iso_pu_bacteria 3006984091 3006986823 180
209 3300003316 rootH1_10004929 rootH1_1000492943 181
210 3300003320 rootH2_10197881 rootH2_101978814 181
211 3300003322 rootL2_10001438 rootL2_1000143839 181
212 3300003323 rootH1_10335462 rootH1_103354623 181
213 3300003578 Ga0006562J51391_1000031 Ga0006562J51391_10000314 181
214 3300003578 Ga0006562J51391_1000939 Ga0006562J51391_10009391 181
215 3300003790 Ga0055528_1004027 Ga0055528_10040276 181
216 3300005328 Ga0070676_10270026 Ga0070676_102700262 181
217 3300005353 Ga0070669_100369891 Ga0070669_1003698912 181
218 3300005354 Ga0070675_100050020 Ga0070675_1000500203 181
219 3300005355 Ga0070671_100393727 Ga0070671_1003937272 181
220 3300014969 Ga0157376_10019209 Ga0157376_100192094 181
221 3300020070 Ga0206356_11743289 Ga0206356_117432891 181
222 3300020077 Ga0206351_10228536 Ga0206351_102285361 181
223 3300020080 Ga0206350_10791016 Ga0206350_107910161 181
224 3300025229 Ga0209147_101382 Ga0209147_1013824 181
225 3300025273 Ga0209673_1002583 Ga0209673_10025836 181
226 3300025294 Ga0209025_1005230 Ga0209025_10052304 181
227 3300025294 Ga0209025_1006697 Ga0209025_10066971 181
228 3300025302 Ga0207426_1013350 Ga0207426_10133501 181
229 3300025711 Ga0207696_1021115 Ga0207696_10211151 181
230 3300025735 Ga0207713_1006642 Ga0207713_10066425 181
231 3300025900 Ga0207710_10134392 Ga0207710_101343921 181
232 3300025926 Ga0207659_10159773 Ga0207659_101597732 181
233 3300025927 Ga0207687_10446562 Ga0207687_104465621 181
234 3300025931 Ga0207644_10378468 Ga0207644_103784682 181
235 3300025934 Ga0207686_10028804 Ga0207686_100288043 181
236 3300025935 Ga0207709_10026484 Ga0207709_100264844 181
237 3300031548 Ga0307408_100529510 Ga0307408_1005295101 181
238 3300031903 Ga0307407_10427320 Ga0307407_104273201 181
239 3300031995 Ga0307409_100613540 Ga0307409_1006135401 181
240 3300031995 Ga0307409_100782917 Ga0307409_1007829172 181
241 3300032002 Ga0307416_100046870 Ga0307416_1000468702 181
242 3300032002 Ga0307416_101540588 Ga0307416_1015405881 181
243 3300046474 Ga0495605_0141585 Ga0495605_0141585_347_895 181
244 3300046520 Ga0495637_0068460 Ga0495637_0068460_771_1319 181
245 3300046530 Ga0495654_0135244 Ga0495654_0135244_263_811 181
246 3300046538 Ga0495609_0166530 Ga0495609_0166530_332_880 181
247 3300046810 Ga0495660_0011995 Ga0495660_0011995_1316_1864 181
248 3300048091 Ga0495626_0024055 Ga0495626_0024055_672_1220 181
249 3300048905 Ga0496102_1280995 Ga0496102_1280995_54_602 181
250 3300048913 Ga0496110_0136925 Ga0496110_0136925_77_628 181
251 3300048914 Ga0496111_0591604 Ga0496111_0591604_129_677 181
252 3300049132 Ga0501343_013848 Ga0501343_013848_14_562 181
253 3300049133 Ga0501344_04087 Ga0501344_04087_152_700 181
254 3300049161 Ga0501305_003734 Ga0501305_003734_1174_1728 181
255 3300049161 Ga0501305_043781 Ga0501305_043781_92_640 181
256 3300049161 Ga0501305_069314 Ga0501305_069314_59_607 181
257 3300049161 Ga0501305_082646 Ga0501305_082646_10_564 181
258 3300049527 Ga0501311_046183 Ga0501311_046183_28_576 181
259 3300049528 Ga0501312_048999 Ga0501312_048999_10_558 181
260 3300049530 Ga0501314_034304 Ga0501314_034304_10_558 181
261 3300049531 Ga0501315_031751 Ga0501315_031751_120_668 181
262 3300049532 Ga0501316_018347 Ga0501316_018347_298_846 181
263 3300049532 Ga0501316_020436 Ga0501316_020436_264_818 181
264 3300049532 Ga0501316_026502 Ga0501316_026502_12_566 181
265 3300049534 Ga0501318_019827 Ga0501318_019827_63_611 181
266 3300049537 Ga0501321_036665 Ga0501321_036665_112_660 181
267 3300049539 Ga0501323_044917 Ga0501323_044917_98_646 181
268 3300049547 Ga0501331_05033 Ga0501331_05033_112_660 181
269 3300049550 Ga0501334_14802 Ga0501334_14802_14_562 181
270 3300049551 Ga0501335_009911 Ga0501335_009911_309_863 181
271 3300049551 Ga0501335_017268 Ga0501335_017268_79_627 181
272 3300049552 Ga0501336_006882 Ga0501336_006882_61_609 181
273 3300049552 Ga0501336_015344 Ga0501336_015344_90_638 181
274 3300049552 Ga0501336_020286 Ga0501336_020286_38_586 181
275 3300049553 Ga0501337_010163 Ga0501337_010163_120_668 181
276 3300049660 Ga0501216_081716 Ga0501216_081716_71_619 181
277 3300049681 Ga0501251_003583 Ga0501251_003583_924_1472 181
278 iso_pu_bacteria 8054280661 8054282226 181
279 3300013102 Ga0157371_10007792 Ga0157371_100077923 182
280 3300025294 Ga0209025_1022014 Ga0209025_10220141 182
281 3300027312 Ga0209371_1020309 Ga0209371_10203092 182
282 3300030500 Ga0268256_1002710 Ga0268256_10027102 182
283 3300032002 Ga0307416_100363942 Ga0307416_1003639422 182
284 3300046515 Ga0495620_0094688 Ga0495620_0094688_417_974 182
285 3300046665 Ga0495661_0167427 Ga0495661_0167427_521_1072 182
286 3300048903 Ga0496100_0173450 Ga0496100_0173450_818_1369 182
287 3300048904 Ga0496101_0173509 Ga0496101_0173509_761_1312 182
288 3300048912 Ga0496109_0139347 Ga0496109_0139347_1356_1913 182
289 3300048913 Ga0496110_0049450 Ga0496110_0049450_1549_2106 182
290 3300048914 Ga0496111_0075787 Ga0496111_0075787_1006_1563 182
291 3300048915 Ga0496112_0086357 Ga0496112_0086357_121_672 182
292 3300048916 Ga0496113_0365496 Ga0496113_0365496_124_675 182
293 3300048919 Ga0496116_0154029 Ga0496116_0154029_583_1146 182
294 3300048924 Ga0496121_0103177 Ga0496121_0103177_579_1136 182
295 3300049161 Ga0501305_038968 Ga0501305_038968_100_651 182
296 3300049531 Ga0501315_043374 Ga0501315_043374_21_578 182
297 3300049532 Ga0501316_031702 Ga0501316_031702_132_689 182
298 3300049537 Ga0501321_028034 Ga0501321_028034_158_715 182
299 3300049539 Ga0501323_035301 Ga0501323_035301_27_584 182
300 3300049652 Ga0501202_042571 Ga0501202_042571_17_574 182
301 3300049661 Ga0501217_053380 Ga0501217_053380_388_945 182
302 3300049773 Ga0501276_012243 Ga0501276_012243_82_639 182
303 iso_pu_bacteria 2897109615 2897113257 182
304 iso_pu_bacteria 8051952484 8051954247 182
305 3300037068 Ga0373925_0574398 Ga0373925_0574398_285_839 183
306 3300049552 Ga0501336_015963 Ga0501336_015963_79_633 183
307 iso_pu_bacteria 2511231119 2511701252 183
308 iso_pu_bacteria 2540341094 2540608446 183
309 iso_pu_bacteria 2545555800 2545559609 183
310 iso_pu_bacteria 2554235283 2555468420 183
311 iso_pu_bacteria 2576861599 2578930568 183
312 iso_pu_bacteria 2630968484 2631984579 183
313 iso_pu_bacteria 2643221735 2644738771 183
314 iso_pu_bacteria 2648501850 2651530869 183
315 iso_pu_bacteria 2671180844 2674421733 183
316 iso_pu_bacteria 2684623153 2686998567 183
317 iso_pu_bacteria 2687453109 2687499842 183
318 iso_pu_bacteria 2695420354 2695629206 183
319 iso_pu_bacteria 2716884898 2717915091 183
320 iso_pu_bacteria 2808606399 2809053584 183
321 iso_pu_bacteria 2811994870 2812317707 183
322 iso_pu_bacteria 2818991468 2819722758 183
323 iso_pu_bacteria 2823526263 2823529781 183
324 iso_pu_bacteria 2860837431 2860841252 183
325 iso_pu_bacteria 2877768649 2877772141 183
326 iso_pu_bacteria 2880169592 2880172979 183
327 iso_pu_bacteria 2904560550 2904561580 183
328 iso_pu_bacteria 2908665501 2908667042 183
329 iso_pu_bacteria 2919093281 2919094942 183
330 iso_pu_bacteria 2919726948 2919727517 183
331 iso_pu_bacteria 2954773129 2954776788 183
332 iso_pu_bacteria 2962290636 2962294479 183
333 iso_pu_bacteria 2969136845 2969140439 183
334 iso_pu_bacteria 2969141011 2969144697 183
335 iso_pu_bacteria 2969765954 2969768765 183
336 iso_pu_bacteria 2969770375 2969771100 183
337 iso_pu_bacteria 2971893375 2971896820 183
338 iso_pu_bacteria 2980492589 2980496251 183
339 iso_pu_bacteria 3006879489 3006882964 183
340 iso_pu_bacteria 8022630665 8022631285 183
341 iso_pu_bacteria 8022653035 8022656285 183
342 iso_pu_bacteria 8052174270 8052175670 183
343 3300003187 JGI25151J46595_10000011 JGI25151J46595_1000001137 187
344 3300003567 Ga0006554J51385_1018500 Ga0006554J51385_10185001 187
345 3300009036 Ga0105244_10269168 Ga0105244_102691681 187
346 3300025294 Ga0209025_1000011 Ga0209025_1000011568 187
347 3300048919 Ga0496116_0065301 Ga0496116_0065301_520_1083 187
348 3300048925 Ga0496122_0149720 Ga0496122_0149720_680_1243 187
349 3300048926 Ga0496123_0206275 Ga0496123_0206275_354_917 187
350 3300049161 Ga0501305_068728 Ga0501305_068728_30_593 187
351 3300049528 Ga0501312_070982 Ga0501312_070982_30_593 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16321

Ribosom_S30AE_C

Sigma 54 modulation/S30EA ribosomal protein C terminus

142

198

0.97

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

27

114

0.89

Feature Viewer

pLDDT pTM Quality
78.91 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map