F418754

General Info

Members Datasets Scaffolds Average Seq Length
351 208 351 223

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0001288|Ga0495629_0001288_15998_16735
Length 245
Sequence MLADEKLVSPAAQFGLDSRIGGVNGPRAASAPELKAQIEAERAGRPFLVFRDGADEQRIVTIAEGAAELWVGRGESADVRLGWDEEVSGLHAQIAVVRGEATLVDDGLSRNGSYVNEVRVHGRRHLRDGDAIRFGRTTVVYRRPGDTAPEATVVATDAPAAASVSPAQRKVLVALCRPYKDGGSFATPATNQQIGAELHLSVDAVKTHMRALFEKLGVGDLPQNQTRVALGERALQMGVVKSHEL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.99
Nodule 0
Rhizoplane 12.82
Rhizosphere 82.62
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10064065 3300005327 Archaea 2998
2 Ga0070658_10076887 3300005327 Bacteria 2738
3 Ga0070683_100335996 3300005329 Bacteria 1438
4 Ga0068869_100280796 3300005334 Bacteria 1339
5 Ga0068869_100330035 3300005334 Bacteria 1239
6 Ga0070682_100000100 3300005337 Bacteria 77054
7 Ga0068868_100005092 3300005338 Bacteria 9224
8 Ga0068868_100079803 3300005338 Bacteria 2622
9 Ga0070660_100000656 3300005339 Bacteria 22861
10 Ga0070689_100435667 3300005340 Bacteria 1113
11 Ga0070689_100676979 3300005340 Bacteria 899
12 Ga0070691_10187728 3300005341 Bacteria 1079
13 Ga0070687_100023376 3300005343 Bacteria 2937
14 Ga0070687_100025361 3300005343 Bacteria 2844
15 Ga0070661_100000031 3300005344 Bacteria 113816
16 Ga0070661_100082241 3300005344 Bacteria 2378
17 Ga0070661_100401890 3300005344 Bacteria 1083
18 Ga0070692_10091107 3300005345 Bacteria 1657
19 Ga0070668_100405632 3300005347 Bacteria 1164
20 Ga0070669_100047762 3300005353 Bacteria 3123
21 Ga0070675_100010455 3300005354 Bacteria 7250
22 Ga0070674_100030008 3300005356 Bacteria 3590
23 Ga0070674_100239351 3300005356 Bacteria 1420
24 Ga0070673_100317911 3300005364 Bacteria 1374
25 Ga0070688_100000064 3300005365 Bacteria 52662
26 Ga0070659_100005040 3300005366 Bacteria 9469
27 Ga0070659_101002817 3300005366 Bacteria 733
28 Ga0070710_10152510 3300005437 Bacteria 1426
29 Ga0070701_10063178 3300005438 Bacteria 1958
30 Ga0070711_100011048 3300005439 Bacteria 5601
31 Ga0070700_100072410 3300005441 Bacteria 2203
32 Ga0070700_100137244 3300005441 Bacteria 1658
33 Ga0070700_100230170 3300005441 Bacteria 1319
34 Ga0070700_100506240 3300005441 Bacteria 930
35 Ga0070694_100400546 3300005444 Bacteria 1074
36 Ga0070663_100001885 3300005455 Bacteria 11713
37 Ga0070678_100048315 3300005456 Bacteria 3063
38 Ga0070678_100393669 3300005456 Bacteria 1202
39 Ga0070662_100127825 3300005457 Bacteria 1955
40 Ga0068867_100014807 3300005459 Bacteria 5530
41 Ga0070685_10000154 3300005466 Bacteria 45505
42 Ga0070685_10048487 3300005466 Bacteria 2446
43 Ga0070685_10197719 3300005466 Bacteria 1305
44 Ga0070707_100369080 3300005468 Bacteria 1394
45 Ga0070707_100374203 3300005468 Bacteria 1384
46 Ga0070698_100908247 3300005471 Bacteria 826
47 Ga0070679_100175711 3300005530 Bacteria 2114
48 Ga0070684_100021366 3300005535 Bacteria 5384
49 Ga0070684_100440867 3300005535 Bacteria 1203
50 Ga0068853_100015153 3300005539 Bacteria 6338
51 Ga0068853_100260461 3300005539 Bacteria 1594
52 Ga0070672_100000023 3300005543 Bacteria 68631
53 Ga0070672_100003065 3300005543 Bacteria 10774
54 Ga0070686_100032308 3300005544 Bacteria 3208
55 Ga0070665_100210998 3300005548 Bacteria 1943
56 Ga0070704_100482912 3300005549 Unclassified 1072
57 Ga0070664_100354215 3300005564 Bacteria 1336
58 Ga0068854_100000107 3300005578 Bacteria 57836
59 Ga0068854_100002182 3300005578 Bacteria 12036
60 Ga0068854_100025912 3300005578 Bacteria 4025
61 Ga0068856_100364854 3300005614 Bacteria 1463
62 Ga0068856_100602556 3300005614 Unclassified 1119
63 Ga0068856_100794527 3300005614 Unclassified 966
64 Ga0070702_100008335 3300005615 Bacteria 5015
65 Ga0068852_100055949 3300005616 Bacteria 3407
66 Ga0068859_100223772 3300005617 Bacteria 1970
67 Ga0068864_100066795 3300005618 Bacteria 3122
68 Ga0068864_100233487 3300005618 Bacteria 1702
69 Ga0068864_101056580 3300005618 Bacteria 807
70 Ga0068866_10022083 3300005718 Bacteria 2941
71 Ga0068861_100049005 3300005719 Bacteria 3196
72 Ga0068861_100272810 3300005719 Bacteria 1453
73 Ga0068851_10000287 3300005834 Bacteria 23180
74 Ga0068870_10407552 3300005840 Bacteria 886
75 Ga0068858_100063007 3300005842 Bacteria 3430
76 Ga0068858_100363816 3300005842 Bacteria 1387
77 Ga0068860_100463641 3300005843 Unclassified 1261
78 Ga0068860_100616055 3300005843 Bacteria 1092
79 Ga0068862_100023207 3300005844 Bacteria 5196
80 Ga0081455_10049976 3300005937 Bacteria 3600
81 Ga0081455_10076420 3300005937 Bacteria 2759
82 Ga0081455_10284158 3300005937 Unclassified 1194
83 Ga0081538_10020878 3300005981 Bacteria 4804
84 Ga0081540_1000735 3300005983 Bacteria 30170
85 Ga0081539_10003289 3300005985 Bacteria 20230
86 Ga0081539_10017154 3300005985 Bacteria 5103
87 Ga0075365_10002695 3300006038 Bacteria 8843
88 Ga0075365_10124354 3300006038 Bacteria 1781
89 Ga0075363_100021935 3300006048 Bacteria 3224
90 Ga0075363_100028188 3300006048 Bacteria 2886
91 Ga0075364_10038282 3300006051 Bacteria 3107
92 Ga0075364_10078136 3300006051 Bacteria 2185
93 Ga0070712_100087763 3300006175 Bacteria 2270
94 Ga0070712_100514006 3300006175 Bacteria 1005
95 Ga0075428_100062614 3300006844 Bacteria 4073
96 Ga0075428_101211216 3300006844 Bacteria 796
97 Ga0075430_100331592 3300006846 Bacteria 1257
98 Ga0068865_100030533 3300006881 Bacteria 3586
99 Ga0068865_100039812 3300006881 Bacteria 3190
100 Ga0068865_100149821 3300006881 Bacteria 1769
101 Ga0097620_100223775 3300006931 Bacteria 1970
102 Ga0111539_10061015 3300009094 Bacteria 4468
103 Ga0111539_10090413 3300009094 Bacteria 3598
104 Ga0111539_10562252 3300009094 Bacteria 1328
105 Ga0111539_10748908 3300009094 Bacteria 1137
106 Ga0105245_10008945 3300009098 Bacteria 8732
107 Ga0105245_10051216 3300009098 Bacteria 3702
108 Ga0105245_10117062 3300009098 Bacteria 2485
109 Ga0105245_10720448 3300009098 Bacteria 1032
110 Ga0105247_10000407 3300009101 Bacteria 36488
111 Ga0105247_10119100 3300009101 Bacteria 1708
112 Ga0105243_10009463 3300009148 Bacteria 7422
113 Ga0105243_10271933 3300009148 Bacteria 1522
114 Ga0105242_10000245 3300009176 Bacteria 42792
115 Ga0105242_10054859 3300009176 Bacteria 3259
116 Ga0105242_10320497 3300009176 Bacteria 1421
117 Ga0105248_10083374 3300009177 Bacteria 3596
118 Ga0105237_10458230 3300009545 Bacteria 1281
119 Ga0105249_10024810 3300009553 Bacteria 5392
120 Ga0105249_10220425 3300009553 Unclassified 1866
121 Ga0105249_10242643 3300009553 Bacteria 1782
122 Ga0105249_10787975 3300009553 Bacteria 1014
123 Ga0105239_10017268 3300010375 Bacteria 7979
124 Ga0105239_10028278 3300010375 Bacteria 6167
125 Ga0105239_10581004 3300010375 Unclassified 1277
126 Ga0157378_10018044 3300013297 Bacteria 6196
127 Ga0157378_10081842 3300013297 Bacteria 2919
128 Ga0157375_10006986 3300013308 Bacteria 9856
129 Ga0157375_10023086 3300013308 Bacteria 5734
130 Ga0157375_10242869 3300013308 Bacteria 1960
131 Ga0157380_10000017 3300014326 Bacteria 119468
132 Ga0157380_10067655 3300014326 Bacteria 2877
133 Ga0157380_10183220 3300014326 Bacteria 1842
134 Ga0157380_10335504 3300014326 Bacteria 1408
135 Ga0182008_10023572 3300014497 Bacteria 3142
136 Ga0157377_10006545 3300014745 Bacteria 5563
137 Ga0157377_10023193 3300014745 Bacteria 3287
138 Ga0157377_10392185 3300014745 Bacteria 943
139 Ga0157377_10437043 3300014745 Bacteria 900
140 Ga0157379_10321171 3300014968 Bacteria 1414
141 Ga0207656_10000576 3300025321 Bacteria 12145
142 Ga0207692_10127965 3300025898 Bacteria 1431
143 Ga0207710_10000817 3300025900 Bacteria 16819
144 Ga0207688_10015276 3300025901 Bacteria 4167
145 Ga0207643_10436853 3300025908 Bacteria 831
146 Ga0207705_10019233 3300025909 Bacteria 4885
147 Ga0207705_10268492 3300025909 Bacteria 1304
148 Ga0207654_10026894 3300025911 Bacteria 3121
149 Ga0207693_10005718 3300025915 Bacteria 10328
150 Ga0207693_10436710 3300025915 Bacteria 1023
151 Ga0207663_10021419 3300025916 Bacteria 3680
152 Ga0207662_10114485 3300025918 Bacteria 1685
153 Ga0207657_10004970 3300025919 Bacteria 13991
154 Ga0207649_10000021 3300025920 Bacteria 209660
155 Ga0207649_10087707 3300025920 Bacteria 2030
156 Ga0207652_10164266 3300025921 Bacteria 1991
157 Ga0207659_10192566 3300025926 Bacteria 1624
158 Ga0207687_10031396 3300025927 Bacteria 3589
159 Ga0207687_10037625 3300025927 Bacteria 3303
160 Ga0207687_10159104 3300025927 Bacteria 1731
161 Ga0207690_10018371 3300025932 Bacteria 4289
162 Ga0207690_10201071 3300025932 Bacteria 1513
163 Ga0207706_10009875 3300025933 Bacteria 8756
164 Ga0207686_10000042 3300025934 Bacteria 122852
165 Ga0207686_10043002 3300025934 Bacteria 2765
166 Ga0207686_10263025 3300025934 Bacteria 1266
167 Ga0207709_10109564 3300025935 Bacteria 1844
168 Ga0207669_10168220 3300025937 Bacteria 1557
169 Ga0207704_10008145 3300025938 Bacteria 4992
170 Ga0207704_10019866 3300025938 Bacteria 3540
171 Ga0207665_10164634 3300025939 Bacteria 1598
172 Ga0207691_10000172 3300025940 Bacteria 60310
173 Ga0207691_10006847 3300025940 Bacteria 11000
174 Ga0207661_10055514 3300025944 Bacteria 3178
175 Ga0207661_10242225 3300025944 Bacteria 1601
176 Ga0207679_10278471 3300025945 Bacteria 1434
177 Ga0207679_10418838 3300025945 Bacteria 1182
178 Ga0207651_10114202 3300025960 Bacteria 2034
179 Ga0207712_10098399 3300025961 Unclassified 2169
180 Ga0207712_10543057 3300025961 Bacteria 999
181 Ga0207668_10159665 3300025972 Bacteria 1755
182 Ga0207668_10610628 3300025972 Bacteria 951
183 Ga0207640_10000026 3300025981 Bacteria 142343
184 Ga0207640_10008058 3300025981 Bacteria 5827
185 Ga0207640_10199220 3300025981 Bacteria 1516
186 Ga0207677_10177771 3300026023 Bacteria 1671
187 Ga0207703_10288247 3300026035 Bacteria 1493
188 Ga0207639_10025145 3300026041 Bacteria 4317
189 Ga0207639_10206421 3300026041 Bacteria 1688
190 Ga0207678_10000994 3300026067 Bacteria 25831
191 Ga0207708_10002088 3300026075 Bacteria 14696
192 Ga0207708_10032670 3300026075 Bacteria 3951
193 Ga0207708_10053970 3300026075 Bacteria 3063
194 Ga0207708_10399324 3300026075 Bacteria 1136
195 Ga0207648_10022910 3300026089 Bacteria 5602
196 Ga0207676_10032160 3300026095 Bacteria 3951
197 Ga0207674_10037977 3300026116 Bacteria 5003
198 Ga0207675_100015728 3300026118 Bacteria 7055
199 Ga0207675_100022882 3300026118 Bacteria 5813
200 Ga0207675_100509837 3300026118 Bacteria 1198
201 Ga0207683_10102102 3300026121 Bacteria 2561
202 Ga0207683_10105569 3300026121 Unclassified 2518
203 Ga0207698_10469667 3300026142 Bacteria 1218
204 Ga0207428_10159447 3300027907 Bacteria 1714
205 Ga0207428_10281922 3300027907 Bacteria 1233
206 Ga0268264_10167818 3300028381 Bacteria 1983
207 Ga0268264_10252772 3300028381 Bacteria 1638
208 Ga0268264_10309014 3300028381 Bacteria 1491
209 Ga0265337_1001302 3300028556 Bacteria 12454
210 Ga0265326_10000027 3300028558 Bacteria 110843
211 Ga0265334_10020312 3300028573 Bacteria 2721
212 Ga0265318_10057933 3300028577 Bacteria 1447
213 Ga0265322_10000003 3300028654 Bacteria 468671
214 Ga0265336_10004126 3300028666 Bacteria 5535
215 Ga0265324_10000074 3300029957 Bacteria 78102
216 Ga0265330_10089744 3300031235 Bacteria 1320
217 Ga0265328_10003810 3300031239 Bacteria 6627
218 Ga0265320_10000001 3300031240 Bacteria 847191
219 Ga0265329_10005849 3300031242 Bacteria 4935
220 Ga0265339_10126264 3300031249 Bacteria 1311
221 Ga0265331_10002908 3300031250 Bacteria 11321
222 Ga0265327_10000003 3300031251 Bacteria 852750
223 Ga0265314_10000222 3300031711 Bacteria 84593
224 Ga0265342_10096729 3300031712 Bacteria 1687
225 Ga0307405_10077507 3300031731 Bacteria 2160
226 Ga0307405_10226276 3300031731 Bacteria 1376
227 Ga0307413_10012785 3300031824 Bacteria 4191
228 Ga0307413_10126033 3300031824 Bacteria 1744
229 Ga0307410_10022403 3300031852 Bacteria 3904
230 Ga0307410_10196109 3300031852 Bacteria 1539
231 Ga0307406_10048859 3300031901 Bacteria 2675
232 Ga0307406_10499208 3300031901 Bacteria 986
233 Ga0307412_10032281 3300031911 Bacteria 3316
234 Ga0307409_100003819 3300031995 Bacteria 8311
235 Ga0307416_100351884 3300032002 Unclassified 1491
236 Ga0307415_100074112 3300032126 Bacteria 2404
237 Ga0373960_0146023 3300035121 Unclassified 805
238 Ga0316582_0402175 3300036647 Bacteria 943
239 Ga0436365_1156738 3300039437 Bacteria 4263
240 Ga0436363_1313926 3300039450 Bacteria 2734
241 Ga0466963_0402528 3300044694 Bacteria 965
242 Ga0466960_0047712 3300044901 Bacteria 2055
243 Ga0466960_0174131 3300044901 Unclassified 1163
244 Ga0466958_0336549 3300045836 Bacteria 971
245 Ga0466967_0028746 3300045976 Bacteria 4645
246 Ga0466967_0217118 3300045976 Bacteria 1816
247 Ga0466967_0299961 3300045976 Bacteria 1546
248 Ga0466967_0887442 3300045976 Bacteria 886
249 Ga0495603_0000044 3300046455 Bacteria 53548
250 Ga0495629_0001288 3300046459 Bacteria 19721
251 Ga0495629_0288709 3300046459 Bacteria 1125
252 Ga0495638_0014624 3300046460 Bacteria 5296
253 Ga0495641_0015395 3300046461 Bacteria 4086
254 Ga0495662_0003766 3300046476 Bacteria 7650
255 Ga0495664_0137618 3300046477 Bacteria 1480
256 Ga0495608_0388762 3300046511 Bacteria 854
257 Ga0495630_0000007 3300046517 Bacteria 376915
258 Ga0495630_0150407 3300046517 Bacteria 1771
259 Ga0495652_0000003 3300046529 Bacteria 597094
260 Ga0495640_0015217 3300046533 Bacteria 5793
261 Ga0495625_0000204 3300046660 Bacteria 94356
262 Ga0495647_0000297 3300046681 Bacteria 13902
263 Ga0495647_0123585 3300046681 Bacteria 1091
264 Ga0495624_0000177 3300046690 Bacteria 47322
265 Ga0495674_0000027 3300047319 Bacteria 132744
266 Ga0495674_0430254 3300047319 Bacteria 1062
267 Ga0495676_0027288 3300047321 Bacteria 4898
268 Ga0495676_0069254 3300047321 Bacteria 2723
269 Ga0495680_0087265 3300047322 Bacteria 2347
270 Ga0495675_0041416 3300047444 Bacteria 2936
271 Ga0495686_0054066 3300047472 Bacteria 2515
272 Ga0496100_0006091 3300048903 Bacteria 6555
273 Ga0496100_0372124 3300048903 Unclassified 1084
274 Ga0496101_0276889 3300048904 Unclassified 1311
275 Ga0496101_0286290 3300048904 Unclassified 1289
276 Ga0496101_0321264 3300048904 Bacteria 1214
277 Ga0496102_0066757 3300048905 Bacteria 3298
278 Ga0496103_0066470 3300048906 Unclassified 2250
279 Ga0496104_0007798 3300048907 Bacteria 9490
280 Ga0496105_0041699 3300048908 Bacteria 3782
281 Ga0496106_0002210 3300048909 Bacteria 14512
282 Ga0496106_0060538 3300048909 Bacteria 2870
283 Ga0496106_0091718 3300048909 Bacteria 2346
284 Ga0496106_0373799 3300048909 Unclassified 1145
285 Ga0496107_0104521 3300048910 Unclassified 2078
286 Ga0496107_0255771 3300048910 Bacteria 1303
287 Ga0496107_0391173 3300048910 Unclassified 1034
288 Ga0496108_0000806 3300048911 Bacteria 24332
289 Ga0496108_0012129 3300048911 Bacteria 7008
290 Ga0496108_0294783 3300048911 Bacteria 1412
291 Ga0496108_0597501 3300048911 Bacteria 962
292 Ga0496108_0656246 3300048911 Bacteria 912
293 Ga0496109_0021702 3300048912 Bacteria 5682
294 Ga0496109_0195232 3300048912 Unclassified 1902
295 Ga0496109_0259860 3300048912 Bacteria 1636
296 Ga0496109_0990432 3300048912 Bacteria 778
297 Ga0496110_0000004 3300048913 Bacteria 122867
298 Ga0496110_0033461 3300048913 Bacteria 4446
299 Ga0496110_0034617 3300048913 Bacteria 4377
300 Ga0496110_0037058 3300048913 Bacteria 4237
301 Ga0496110_0182905 3300048913 Bacteria 1903
302 Ga0496110_0827470 3300048913 Bacteria 831
303 Ga0496111_0000007 3300048914 Bacteria 103885
304 Ga0496111_0044224 3300048914 Bacteria 3201
305 Ga0496111_0124999 3300048914 Bacteria 1901
306 Ga0496112_0036245 3300048915 Bacteria 4811
307 Ga0496112_0042722 3300048915 Bacteria 4436
308 Ga0496112_0089922 3300048915 Bacteria 3039
309 Ga0496113_0000460 3300048916 Bacteria 19823
310 Ga0496113_0003255 3300048916 Bacteria 9686
311 Ga0496113_0057938 3300048916 Bacteria 2913
312 Ga0496113_0434694 3300048916 Bacteria 1054
313 Ga0496114_0028557 3300048917 Bacteria 4578
314 Ga0496114_0060722 3300048917 Bacteria 3160
315 Ga0496114_0346499 3300048917 Unclassified 1314
316 Ga0496114_0478461 3300048917 Bacteria 1102
317 Ga0501039_0106480 3300049575 Bacteria 2190
318 Ga0501040_0301716 3300049576 Bacteria 1145
319 Ga0501042_0028926 3300049578 Bacteria 3908
320 Ga0501042_0055077 3300049578 Bacteria 2837
321 Ga0501068_0121160 3300049584 Bacteria 1631
322 Ga0501070_0054073 3300049586 Bacteria 3329
323 Ga0501071_0029090 3300049587 Bacteria 3897
324 Ga0501071_0135079 3300049587 Bacteria 1835
325 Ga0501071_0567465 3300049587 Unclassified 872
326 Ga0501072_0172934 3300049588 Bacteria 1723
327 Ga0501072_0275323 3300049588 Bacteria 1339
328 Ga0501072_0317806 3300049588 Bacteria 1237
329 Ga0501073_0054974 3300049589 Bacteria 2786
330 Ga0501074_0040303 3300049590 Bacteria 3383
331 Ga0501075_0250722 3300049591 Bacteria 1349
332 Ga0501076_0082200 3300049592 Bacteria 2586
333 Ga0501076_0300305 3300049592 Bacteria 1316
334 Ga0501077_0294935 3300049593 Bacteria 1033
335 nmdc:mga03n38_31630_c1 3300050490 Bacteria 2235
336 nmdc:mga03n38_7537_c1 3300050490 Bacteria 3855
337 nmdc:mga00v17_30140_c1 3300050491 Bacteria 3190
338 nmdc:mga00v17_37435_c1 3300050491 Bacteria 2073
339 nmdc:mga0yw44_398838_c1 3300050492 Unclassified 930
340 nmdc:mga0yw44_6426_c1 3300050492 Bacteria 5679
341 nmdc:mga0yw44_700_c1 3300050492 Bacteria 12279
342 nmdc:mga0qj67_302088_c1 3300050509 Bacteria 1297
343 nmdc:mga06r32_554887_c1 3300050510 Bacteria 1122
344 nmdc:mga08y16_130857_c1 3300050511 Bacteria 2609
345 nmdc:mga08y16_389571_c1 3300050511 Bacteria 1428
346 nmdc:mga08y16_580948_c1 3300050511 Bacteria 1131
347 Ga0495655_0000765 3300053083 Bacteria 5048
348 Ga0495619_0000038 3300053085 Bacteria 121365
349 Ga0500641_0006502 3300053096 Bacteria 4146
350 Ga0501082_0471282 3300060353 Bacteria 1097
351 Ga0466962_0039967 3300061719 Bacteria 2246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100514006 Ga0070712_1005140061 194
2 3300025915 Ga0207693_10436710 Ga0207693_104367101 194
3 3300048910 Ga0496107_0391173 Ga0496107_0391173_421_1011 196
4 3300048913 Ga0496110_0827470 Ga0496110_0827470_179_784 197
5 3300046529 Ga0495652_0000003 Ga0495652_0000003_563258_563932 200
6 3300005985 Ga0081539_10017154 Ga0081539_100171545 203
7 3300026035 Ga0207703_10288247 Ga0207703_102882472 203
8 3300036647 Ga0316582_0402175 Ga0316582_0402175_10_627 204
9 3300005549 Ga0070704_100482912 Ga0070704_1004829121 205
10 3300005983 Ga0081540_1000735 Ga0081540_10007359 205
11 3300046533 Ga0495640_0015217 Ga0495640_0015217_2886_3560 205
12 3300047319 Ga0495674_0000027 Ga0495674_0000027_49934_50608 205
13 3300047444 Ga0495675_0041416 Ga0495675_0041416_1091_1765 205
14 3300005981 Ga0081538_10020878 Ga0081538_100208782 206
15 3300005548 Ga0070665_100210998 Ga0070665_1002109982 208
16 3300005842 Ga0068858_100363816 Ga0068858_1003638161 210
17 3300005843 Ga0068860_100463641 Ga0068860_1004636412 210
18 3300006038 Ga0075365_10124354 Ga0075365_101243541 210
19 3300014968 Ga0157379_10321171 Ga0157379_103211711 210
20 3300028381 Ga0268264_10252772 Ga0268264_102527721 210
21 3300039437 Ga0436365_1156738 Ga0436365_1156738_1051_1722 210
22 3300039450 Ga0436363_1313926 Ga0436363_1313926_1684_2403 210
23 3300047472 Ga0495686_0054066 Ga0495686_0054066_253_981 210
24 3300050492 nmdc:mga0yw44_700_c1 nmdc:mga0yw44_700_c1_8000_8683 210
25 3300050509 nmdc:mga0qj67_302088_c1 nmdc:mga0qj67_302088_c1_332_970 211
26 3300009098 Ga0105245_10720448 Ga0105245_107204481 214
27 3300005840 Ga0068870_10407552 Ga0068870_104075521 215
28 3300025908 Ga0207643_10436853 Ga0207643_104368532 215
29 3300048903 Ga0496100_0372124 Ga0496100_0372124_249_905 215
30 3300005334 Ga0068869_100330035 Ga0068869_1003300352 217
31 3300009094 Ga0111539_10562252 Ga0111539_105622522 217
32 3300014745 Ga0157377_10392185 Ga0157377_103921851 217
33 3300028556 Ga0265337_1001302 Ga0265337_10013022 217
34 3300028558 Ga0265326_10000027 Ga0265326_1000002774 217
35 3300028577 Ga0265318_10057933 Ga0265318_100579332 217
36 3300028654 Ga0265322_10000003 Ga0265322_10000003215 217
37 3300028666 Ga0265336_10004126 Ga0265336_100041266 217
38 3300029957 Ga0265324_10000074 Ga0265324_1000007481 217
39 3300031235 Ga0265330_10089744 Ga0265330_100897442 217
40 3300031239 Ga0265328_10003810 Ga0265328_1000381010 217
41 3300031240 Ga0265320_10000001 Ga0265320_10000001215 217
42 3300031242 Ga0265329_10005849 Ga0265329_100058495 217
43 3300031249 Ga0265339_10126264 Ga0265339_101262641 217
44 3300031250 Ga0265331_10002908 Ga0265331_100029088 217
45 3300031251 Ga0265327_10000003 Ga0265327_10000003215 217
46 3300031711 Ga0265314_10000222 Ga0265314_1000022213 217
47 3300031712 Ga0265342_10096729 Ga0265342_100967292 217
48 3300044901 Ga0466960_0047712 Ga0466960_0047712_1251_1922 217
49 3300045836 Ga0466958_0336549 Ga0466958_0336549_185_850 217
50 3300046455 Ga0495603_0000044 Ga0495603_0000044_19027_19683 217
51 3300048911 Ga0496108_0597501 Ga0496108_0597501_254_919 217
52 3300048912 Ga0496109_0990432 Ga0496109_0990432_70_735 217
53 3300048915 Ga0496112_0089922 Ga0496112_0089922_1181_1876 217
54 3300048917 Ga0496114_0060722 Ga0496114_0060722_1888_2544 217
55 3300050511 nmdc:mga08y16_580948_c1 nmdc:mga08y16_580948_c1_25_714 217
56 3300061719 Ga0466962_0039967 Ga0466962_0039967_1522_2187 217
57 3300005356 Ga0070674_100239351 Ga0070674_1002393511 218
58 3300014745 Ga0157377_10437043 Ga0157377_104370431 218
59 3300026118 Ga0207675_100509837 Ga0207675_1005098371 218
60 3300032002 Ga0307416_100351884 Ga0307416_1003518842 218
61 3300045976 Ga0466967_0299961 Ga0466967_0299961_717_1388 218
62 3300005327 Ga0070658_10076887 Ga0070658_100768872 219
63 3300005329 Ga0070683_100335996 Ga0070683_1003359961 219
64 3300005338 Ga0068868_100005092 Ga0068868_1000050922 219
65 3300005339 Ga0070660_100000656 Ga0070660_1000006564 219
66 3300005343 Ga0070687_100023376 Ga0070687_1000233762 219
67 3300005344 Ga0070661_100082241 Ga0070661_1000822411 219
68 3300005345 Ga0070692_10091107 Ga0070692_100911072 219
69 3300005347 Ga0070668_100405632 Ga0070668_1004056322 219
70 3300005353 Ga0070669_100047762 Ga0070669_1000477622 219
71 3300005354 Ga0070675_100010455 Ga0070675_1000104555 219
72 3300005356 Ga0070674_100030008 Ga0070674_1000300082 219
73 3300005364 Ga0070673_100317911 Ga0070673_1003179112 219
74 3300005366 Ga0070659_100005040 Ga0070659_1000050407 219
75 3300005441 Ga0070700_100137244 Ga0070700_1001372442 219
76 3300005441 Ga0070700_100230170 Ga0070700_1002301702 219
77 3300005455 Ga0070663_100001885 Ga0070663_10000188513 219
78 3300005456 Ga0070678_100048315 Ga0070678_1000483152 219
79 3300005457 Ga0070662_100127825 Ga0070662_1001278252 219
80 3300005459 Ga0068867_100014807 Ga0068867_1000148072 219
81 3300005466 Ga0070685_10048487 Ga0070685_100484872 219
82 3300005530 Ga0070679_100175711 Ga0070679_1001757112 219
83 3300005535 Ga0070684_100021366 Ga0070684_1000213661 219
84 3300005539 Ga0068853_100015153 Ga0068853_1000151532 219
85 3300005543 Ga0070672_100003065 Ga0070672_1000030657 219
86 3300005544 Ga0070686_100032308 Ga0070686_1000323082 219
87 3300005578 Ga0068854_100002182 Ga0068854_1000021828 219
88 3300005616 Ga0068852_100055949 Ga0068852_1000559494 219
89 3300005618 Ga0068864_100066795 Ga0068864_1000667952 219
90 3300005718 Ga0068866_10022083 Ga0068866_100220832 219
91 3300005719 Ga0068861_100272810 Ga0068861_1002728102 219
92 3300005842 Ga0068858_100063007 Ga0068858_1000630072 219
93 3300005843 Ga0068860_100616055 Ga0068860_1006160552 219
94 3300005844 Ga0068862_100023207 Ga0068862_1000232072 219
95 3300005937 Ga0081455_10284158 Ga0081455_102841581 219
96 3300006038 Ga0075365_10002695 Ga0075365_100026958 219
97 3300006048 Ga0075363_100028188 Ga0075363_1000281882 219
98 3300006051 Ga0075364_10038282 Ga0075364_100382822 219
99 3300006881 Ga0068865_100039812 Ga0068865_1000398122 219
100 3300009094 Ga0111539_10090413 Ga0111539_100904132 219
101 3300009094 Ga0111539_10748908 Ga0111539_107489082 219
102 3300009098 Ga0105245_10051216 Ga0105245_100512164 219
103 3300009148 Ga0105243_10009463 Ga0105243_100094632 219
104 3300009148 Ga0105243_10271933 Ga0105243_102719332 219
105 3300009176 Ga0105242_10320497 Ga0105242_103204972 219
106 3300009545 Ga0105237_10458230 Ga0105237_104582302 219
107 3300009553 Ga0105249_10242643 Ga0105249_102426432 219
108 3300010375 Ga0105239_10017268 Ga0105239_100172684 219
109 3300013308 Ga0157375_10006986 Ga0157375_100069868 219
110 3300014326 Ga0157380_10067655 Ga0157380_100676552 219
111 3300014326 Ga0157380_10335504 Ga0157380_103355041 219
112 3300014745 Ga0157377_10023193 Ga0157377_100231932 219
113 3300025901 Ga0207688_10015276 Ga0207688_100152762 219
114 3300025909 Ga0207705_10268492 Ga0207705_102684922 219
115 3300025918 Ga0207662_10114485 Ga0207662_101144852 219
116 3300025919 Ga0207657_10004970 Ga0207657_100049706 219
117 3300025920 Ga0207649_10087707 Ga0207649_100877072 219
118 3300025921 Ga0207652_10164266 Ga0207652_101642662 219
119 3300025926 Ga0207659_10192566 Ga0207659_101925662 219
120 3300025927 Ga0207687_10031396 Ga0207687_100313964 219
121 3300025932 Ga0207690_10201071 Ga0207690_102010712 219
122 3300025933 Ga0207706_10009875 Ga0207706_100098757 219
123 3300025934 Ga0207686_10263025 Ga0207686_102630252 219
124 3300025935 Ga0207709_10109564 Ga0207709_101095642 219
125 3300025937 Ga0207669_10168220 Ga0207669_101682202 219
126 3300025938 Ga0207704_10019866 Ga0207704_100198662 219
127 3300025940 Ga0207691_10006847 Ga0207691_100068475 219
128 3300025960 Ga0207651_10114202 Ga0207651_101142022 219
129 3300025972 Ga0207668_10159665 Ga0207668_101596652 219
130 3300025981 Ga0207640_10008058 Ga0207640_100080582 219
131 3300026023 Ga0207677_10177771 Ga0207677_101777712 219
132 3300026041 Ga0207639_10025145 Ga0207639_100251453 219
133 3300026067 Ga0207678_10000994 Ga0207678_1000099413 219
134 3300026075 Ga0207708_10002088 Ga0207708_1000208813 219
135 3300026075 Ga0207708_10053970 Ga0207708_100539702 219
136 3300026089 Ga0207648_10022910 Ga0207648_100229102 219
137 3300026095 Ga0207676_10032160 Ga0207676_100321603 219
138 3300026116 Ga0207674_10037977 Ga0207674_100379774 219
139 3300026118 Ga0207675_100015728 Ga0207675_1000157282 219
140 3300026121 Ga0207683_10102102 Ga0207683_101021023 219
141 3300027907 Ga0207428_10281922 Ga0207428_102819222 219
142 3300028381 Ga0268264_10309014 Ga0268264_103090142 219
143 3300031731 Ga0307405_10077507 Ga0307405_100775071 219
144 3300031824 Ga0307413_10012785 Ga0307413_100127855 219
145 3300031852 Ga0307410_10022403 Ga0307410_100224032 219
146 3300031911 Ga0307412_10032281 Ga0307412_100322814 219
147 3300031995 Ga0307409_100003819 Ga0307409_1000038195 219
148 3300032126 Ga0307415_100074112 Ga0307415_1000741122 219
149 3300048905 Ga0496102_0066757 Ga0496102_0066757_2590_3261 219
150 3300048909 Ga0496106_0002210 Ga0496106_0002210_6021_6692 219
151 3300048910 Ga0496107_0255771 Ga0496107_0255771_98_769 219
152 3300048911 Ga0496108_0012129 Ga0496108_0012129_5852_6523 219
153 3300048912 Ga0496109_0021702 Ga0496109_0021702_1176_1847 219
154 3300048913 Ga0496110_0034617 Ga0496110_0034617_2724_3395 219
155 3300048914 Ga0496111_0124999 Ga0496111_0124999_400_1071 219
156 3300048916 Ga0496113_0434694 Ga0496113_0434694_43_714 219
157 3300049592 Ga0501076_0082200 Ga0501076_0082200_1055_1735 219
158 3300050490 nmdc:mga03n38_31630_c1 nmdc:mga03n38_31630_c1_969_1640 219
159 3300050491 nmdc:mga00v17_30140_c1 nmdc:mga00v17_30140_c1_933_1604 219
160 3300050492 nmdc:mga0yw44_6426_c1 nmdc:mga0yw44_6426_c1_4381_5052 219
161 3300050511 nmdc:mga08y16_130857_c1 nmdc:mga08y16_130857_c1_1525_2196 219
162 3300005334 Ga0068869_100280796 Ga0068869_1002807962 220
163 3300005338 Ga0068868_100079803 Ga0068868_1000798033 220
164 3300005340 Ga0070689_100676979 Ga0070689_1006769792 220
165 3300005341 Ga0070691_10187728 Ga0070691_101877281 220
166 3300005343 Ga0070687_100025361 Ga0070687_1000253612 220
167 3300005344 Ga0070661_100401890 Ga0070661_1004018902 220
168 3300005438 Ga0070701_10063178 Ga0070701_100631782 220
169 3300005441 Ga0070700_100072410 Ga0070700_1000724103 220
170 3300005441 Ga0070700_100506240 Ga0070700_1005062401 220
171 3300005468 Ga0070707_100369080 Ga0070707_1003690802 220
172 3300005471 Ga0070698_100908247 Ga0070698_1009082471 220
173 3300005535 Ga0070684_100440867 Ga0070684_1004408672 220
174 3300005539 Ga0068853_100260461 Ga0068853_1002604612 220
175 3300005578 Ga0068854_100000107 Ga0068854_10000010724 220
176 3300005578 Ga0068854_100025912 Ga0068854_1000259125 220
177 3300005615 Ga0070702_100008335 Ga0070702_1000083352 220
178 3300005617 Ga0068859_100223772 Ga0068859_1002237722 220
179 3300005618 Ga0068864_100233487 Ga0068864_1002334872 220
180 3300005618 Ga0068864_101056580 Ga0068864_1010565801 220
181 3300005719 Ga0068861_100049005 Ga0068861_1000490053 220
182 3300006844 Ga0075428_100062614 Ga0075428_1000626145 220
183 3300006844 Ga0075428_101211216 Ga0075428_1012112161 220
184 3300006881 Ga0068865_100030533 Ga0068865_1000305332 220
185 3300006931 Ga0097620_100223775 Ga0097620_1002237752 220
186 3300009094 Ga0111539_10061015 Ga0111539_100610156 220
187 3300009098 Ga0105245_10117062 Ga0105245_101170622 220
188 3300009553 Ga0105249_10024810 Ga0105249_100248104 220
189 3300009553 Ga0105249_10787975 Ga0105249_107879751 220
190 3300014497 Ga0182008_10023572 Ga0182008_100235722 220
191 3300014745 Ga0157377_10006545 Ga0157377_100065454 220
192 3300025927 Ga0207687_10159104 Ga0207687_101591041 220
193 3300025938 Ga0207704_10008145 Ga0207704_100081453 220
194 3300025944 Ga0207661_10055514 Ga0207661_100555142 220
195 3300025944 Ga0207661_10242225 Ga0207661_102422252 220
196 3300025945 Ga0207679_10278471 Ga0207679_102784712 220
197 3300025961 Ga0207712_10543057 Ga0207712_105430571 220
198 3300025972 Ga0207668_10610628 Ga0207668_106106281 220
199 3300025981 Ga0207640_10000026 Ga0207640_1000002642 220
200 3300025981 Ga0207640_10199220 Ga0207640_101992202 220
201 3300026041 Ga0207639_10206421 Ga0207639_102064212 220
202 3300026075 Ga0207708_10032670 Ga0207708_100326703 220
203 3300026075 Ga0207708_10399324 Ga0207708_103993242 220
204 3300026118 Ga0207675_100022882 Ga0207675_1000228827 220
205 3300026142 Ga0207698_10469667 Ga0207698_104696672 220
206 3300027907 Ga0207428_10159447 Ga0207428_101594471 220
207 3300028381 Ga0268264_10167818 Ga0268264_101678183 220
208 3300031731 Ga0307405_10226276 Ga0307405_102262761 220
209 3300031824 Ga0307413_10126033 Ga0307413_101260332 220
210 3300031852 Ga0307410_10196109 Ga0307410_101961092 220
211 3300031901 Ga0307406_10048859 Ga0307406_100488592 220
212 3300031901 Ga0307406_10499208 Ga0307406_104992081 220
213 3300044694 Ga0466963_0402528 Ga0466963_0402528_264_944 220
214 3300044901 Ga0466960_0174131 Ga0466960_0174131_46_744 220
215 3300045976 Ga0466967_0028746 Ga0466967_0028746_848_1528 220
216 3300045976 Ga0466967_0217118 Ga0466967_0217118_540_1220 220
217 3300045976 Ga0466967_0887442 Ga0466967_0887442_67_747 220
218 3300046511 Ga0495608_0388762 Ga0495608_0388762_17_706 220
219 3300048904 Ga0496101_0286290 Ga0496101_0286290_518_1210 220
220 3300048909 Ga0496106_0091718 Ga0496106_0091718_1590_2273 220
221 3300048911 Ga0496108_0656246 Ga0496108_0656246_24_707 220
222 3300048917 Ga0496114_0478461 Ga0496114_0478461_132_815 220
223 3300049576 Ga0501040_0301716 Ga0501040_0301716_141_815 220
224 3300049591 Ga0501075_0250722 Ga0501075_0250722_223_897 220
225 3300049593 Ga0501077_0294935 Ga0501077_0294935_169_843 220
226 3300050510 nmdc:mga06r32_554887_c1 nmdc:mga06r32_554887_c1_305_982 220
227 3300050511 nmdc:mga08y16_389571_c1 nmdc:mga08y16_389571_c1_209_886 220
228 3300005327 Ga0070658_10064065 Ga0070658_100640652 221
229 3300005337 Ga0070682_100000100 Ga0070682_10000010061 221
230 3300005340 Ga0070689_100435667 Ga0070689_1004356671 221
231 3300005344 Ga0070661_100000031 Ga0070661_10000003121 221
232 3300005365 Ga0070688_100000064 Ga0070688_10000006428 221
233 3300005366 Ga0070659_101002817 Ga0070659_1010028171 221
234 3300005437 Ga0070710_10152510 Ga0070710_101525102 221
235 3300005439 Ga0070711_100011048 Ga0070711_1000110484 221
236 3300005444 Ga0070694_100400546 Ga0070694_1004005462 221
237 3300005456 Ga0070678_100393669 Ga0070678_1003936691 221
238 3300005466 Ga0070685_10000154 Ga0070685_1000015437 221
239 3300005466 Ga0070685_10197719 Ga0070685_101977192 221
240 3300005468 Ga0070707_100374203 Ga0070707_1003742032 221
241 3300005543 Ga0070672_100000023 Ga0070672_10000002361 221
242 3300005564 Ga0070664_100354215 Ga0070664_1003542154 221
243 3300005614 Ga0068856_100364854 Ga0068856_1003648542 221
244 3300005614 Ga0068856_100602556 Ga0068856_1006025562 221
245 3300005614 Ga0068856_100794527 Ga0068856_1007945271 221
246 3300005834 Ga0068851_10000287 Ga0068851_1000028711 221
247 3300005937 Ga0081455_10049976 Ga0081455_100499762 221
248 3300005937 Ga0081455_10076420 Ga0081455_100764202 221
249 3300005985 Ga0081539_10003289 Ga0081539_1000328911 221
250 3300006048 Ga0075363_100021935 Ga0075363_1000219353 221
251 3300006051 Ga0075364_10078136 Ga0075364_100781363 221
252 3300006175 Ga0070712_100087763 Ga0070712_1000877632 221
253 3300006846 Ga0075430_100331592 Ga0075430_1003315922 221
254 3300006881 Ga0068865_100149821 Ga0068865_1001498212 221
255 3300009098 Ga0105245_10008945 Ga0105245_1000894515 221
256 3300009101 Ga0105247_10000407 Ga0105247_100004074 221
257 3300009101 Ga0105247_10119100 Ga0105247_101191002 221
258 3300009176 Ga0105242_10000245 Ga0105242_1000024521 221
259 3300009176 Ga0105242_10054859 Ga0105242_100548594 221
260 3300009177 Ga0105248_10083374 Ga0105248_100833744 221
261 3300009553 Ga0105249_10220425 Ga0105249_102204252 221
262 3300010375 Ga0105239_10028278 Ga0105239_100282789 221
263 3300010375 Ga0105239_10581004 Ga0105239_105810042 221
264 3300013297 Ga0157378_10018044 Ga0157378_100180446 221
265 3300013297 Ga0157378_10081842 Ga0157378_100818422 221
266 3300013308 Ga0157375_10023086 Ga0157375_100230863 221
267 3300013308 Ga0157375_10242869 Ga0157375_102428692 221
268 3300014326 Ga0157380_10000017 Ga0157380_1000001767 221
269 3300014326 Ga0157380_10183220 Ga0157380_101832202 221
270 3300025321 Ga0207656_10000576 Ga0207656_100005766 221
271 3300025898 Ga0207692_10127965 Ga0207692_101279652 221
272 3300025900 Ga0207710_10000817 Ga0207710_1000081712 221
273 3300025909 Ga0207705_10019233 Ga0207705_100192332 221
274 3300025911 Ga0207654_10026894 Ga0207654_100268944 221
275 3300025915 Ga0207693_10005718 Ga0207693_1000571813 221
276 3300025916 Ga0207663_10021419 Ga0207663_100214192 221
277 3300025920 Ga0207649_10000021 Ga0207649_10000021110 221
278 3300025927 Ga0207687_10037625 Ga0207687_100376256 221
279 3300025932 Ga0207690_10018371 Ga0207690_100183714 221
280 3300025934 Ga0207686_10000042 Ga0207686_1000004220 221
281 3300025934 Ga0207686_10043002 Ga0207686_100430024 221
282 3300025939 Ga0207665_10164634 Ga0207665_101646342 221
283 3300025940 Ga0207691_10000172 Ga0207691_1000017223 221
284 3300025945 Ga0207679_10418838 Ga0207679_104188381 221
285 3300025961 Ga0207712_10098399 Ga0207712_100983992 221
286 3300026121 Ga0207683_10105569 Ga0207683_101055692 221
287 3300028573 Ga0265334_10020312 Ga0265334_100203123 221
288 3300035121 Ga0373960_0146023 Ga0373960_0146023_39_722 221
289 3300046459 Ga0495629_0001288 Ga0495629_0001288_15998_16735 221
290 3300046459 Ga0495629_0288709 Ga0495629_0288709_181_864 221
291 3300046460 Ga0495638_0014624 Ga0495638_0014624_2775_3446 221
292 3300046461 Ga0495641_0015395 Ga0495641_0015395_2683_3348 221
293 3300046476 Ga0495662_0003766 Ga0495662_0003766_6919_7587 221
294 3300046477 Ga0495664_0137618 Ga0495664_0137618_340_1014 221
295 3300046517 Ga0495630_0000007 Ga0495630_0000007_33182_33847 221
296 3300046517 Ga0495630_0150407 Ga0495630_0150407_452_1126 221
297 3300046660 Ga0495625_0000204 Ga0495625_0000204_73269_73940 221
298 3300046681 Ga0495647_0000297 Ga0495647_0000297_838_1503 221
299 3300046681 Ga0495647_0123585 Ga0495647_0123585_345_1028 221
300 3300046690 Ga0495624_0000177 Ga0495624_0000177_42239_42904 221
301 3300047319 Ga0495674_0430254 Ga0495674_0430254_150_824 221
302 3300047321 Ga0495676_0027288 Ga0495676_0027288_3658_4329 221
303 3300047321 Ga0495676_0069254 Ga0495676_0069254_1217_1900 221
304 3300047322 Ga0495680_0087265 Ga0495680_0087265_1409_2083 221
305 3300048903 Ga0496100_0006091 Ga0496100_0006091_5597_6280 221
306 3300048904 Ga0496101_0276889 Ga0496101_0276889_342_1016 221
307 3300048904 Ga0496101_0321264 Ga0496101_0321264_69_752 221
308 3300048906 Ga0496103_0066470 Ga0496103_0066470_1054_1737 221
309 3300048907 Ga0496104_0007798 Ga0496104_0007798_7551_8225 221
310 3300048908 Ga0496105_0041699 Ga0496105_0041699_1100_1783 221
311 3300048909 Ga0496106_0060538 Ga0496106_0060538_385_1068 221
312 3300048909 Ga0496106_0373799 Ga0496106_0373799_116_790 221
313 3300048910 Ga0496107_0104521 Ga0496107_0104521_595_1278 221
314 3300048911 Ga0496108_0000806 Ga0496108_0000806_1059_1733 221
315 3300048911 Ga0496108_0294783 Ga0496108_0294783_345_1028 221
316 3300048912 Ga0496109_0195232 Ga0496109_0195232_225_908 221
317 3300048912 Ga0496109_0259860 Ga0496109_0259860_116_790 221
318 3300048913 Ga0496110_0000004 Ga0496110_0000004_50007_50675 221
319 3300048913 Ga0496110_0033461 Ga0496110_0033461_1937_2611 221
320 3300048913 Ga0496110_0037058 Ga0496110_0037058_1937_2620 221
321 3300048913 Ga0496110_0182905 Ga0496110_0182905_121_795 221
322 3300048914 Ga0496111_0000007 Ga0496111_0000007_6947_7615 221
323 3300048914 Ga0496111_0044224 Ga0496111_0044224_171_845 221
324 3300048915 Ga0496112_0036245 Ga0496112_0036245_1120_1794 221
325 3300048915 Ga0496112_0042722 Ga0496112_0042722_46_714 221
326 3300048916 Ga0496113_0000460 Ga0496113_0000460_4842_5510 221
327 3300048916 Ga0496113_0003255 Ga0496113_0003255_7712_8386 221
328 3300048916 Ga0496113_0057938 Ga0496113_0057938_1738_2421 221
329 3300048917 Ga0496114_0028557 Ga0496114_0028557_1979_2662 221
330 3300048917 Ga0496114_0346499 Ga0496114_0346499_389_1063 221
331 3300049575 Ga0501039_0106480 Ga0501039_0106480_1194_1889 221
332 3300049578 Ga0501042_0028926 Ga0501042_0028926_14_685 221
333 3300049578 Ga0501042_0055077 Ga0501042_0055077_49_744 221
334 3300049584 Ga0501068_0121160 Ga0501068_0121160_603_1268 221
335 3300049586 Ga0501070_0054073 Ga0501070_0054073_474_1157 221
336 3300049587 Ga0501071_0029090 Ga0501071_0029090_781_1476 221
337 3300049587 Ga0501071_0135079 Ga0501071_0135079_205_888 221
338 3300049587 Ga0501071_0567465 Ga0501071_0567465_30_713 221
339 3300049588 Ga0501072_0172934 Ga0501072_0172934_818_1501 221
340 3300049588 Ga0501072_0275323 Ga0501072_0275323_35_718 221
341 3300049588 Ga0501072_0317806 Ga0501072_0317806_496_1179 221
342 3300049589 Ga0501073_0054974 Ga0501073_0054974_2084_2767 221
343 3300049590 Ga0501074_0040303 Ga0501074_0040303_1377_2060 221
344 3300049592 Ga0501076_0300305 Ga0501076_0300305_367_1062 221
345 3300050490 nmdc:mga03n38_7537_c1 nmdc:mga03n38_7537_c1_518_1210 221
346 3300050491 nmdc:mga00v17_37435_c1 nmdc:mga00v17_37435_c1_35_724 221
347 3300050492 nmdc:mga0yw44_398838_c1 nmdc:mga0yw44_398838_c1_20_709 221
348 3300053083 Ga0495655_0000765 Ga0495655_0000765_680_1348 221
349 3300053085 Ga0495619_0000038 Ga0495619_0000038_66555_67223 221
350 3300053096 Ga0500641_0006502 Ga0500641_0006502_2290_2961 221
351 3300060353 Ga0501082_0471282 Ga0501082_0471282_263_961 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

185

226

0.93

PF00498

FHA

FHA domain

69

135

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gqs-assembly2.cif.gz_B crystal structure of the fha domain of ct664 protein from chlamydia trachomatis 0.914 22 118
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9091 21 118
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9015 25 118
4gvp-assembly1.cif.gz_A crystal structure of the response regulator protein vrar from staphylococcus aureus 0.8954 135 217
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.89 136 216
ID Description Score Start End Superfamily
af_O65934_209_307_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9347 43 120 2.60.200.20
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9043 134 217 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9037 139 208 1.10.10.10
4gvpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9024 135 216 3.40.50.2300
4ijaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8966 143 191 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1V5GUZ6-F1-model_v4 FHA domain protein 0.94 23 121
AF-A0A1M3BG64-F1-model_v4 HTH luxR-type domain-containing protein 0.9222 133 217 GO:0003677
GO:0006355
GO:0016020
AF-A0A0D8HKH1-F1-model_v4 FHA domain-containing protein FhaB 0.9188 21 117 GO:0016020
AF-A0A7X7T7C9-F1-model_v4 FHA domain-containing protein 0.9177 22 118 GO:0016020
AF-A0A7V8YDA2-F1-model_v4 FHA domain-containing protein 0.9147 22 119

Feature Viewer

pLDDT pTM Quality
85.32 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map