F418698

General Info

Members Datasets Scaffolds Average Seq Length
351 182 702 365

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100108322|Ga0307416_1001083222
Length 385
Sequence MAFTATCQRCGVVRPSAVRLVAIAAAIVCSGVALPAQLPFAATYDNDRQVRFEGAVTRVEWVNPRAYLFLDVRDANGTTVNWAVEIGNALVLERNGWKRSSVRVGDIVTVEGNPAIGLASRAFARSVTLKRTAARLFAAPAGRRAAAATAPAPRWADGRIRLGPPPGKKGYWGASSATVLVEGSAGKIPMSEEGLLVNIADADRVAPFQPWAKAVYLYRQRTLLKDDPSSRCLPPGGPRQFHSAHGFQFIEQPEQGRVLVLLGGGNRNWRVIYTDGRPQGQAAEAVPSYYGNSVGRWEKDTLVVDSVGFNERFWMSNGGLPHTDALHLIERFSRPDLNTLRYEVTVDDPRTYTRSWSGGWTIQWVPDQEIQEYFCEENAESTFVR

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.28
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 23.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100108322 3300032002 Bacteria 2441
2 Ga0070683_100003941 3300005329 Bacteria 12142
3 Ga0070683_100006922 3300005329 Bacteria 9530
4 Ga0070670_100002856 3300005331 Bacteria 14284
5 Ga0070670_100063129 3300005331 Bacteria 3179
6 Ga0068869_100139345 3300005334 Bacteria 1872
7 Ga0070689_100029775 3300005340 Bacteria 4137
8 Ga0070691_10000176 3300005341 Bacteria 20932
9 Ga0070661_100247410 3300005344 Bacteria 1375
10 Ga0070669_100094230 3300005353 Bacteria 2250
11 Ga0070675_100000061 3300005354 Bacteria 66703
12 Ga0070675_100001628 3300005354 Bacteria 16576
13 Ga0070675_100016847 3300005354 Bacteria 5803
14 Ga0070675_100017305 3300005354 Bacteria 5727
15 Ga0070675_100037849 3300005354 Bacteria 3931
16 Ga0070675_100044015 3300005354 Unclassified 3651
17 Ga0070675_100073101 3300005354 Viruses 2846
18 Ga0070675_100101078 3300005354 Unclassified 2429
19 Ga0070675_100304373 3300005354 Unclassified 1405
20 Ga0070671_100016575 3300005355 Bacteria 5956
21 Ga0070671_100030578 3300005355 Bacteria 4444
22 Ga0070674_100120376 3300005356 Unclassified 1943
23 Ga0070674_100257847 3300005356 Unclassified 1372
24 Ga0070673_100046404 3300005364 Bacteria 3375
25 Ga0070673_100055482 3300005364 Bacteria 3122
26 Ga0070673_100140114 3300005364 Unclassified 2039
27 Ga0070673_100407223 3300005364 Unclassified 1217
28 Ga0070688_100072157 3300005365 Bacteria 2212
29 Ga0070688_100162927 3300005365 Unclassified 1533
30 Ga0070667_100010383 3300005367 Bacteria 7687
31 Ga0070667_100018544 3300005367 Bacteria 5773
32 Ga0070709_10017331 3300005434 Bacteria 4130
33 Ga0070713_100063203 3300005436 Unclassified 3103
34 Ga0070713_100068723 3300005436 Bacteria 2986
35 Ga0070711_100121559 3300005439 Unclassified 1932
36 Ga0070694_100164361 3300005444 Unclassified 1631
37 Ga0070662_100093945 3300005457 Bacteria 2257
38 Ga0070681_10011267 3300005458 Bacteria 8843
39 Ga0068867_100040253 3300005459 Bacteria 3409
40 Ga0068867_100053952 3300005459 Bacteria 2969
41 Ga0070685_10011078 3300005466 Unclassified 4708
42 Ga0070707_100015483 3300005468 Bacteria 7156
43 Ga0070707_100115431 3300005468 Bacteria 2606
44 Ga0070699_100179084 3300005518 Bacteria 1881
45 Ga0070679_100114768 3300005530 Bacteria 2679
46 Ga0070684_100000310 3300005535 Bacteria 33597
47 Ga0070684_100015904 3300005535 Bacteria 6140
48 Ga0070684_100022132 3300005535 Bacteria 5298
49 Ga0070684_100082531 3300005535 Bacteria 2846
50 Ga0068853_100072505 3300005539 Bacteria 3001
51 Ga0068853_100112824 3300005539 Bacteria 2416
52 Ga0068853_100312402 3300005539 Unclassified 1455
53 Ga0070672_100000416 3300005543 Bacteria 24708
54 Ga0070672_100029613 3300005543 Bacteria 4107
55 Ga0070672_100095543 3300005543 Unclassified 2403
56 Ga0070672_100219313 3300005543 Bacteria 1595
57 Ga0070696_100204535 3300005546 Unclassified 1475
58 Ga0070693_100051661 3300005547 Bacteria 2354
59 Ga0068855_100018826 3300005563 Bacteria 8300
60 Ga0068855_100021423 3300005563 Bacteria 7750
61 Ga0068855_100051661 3300005563 Bacteria 4842
62 Ga0070664_100011914 3300005564 Bacteria 7058
63 Ga0070664_100085229 3300005564 Bacteria 2728
64 Ga0068857_100023175 3300005577 Bacteria 5463
65 Ga0068857_100066303 3300005577 Bacteria 3212
66 Ga0068856_100003188 3300005614 Bacteria 16692
67 Ga0068856_100021068 3300005614 Bacteria 6336
68 Ga0068856_100088183 3300005614 Bacteria 3085
69 Ga0068856_100128102 3300005614 Bacteria 2542
70 Ga0068856_100154578 3300005614 Bacteria 2304
71 Ga0068852_100039637 3300005616 Bacteria 3967
72 Ga0068852_100172615 3300005616 Unclassified 2028
73 Ga0068859_100000802 3300005617 Bacteria 31882
74 Ga0068859_100158648 3300005617 Bacteria 2341
75 Ga0068859_100174521 3300005617 Bacteria 2231
76 Ga0068864_100019841 3300005618 Bacteria 5621
77 Ga0068864_100105569 3300005618 Bacteria 2504
78 Ga0068866_10099708 3300005718 Bacteria 1600
79 Ga0068851_10066998 3300005834 Unclassified 1851
80 Ga0068863_100000177 3300005841 Bacteria 67749
81 Ga0068863_100023114 3300005841 Bacteria 5941
82 Ga0068863_100082012 3300005841 Unclassified 3056
83 Ga0068858_100014187 3300005842 Bacteria 7513
84 Ga0068858_100061317 3300005842 Bacteria 3477
85 Ga0081539_10031200 3300005985 Bacteria 3290
86 Ga0070712_100049835 3300006175 Unclassified 2910
87 Ga0097621_100012778 3300006237 Bacteria 6239
88 Ga0097621_100023219 3300006237 Bacteria 4825
89 Ga0097621_100043013 3300006237 Bacteria 3640
90 Ga0097621_100190830 3300006237 Unclassified 1774
91 Ga0068871_100006789 3300006358 Bacteria 8135
92 Ga0068871_100058953 3300006358 Bacteria 3127
93 Ga0075428_100120057 3300006844 Unclassified 2862
94 Ga0075428_100196884 3300006844 Bacteria 2179
95 Ga0075430_100148940 3300006846 Bacteria 1949
96 Ga0075431_100116126 3300006847 Bacteria 2763
97 Ga0075433_10000590 3300006852 Bacteria 24085
98 Ga0075434_100000541 3300006871 Bacteria 28796
99 Ga0075434_100023210 3300006871 Bacteria 6044
100 Ga0075434_100060675 3300006871 Unclassified 3761
101 Ga0075434_100105317 3300006871 Unclassified 2831
102 Ga0075434_100117809 3300006871 Bacteria 2669
103 Ga0075434_100251937 3300006871 Bacteria 1785
104 Ga0075429_100023354 3300006880 Bacteria 5366
105 Ga0075429_100045268 3300006880 Bacteria 3828
106 Ga0097620_100000802 3300006931 Bacteria 31882
107 Ga0097620_100158648 3300006931 Bacteria 2341
108 Ga0097620_100174525 3300006931 Bacteria 2231
109 Ga0075435_100064759 3300007076 Bacteria 2971
110 Ga0075435_100239383 3300007076 Unclassified 1543
111 Ga0105240_10001512 3300009093 Bacteria 39567
112 Ga0105240_10084200 3300009093 Unclassified 3900
113 Ga0105240_10150613 3300009093 Bacteria 2771
114 Ga0111539_10001210 3300009094 Bacteria 34346
115 Ga0111539_10001820 3300009094 Bacteria 28388
116 Ga0111539_10004517 3300009094 Bacteria 18197
117 Ga0111539_10028187 3300009094 Bacteria 6855
118 Ga0111539_10091474 3300009094 Unclassified 3574
119 Ga0111539_10117906 3300009094 Bacteria 3111
120 Ga0111539_10203726 3300009094 Unclassified 2307
121 Ga0105245_10001068 3300009098 Bacteria 24840
122 Ga0105245_10005027 3300009098 Bacteria 11626
123 Ga0105247_10080280 3300009101 Bacteria 2054
124 Ga0114129_10000075 3300009147 Bacteria 91461
125 Ga0114129_10015073 3300009147 Bacteria 11004
126 Ga0114129_10039122 3300009147 Bacteria 6687
127 Ga0114129_10157194 3300009147 Bacteria 3108
128 Ga0114129_10166058 3300009147 Bacteria 3012
129 Ga0114129_10231661 3300009147 Bacteria 2487
130 Ga0105241_10002973 3300009174 Bacteria 12646
131 Ga0105241_10070065 3300009174 Unclassified 2720
132 Ga0105241_10089469 3300009174 Unclassified 2426
133 Ga0105241_10312950 3300009174 Unclassified 1351
134 Ga0105242_10016957 3300009176 Bacteria 5669
135 Ga0105242_10028538 3300009176 Unclassified 4445
136 Ga0105242_10220535 3300009176 Bacteria 1695
137 Ga0105242_10410748 3300009176 Bacteria 1266
138 Ga0105248_10004089 3300009177 Bacteria 16136
139 Ga0105248_10074994 3300009177 Bacteria 3802
140 Ga0105237_10005398 3300009545 Bacteria 14438
141 Ga0105237_10048377 3300009545 Bacteria 4274
142 Ga0105237_10084877 3300009545 Bacteria 3156
143 Ga0105237_10142835 3300009545 Unclassified 2388
144 Ga0105238_10001473 3300009551 Bacteria 23635
145 Ga0105238_10015787 3300009551 Bacteria 7645
146 Ga0105238_10241390 3300009551 Unclassified 1784
147 Ga0105249_10109451 3300009553 Unclassified 2610
148 Ga0105239_10000767 3300010375 Bacteria 45361
149 Ga0105239_10014278 3300010375 Bacteria 8815
150 Ga0105239_10034614 3300010375 Bacteria 5547
151 Ga0105239_10189170 3300010375 Unclassified 2304
152 Ga0105246_10001389 3300011119 Bacteria 14304
153 Ga0157370_10015940 3300013104 Bacteria 7625
154 Ga0157370_10042693 3300013104 Bacteria 4368
155 Ga0157369_10003802 3300013105 Bacteria 17942
156 Ga0157369_10079629 3300013105 Bacteria 3509
157 Ga0157374_10130083 3300013296 Bacteria 2436
158 Ga0157378_10005110 3300013297 Bacteria 11519
159 Ga0157378_10363688 3300013297 Unclassified 1416
160 Ga0163162_10000637 3300013306 Bacteria 32481
161 Ga0163162_10119859 3300013306 Unclassified 2734
162 Ga0157372_10001372 3300013307 Bacteria 26352
163 Ga0157372_10017832 3300013307 Bacteria 7624
164 Ga0157372_10041058 3300013307 Bacteria 5114
165 Ga0157375_10007813 3300013308 Bacteria 9359
166 Ga0157375_10021844 3300013308 Bacteria 5880
167 Ga0163163_10046105 3300014325 Unclassified 4281
168 Ga0163163_10183383 3300014325 Bacteria 2140
169 Ga0163163_10216712 3300014325 Bacteria 1963
170 Ga0157377_10044019 3300014745 Unclassified 2487
171 Ga0157377_10116267 3300014745 Unclassified 1615
172 Ga0157379_10086866 3300014968 Bacteria 2804
173 Ga0157376_10063777 3300014969 Bacteria 3105
174 Ga0157376_10217955 3300014969 Bacteria 1766
175 Ga0213873_10019985 3300021358 Unclassified 1560
176 Ga0207680_10005014 3300025903 Bacteria 6307
177 Ga0207699_10049907 3300025906 Unclassified 2465
178 Ga0207654_10003807 3300025911 Bacteria 7609
179 Ga0207707_10198420 3300025912 Unclassified 1750
180 Ga0207695_10009005 3300025913 Bacteria 12415
181 Ga0207695_10016293 3300025913 Bacteria 8705
182 Ga0207695_10180533 3300025913 Bacteria 2031
183 Ga0207671_10048838 3300025914 Bacteria 3131
184 Ga0207663_10057052 3300025916 Bacteria 2459
185 Ga0207660_10001624 3300025917 Bacteria 15086
186 Ga0207662_10011708 3300025918 Bacteria 4873
187 Ga0207646_10098952 3300025922 Bacteria 2614
188 Ga0207694_10008551 3300025924 Bacteria 7728
189 Ga0207694_10009178 3300025924 Bacteria 7463
190 Ga0207694_10182214 3300025924 Bacteria 1703
191 Ga0207650_10002505 3300025925 Bacteria 12753
192 Ga0207650_10074967 3300025925 Bacteria 2552
193 Ga0207659_10002029 3300025926 Bacteria 12008
194 Ga0207659_10004022 3300025926 Bacteria 8872
195 Ga0207659_10004831 3300025926 Bacteria 8169
196 Ga0207659_10010654 3300025926 Bacteria 5781
197 Ga0207659_10038987 3300025926 Viruses 3309
198 Ga0207659_10191812 3300025926 Bacteria 1627
199 Ga0207659_10243650 3300025926 Unclassified 1456
200 Ga0207687_10004099 3300025927 Bacteria 9768
201 Ga0207687_10009211 3300025927 Bacteria 6460
202 Ga0207687_10011142 3300025927 Bacteria 5874
203 Ga0207700_10068329 3300025928 Bacteria 2723
204 Ga0207700_10157607 3300025928 Unclassified 1882
205 Ga0207644_10061716 3300025931 Unclassified 2716
206 Ga0207690_10027609 3300025932 Bacteria 3589
207 Ga0207706_10070311 3300025933 Bacteria 3079
208 Ga0207706_10088833 3300025933 Unclassified 2716
209 Ga0207706_10179967 3300025933 Bacteria 1857
210 Ga0207686_10002578 3300025934 Bacteria 9853
211 Ga0207686_10017427 3300025934 Unclassified 4048
212 Ga0207686_10125128 3300025934 Unclassified 1756
213 Ga0207709_10063074 3300025935 Bacteria 2322
214 Ga0207670_10093786 3300025936 Bacteria 2128
215 Ga0207669_10097331 3300025937 Unclassified 1935
216 Ga0207665_10114566 3300025939 Unclassified 1898
217 Ga0207691_10003943 3300025940 Bacteria 14415
218 Ga0207691_10078590 3300025940 Bacteria 2970
219 Ga0207691_10371178 3300025940 Bacteria 1222
220 Ga0207711_10009157 3300025941 Bacteria 8271
221 Ga0207711_10040547 3300025941 Bacteria 3961
222 Ga0207711_10138576 3300025941 Unclassified 2187
223 Ga0207711_10221755 3300025941 Bacteria 1730
224 Ga0207689_10010921 3300025942 Bacteria 7808
225 Ga0207689_10057958 3300025942 Unclassified 3186
226 Ga0207689_10149973 3300025942 Bacteria 1922
227 Ga0207661_10001677 3300025944 Bacteria 15107
228 Ga0207661_10020601 3300025944 Bacteria 4932
229 Ga0207679_10102438 3300025945 Bacteria 2242
230 Ga0207667_10000573 3300025949 Bacteria 48021
231 Ga0207667_10017982 3300025949 Bacteria 7941
232 Ga0207667_10026434 3300025949 Bacteria 6341
233 Ga0207651_10001451 3300025960 Bacteria 10783
234 Ga0207651_10014572 3300025960 Bacteria 4545
235 Ga0207651_10077756 3300025960 Bacteria 2377
236 Ga0207703_10012598 3300026035 Bacteria 6593
237 Ga0207703_10021519 3300026035 Bacteria 5050
238 Ga0207703_10067263 3300026035 Bacteria 2949
239 Ga0207703_10072816 3300026035 Bacteria 2841
240 Ga0207639_10115895 3300026041 Bacteria 2192
241 Ga0207639_10284558 3300026041 Bacteria 1455
242 Ga0207702_10024754 3300026078 Unclassified 4980
243 Ga0207702_10069401 3300026078 Bacteria 3030
244 Ga0207702_10359371 3300026078 Bacteria 1395
245 Ga0207641_10000472 3300026088 Bacteria 45544
246 Ga0207641_10001664 3300026088 Bacteria 21678
247 Ga0207641_10087717 3300026088 Unclassified 2715
248 Ga0207648_10070667 3300026089 Bacteria 3043
249 Ga0207648_10090471 3300026089 Bacteria 2674
250 Ga0207648_10100091 3300026089 Bacteria 2539
251 Ga0207676_10109588 3300026095 Unclassified 2307
252 Ga0207676_10328830 3300026095 Bacteria 1406
253 Ga0207674_10000035 3300026116 Bacteria 136262
254 Ga0207674_10003754 3300026116 Bacteria 18529
255 Ga0207674_10078217 3300026116 Bacteria 3313
256 Ga0207675_100285398 3300026118 Bacteria 1605
257 Ga0209974_10010600 3300027876 Bacteria 3110
258 Ga0207428_10048001 3300027907 Unclassified 3427
259 Ga0207428_10109227 3300027907 Bacteria 2130
260 Ga0265338_10032729 3300028800 Bacteria 5062
261 Ga0265313_10008168 3300031595 Bacteria 6996
262 Ga0307405_10002012 3300031731 Bacteria 8807
263 Ga0307413_10014485 3300031824 Bacteria 4007
264 Ga0307410_10027904 3300031852 Unclassified 3573
265 Ga0307412_10107233 3300031911 Bacteria 1988
266 Ga0307412_10112609 3300031911 Unclassified 1945
267 Ga0307409_100002744 3300031995 Bacteria 9299
268 Ga0307416_100002630 3300032002 Bacteria 10386
269 Ga0307411_10043671 3300032005 Bacteria 2869
270 Ga0307415_100051091 3300032126 Unclassified 2804
271 Ga0373923_0022787 3300035111 Unclassified 2459
272 Ga0373953_0002996 3300035117 Bacteria 5168
273 Ga0373953_0019544 3300035117 Unclassified 2522
274 Ga0373954_0017716 3300035118 Unclassified 3201
275 Ga0373956_0018782 3300035119 Bacteria 2930
276 Ga0373957_0016796 3300035120 Unclassified 2540
277 Ga0373955_0007703 3300035172 Bacteria 4960
278 Ga0373955_0063596 3300035172 Bacteria 2043
279 Ga0373924_0075935 3300035410 Unclassified 1423
280 Ga0373937_0005574 3300036401 Bacteria 10802
281 Ga0373937_0158688 3300036401 Bacteria 2120
282 Ga0373925_0041451 3300037068 Unclassified 3413
283 Ga0373925_0127028 3300037068 Bacteria 1985
284 Ga0436364_0056936 3300037853 Bacteria 2470
285 Ga0436365_1312171 3300039437 Unclassified 4233
286 Ga0436363_0806230 3300039450 Unclassified 1548
287 Ga0436362_0144062 3300039453 Bacteria 2490
288 Ga0495592_0040765 3300046454 Unclassified 3483
289 Ga0495580_0006672 3300046472 Bacteria 9369
290 Ga0495639_0004789 3300046475 Bacteria 5820
291 Ga0495630_0253130 3300046517 Bacteria 1346
292 Ga0495652_0043802 3300046529 Bacteria 3855
293 Ga0495652_0196054 3300046529 Bacteria 1537
294 Ga0495665_0088095 3300046531 Unclassified 1632
295 Ga0495586_0013283 3300046535 Bacteria 4365
296 Ga0495587_0005188 3300046536 Bacteria 8514
297 Ga0495621_0081824 3300046539 Bacteria 1205
298 Ga0495645_0080560 3300046543 Unclassified 2337
299 Ga0495667_0000643 3300046559 Bacteria 22236
300 Ga0495659_0024080 3300046664 Bacteria 2073
301 Ga0495657_0005533 3300046675 Bacteria 9980
302 Ga0495599_0028000 3300046678 Bacteria 3530
303 Ga0495623_0120914 3300046679 Bacteria 1576
304 Ga0495647_0022426 3300046681 Viruses 2281
305 Ga0495658_0142309 3300046683 Bacteria 1468
306 Ga0495613_0015723 3300046689 Bacteria 5632
307 Ga0495613_0094481 3300046689 Bacteria 2163
308 Ga0495581_0102749 3300047315 Unclassified 1661
309 Ga0495674_0065137 3300047319 Bacteria 3166
310 Ga0495674_0218481 3300047319 Bacteria 1576
311 Ga0495675_0025852 3300047444 Bacteria 3742
312 Ga0495684_0001978 3300047471 Bacteria 16463
313 Ga0495602_0001061 3300048088 Bacteria 26941
314 Ga0496115_0280545 3300048918 Unclassified 1368
315 Ga0501038_0140168 3300049574 Unclassified 1979
316 Ga0501039_0096741 3300049575 Unclassified 2302
317 Ga0501040_0044265 3300049576 Unclassified 3035
318 Ga0501042_0025989 3300049578 Bacteria 4114
319 Ga0501042_0206983 3300049578 Bacteria 1415
320 Ga0501046_0100781 3300049580 Bacteria 2216
321 Ga0501071_0092322 3300049587 Bacteria 2225
322 Ga0501075_0007398 3300049591 Bacteria 7619
323 Ga0501075_0151311 3300049591 Bacteria 1769
324 Ga0501076_0018639 3300049592 Bacteria 5296
325 Ga0501077_0023454 3300049593 Bacteria 3914
326 Ga0501081_0018147 3300049743 Bacteria 4670
327 nmdc:mga05p37_125989_c1 3300050507 Unclassified 3145
328 nmdc:mga05p37_15981_c1 3300050507 Bacteria 9031
329 nmdc:mga05p37_17139_c1 3300050507 Bacteria 8741
330 nmdc:mga05p37_37451_c1 3300050507 Bacteria 5946
331 nmdc:mga09592_190948_c1 3300050508 Bacteria 1773
332 nmdc:mga09592_38138_c1 3300050508 Bacteria 4032
333 nmdc:mga06r32_76872_c1 3300050510 Unclassified 3242
334 nmdc:mga06r32_9097_c1 3300050510 Bacteria 8954
335 nmdc:mga08y16_11043_c1 3300050511 Bacteria 9483
336 nmdc:mga08y16_132726_c1 3300050511 Bacteria 2589
337 nmdc:mga08y16_347_c1 3300050511 Bacteria 41642
338 nmdc:mga08y16_4654_c1 3300050511 Bacteria 14285
339 nmdc:mga08y16_481218_c1 3300050511 Bacteria 1263
340 nmdc:mga08y16_74023_c1 3300050511 Bacteria 3549
341 nmdc:mga0n895_116676_c1 3300050512 Unclassified 2688
342 nmdc:mga0n895_19472_c1 3300050512 Bacteria 6310
343 nmdc:mga0n895_252960_c1 3300050512 Bacteria 1788
344 nmdc:mga0n895_91408_c1 3300050512 Unclassified 3046
345 nmdc:mga0n895_99851_c1 3300050512 Unclassified 2911
346 nmdc:mga0rr50_54338_c1 3300050513 Bacteria 2983
347 nmdc:mga0a205_13207_c1 3300050515 Bacteria 7677
348 nmdc:mga0a205_369236_c1 3300050515 Bacteria 1301
349 nmdc:mga0a205_83046_c1 3300050515 Bacteria 3094
350 nmdc:mga0a205_84_c1 3300050515 Bacteria 51647
351 Ga0500568_0000467 3300053139 Bacteria 29990
352 Ga0307416_100108322
353 Ga0070683_100003941
354 Ga0070683_100006922
355 Ga0070670_100002856
356 Ga0070670_100063129
357 Ga0068869_100139345
358 Ga0070689_100029775
359 Ga0070691_10000176
360 Ga0070661_100247410
361 Ga0070669_100094230
362 Ga0070675_100000061
363 Ga0070675_100001628
364 Ga0070675_100016847
365 Ga0070675_100017305
366 Ga0070675_100037849
367 Ga0070675_100044015
368 Ga0070675_100073101
369 Ga0070675_100101078
370 Ga0070675_100304373
371 Ga0070671_100016575
372 Ga0070671_100030578
373 Ga0070674_100120376
374 Ga0070674_100257847
375 Ga0070673_100046404
376 Ga0070673_100055482
377 Ga0070673_100140114
378 Ga0070673_100407223
379 Ga0070688_100072157
380 Ga0070688_100162927
381 Ga0070667_100010383
382 Ga0070667_100018544
383 Ga0070709_10017331
384 Ga0070713_100063203
385 Ga0070713_100068723
386 Ga0070711_100121559
387 Ga0070694_100164361
388 Ga0070662_100093945
389 Ga0070681_10011267
390 Ga0068867_100040253
391 Ga0068867_100053952
392 Ga0070685_10011078
393 Ga0070707_100015483
394 Ga0070707_100115431
395 Ga0070699_100179084
396 Ga0070679_100114768
397 Ga0070684_100000310
398 Ga0070684_100015904
399 Ga0070684_100022132
400 Ga0070684_100082531
401 Ga0068853_100072505
402 Ga0068853_100112824
403 Ga0068853_100312402
404 Ga0070672_100000416
405 Ga0070672_100029613
406 Ga0070672_100095543
407 Ga0070672_100219313
408 Ga0070696_100204535
409 Ga0070693_100051661
410 Ga0068855_100018826
411 Ga0068855_100021423
412 Ga0068855_100051661
413 Ga0070664_100011914
414 Ga0070664_100085229
415 Ga0068857_100023175
416 Ga0068857_100066303
417 Ga0068856_100003188
418 Ga0068856_100021068
419 Ga0068856_100088183
420 Ga0068856_100128102
421 Ga0068856_100154578
422 Ga0068852_100039637
423 Ga0068852_100172615
424 Ga0068859_100000802
425 Ga0068859_100158648
426 Ga0068859_100174521
427 Ga0068864_100019841
428 Ga0068864_100105569
429 Ga0068866_10099708
430 Ga0068851_10066998
431 Ga0068863_100000177
432 Ga0068863_100023114
433 Ga0068863_100082012
434 Ga0068858_100014187
435 Ga0068858_100061317
436 Ga0081539_10031200
437 Ga0070712_100049835
438 Ga0097621_100012778
439 Ga0097621_100023219
440 Ga0097621_100043013
441 Ga0097621_100190830
442 Ga0068871_100006789
443 Ga0068871_100058953
444 Ga0075428_100120057
445 Ga0075428_100196884
446 Ga0075430_100148940
447 Ga0075431_100116126
448 Ga0075433_10000590
449 Ga0075434_100000541
450 Ga0075434_100023210
451 Ga0075434_100060675
452 Ga0075434_100105317
453 Ga0075434_100117809
454 Ga0075434_100251937
455 Ga0075429_100023354
456 Ga0075429_100045268
457 Ga0097620_100000802
458 Ga0097620_100158648
459 Ga0097620_100174525
460 Ga0075435_100064759
461 Ga0075435_100239383
462 Ga0105240_10001512
463 Ga0105240_10084200
464 Ga0105240_10150613
465 Ga0111539_10001210
466 Ga0111539_10001820
467 Ga0111539_10004517
468 Ga0111539_10028187
469 Ga0111539_10091474
470 Ga0111539_10117906
471 Ga0111539_10203726
472 Ga0105245_10001068
473 Ga0105245_10005027
474 Ga0105247_10080280
475 Ga0114129_10000075
476 Ga0114129_10015073
477 Ga0114129_10039122
478 Ga0114129_10157194
479 Ga0114129_10166058
480 Ga0114129_10231661
481 Ga0105241_10002973
482 Ga0105241_10070065
483 Ga0105241_10089469
484 Ga0105241_10312950
485 Ga0105242_10016957
486 Ga0105242_10028538
487 Ga0105242_10220535
488 Ga0105242_10410748
489 Ga0105248_10004089
490 Ga0105248_10074994
491 Ga0105237_10005398
492 Ga0105237_10048377
493 Ga0105237_10084877
494 Ga0105237_10142835
495 Ga0105238_10001473
496 Ga0105238_10015787
497 Ga0105238_10241390
498 Ga0105249_10109451
499 Ga0105239_10000767
500 Ga0105239_10014278
501 Ga0105239_10034614
502 Ga0105239_10189170
503 Ga0105246_10001389
504 Ga0157370_10015940
505 Ga0157370_10042693
506 Ga0157369_10003802
507 Ga0157369_10079629
508 Ga0157374_10130083
509 Ga0157378_10005110
510 Ga0157378_10363688
511 Ga0163162_10000637
512 Ga0163162_10119859
513 Ga0157372_10001372
514 Ga0157372_10017832
515 Ga0157372_10041058
516 Ga0157375_10007813
517 Ga0157375_10021844
518 Ga0163163_10046105
519 Ga0163163_10183383
520 Ga0163163_10216712
521 Ga0157377_10044019
522 Ga0157377_10116267
523 Ga0157379_10086866
524 Ga0157376_10063777
525 Ga0157376_10217955
526 Ga0213873_10019985
527 Ga0207680_10005014
528 Ga0207699_10049907
529 Ga0207654_10003807
530 Ga0207707_10198420
531 Ga0207695_10009005
532 Ga0207695_10016293
533 Ga0207695_10180533
534 Ga0207671_10048838
535 Ga0207663_10057052
536 Ga0207660_10001624
537 Ga0207662_10011708
538 Ga0207646_10098952
539 Ga0207694_10008551
540 Ga0207694_10009178
541 Ga0207694_10182214
542 Ga0207650_10002505
543 Ga0207650_10074967
544 Ga0207659_10002029
545 Ga0207659_10004022
546 Ga0207659_10004831
547 Ga0207659_10010654
548 Ga0207659_10038987
549 Ga0207659_10191812
550 Ga0207659_10243650
551 Ga0207687_10004099
552 Ga0207687_10009211
553 Ga0207687_10011142
554 Ga0207700_10068329
555 Ga0207700_10157607
556 Ga0207644_10061716
557 Ga0207690_10027609
558 Ga0207706_10070311
559 Ga0207706_10088833
560 Ga0207706_10179967
561 Ga0207686_10002578
562 Ga0207686_10017427
563 Ga0207686_10125128
564 Ga0207709_10063074
565 Ga0207670_10093786
566 Ga0207669_10097331
567 Ga0207665_10114566
568 Ga0207691_10003943
569 Ga0207691_10078590
570 Ga0207691_10371178
571 Ga0207711_10009157
572 Ga0207711_10040547
573 Ga0207711_10138576
574 Ga0207711_10221755
575 Ga0207689_10010921
576 Ga0207689_10057958
577 Ga0207689_10149973
578 Ga0207661_10001677
579 Ga0207661_10020601
580 Ga0207679_10102438
581 Ga0207667_10000573
582 Ga0207667_10017982
583 Ga0207667_10026434
584 Ga0207651_10001451
585 Ga0207651_10014572
586 Ga0207651_10077756
587 Ga0207703_10012598
588 Ga0207703_10021519
589 Ga0207703_10067263
590 Ga0207703_10072816
591 Ga0207639_10115895
592 Ga0207639_10284558
593 Ga0207702_10024754
594 Ga0207702_10069401
595 Ga0207702_10359371
596 Ga0207641_10000472
597 Ga0207641_10001664
598 Ga0207641_10087717
599 Ga0207648_10070667
600 Ga0207648_10090471
601 Ga0207648_10100091
602 Ga0207676_10109588
603 Ga0207676_10328830
604 Ga0207674_10000035
605 Ga0207674_10003754
606 Ga0207674_10078217
607 Ga0207675_100285398
608 Ga0209974_10010600
609 Ga0207428_10048001
610 Ga0207428_10109227
611 Ga0265338_10032729
612 Ga0265313_10008168
613 Ga0307405_10002012
614 Ga0307413_10014485
615 Ga0307410_10027904
616 Ga0307412_10107233
617 Ga0307412_10112609
618 Ga0307409_100002744
619 Ga0307416_100002630
620 Ga0307411_10043671
621 Ga0307415_100051091
622 Ga0373923_0022787
623 Ga0373953_0002996
624 Ga0373953_0019544
625 Ga0373954_0017716
626 Ga0373956_0018782
627 Ga0373957_0016796
628 Ga0373955_0007703
629 Ga0373955_0063596
630 Ga0373924_0075935
631 Ga0373937_0005574
632 Ga0373937_0158688
633 Ga0373925_0041451
634 Ga0373925_0127028
635 Ga0436364_0056936
636 Ga0436365_1312171
637 Ga0436363_0806230
638 Ga0436362_0144062
639 Ga0495592_0040765
640 Ga0495580_0006672
641 Ga0495639_0004789
642 Ga0495630_0253130
643 Ga0495652_0043802
644 Ga0495652_0196054
645 Ga0495665_0088095
646 Ga0495586_0013283
647 Ga0495587_0005188
648 Ga0495621_0081824
649 Ga0495645_0080560
650 Ga0495667_0000643
651 Ga0495659_0024080
652 Ga0495657_0005533
653 Ga0495599_0028000
654 Ga0495623_0120914
655 Ga0495647_0022426
656 Ga0495658_0142309
657 Ga0495613_0015723
658 Ga0495613_0094481
659 Ga0495581_0102749
660 Ga0495674_0065137
661 Ga0495674_0218481
662 Ga0495675_0025852
663 Ga0495684_0001978
664 Ga0495602_0001061
665 Ga0496115_0280545
666 Ga0501038_0140168
667 Ga0501039_0096741
668 Ga0501040_0044265
669 Ga0501042_0025989
670 Ga0501042_0206983
671 Ga0501046_0100781
672 Ga0501071_0092322
673 Ga0501075_0007398
674 Ga0501075_0151311
675 Ga0501076_0018639
676 Ga0501077_0023454
677 Ga0501081_0018147
678 nmdc:mga05p37_125989_c1
679 nmdc:mga05p37_15981_c1
680 nmdc:mga05p37_17139_c1
681 nmdc:mga05p37_37451_c1
682 nmdc:mga09592_190948_c1
683 nmdc:mga09592_38138_c1
684 nmdc:mga06r32_76872_c1
685 nmdc:mga06r32_9097_c1
686 nmdc:mga08y16_11043_c1
687 nmdc:mga08y16_132726_c1
688 nmdc:mga08y16_347_c1
689 nmdc:mga08y16_4654_c1
690 nmdc:mga08y16_481218_c1
691 nmdc:mga08y16_74023_c1
692 nmdc:mga0n895_116676_c1
693 nmdc:mga0n895_19472_c1
694 nmdc:mga0n895_252960_c1
695 nmdc:mga0n895_91408_c1
696 nmdc:mga0n895_99851_c1
697 nmdc:mga0rr50_54338_c1
698 nmdc:mga0a205_13207_c1
699 nmdc:mga0a205_369236_c1
700 nmdc:mga0a205_83046_c1
701 nmdc:mga0a205_84_c1
702 Ga0500568_0000467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

25

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7981 29 63
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.797 29 63
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.7829 28 63
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.7812 28 63
4fvm-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha 0.7799 28 63
ID Description Score Start End Superfamily
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8596 33 60 2.30.29.30
af_P08372_33_104_3.30.1300.30 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.8455 303 339 3.30.1300.30
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.8352 303 326 2.60.40.200
af_A0A0R0JF93_1_117_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.7817 42 64 3.40.20.10
af_K7KS40_28_169_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.7771 42 64 3.40.20.10
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9799 21 115
AF-A0A7C2J476-F1-model_v4 DUF5666 domain-containing protein 0.9462 20 118
AF-A0A2E9JIJ5-F1-model_v4 DNA-binding protein 0.9425 20 115
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9406 21 115
AF-A0A2E5NMG3-F1-model_v4 Polyketide cyclase 0.9356 19 112

Map