F418687

General Info

Members Datasets Scaffolds Average Seq Length
351 219 702 126

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10023647|Ga0316575_100236472
Length 144
Sequence MAATVDPGITTPPCTEPAGAAKRLLIVLMNTDPRNVEELGAPFYHAAVAAAMDYEVNVLCTATAGRLMHKGVAERLIIKPGDPKTVYDWIKDAHEYGARFWACPANLDLFDLDESDLIPECSGMMGAAAMIRDIMEGNCRVLTY

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
219 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.85
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.4
Nodule 0.28
Rhizoplane 9.69
Rhizosphere 78.92
Stem 0
Stem Tuber 0
Unclassified 15.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10023647 3300031665 Bacteria 2376
2 JGI25404J52841_10012748 3300003659 Bacteria 1823
3 Ga0065712_10283519 3300005290 Unclassified 891
4 Ga0070676_10079908 3300005328 Bacteria 1981
5 Ga0070670_100103337 3300005331 Bacteria 2454
6 Ga0070666_10018627 3300005335 Bacteria 4468
7 Ga0070668_100297181 3300005347 Bacteria 1353
8 Ga0070668_100951687 3300005347 Unclassified 770
9 Ga0070668_101665734 3300005347 Bacteria 585
10 Ga0070669_100607286 3300005353 Unclassified 917
11 Ga0070675_101262791 3300005354 Bacteria 680
12 Ga0070671_100270487 3300005355 Bacteria 1444
13 Ga0070674_100483251 3300005356 Bacteria 1028
14 Ga0070674_100510056 3300005356 Bacteria 1003
15 Ga0070673_100132432 3300005364 Bacteria 2094
16 Ga0070688_100007651 3300005365 Bacteria 5835
17 Ga0070688_100603704 3300005365 Bacteria 840
18 Ga0070659_101120406 3300005366 Bacteria 694
19 Ga0070667_100053779 3300005367 Bacteria 3399
20 Ga0070709_10003763 3300005434 Bacteria 8157
21 Ga0070714_100008153 3300005435 Bacteria 8165
22 Ga0070713_100002516 3300005436 Bacteria 11984
23 Ga0070710_10015138 3300005437 Bacteria 3897
24 Ga0070701_10123284 3300005438 Bacteria 1463
25 Ga0070711_100068834 3300005439 Bacteria 2488
26 Ga0070705_100410863 3300005440 Bacteria 1005
27 Ga0070700_100035982 3300005441 Bacteria 3000
28 Ga0070700_100601740 3300005441 Bacteria 861
29 Ga0070694_100956017 3300005444 Unclassified 709
30 Ga0070663_100086264 3300005455 Bacteria 2318
31 Ga0070663_100892189 3300005455 Bacteria 767
32 Ga0070678_100020401 3300005456 Bacteria 4347
33 Ga0070662_100607698 3300005457 Bacteria 920
34 Ga0070685_10022464 3300005466 Bacteria 3440
35 Ga0070706_101919107 3300005467 Bacteria 537
36 Ga0070684_100154873 3300005535 Bacteria 2078
37 Ga0070684_100393519 3300005535 Bacteria 1277
38 Ga0070697_100103986 3300005536 Bacteria 2361
39 Ga0068853_100303986 3300005539 Bacteria 1475
40 Ga0068853_101893389 3300005539 Bacteria 578
41 Ga0070686_100371753 3300005544 Bacteria 1080
42 Ga0070695_100002139 3300005545 Bacteria 11330
43 Ga0070695_100012605 3300005545 Bacteria 5077
44 Ga0070696_100912472 3300005546 Bacteria 729
45 Ga0070665_100319395 3300005548 Bacteria 1557
46 Ga0070665_102395142 3300005548 Unclassified 530
47 Ga0070704_101964697 3300005549 Bacteria 543
48 Ga0070664_100092710 3300005564 Bacteria 2616
49 Ga0070702_100232463 3300005615 Bacteria 1240
50 Ga0070702_101470567 3300005615 Bacteria 559
51 Ga0068859_100679241 3300005617 Bacteria 1121
52 Ga0068864_100059380 3300005618 Bacteria 3309
53 Ga0068866_10166308 3300005718 Bacteria 1291
54 Ga0068861_100032105 3300005719 Unclassified 3863
55 Ga0068861_100116133 3300005719 Unclassified 2151
56 Ga0068861_102358953 3300005719 Bacteria 534
57 Ga0068863_100013114 3300005841 Bacteria 7996
58 Ga0068863_101255321 3300005841 Bacteria 747
59 Ga0068858_100018644 3300005842 Bacteria 6496
60 Ga0068860_100025489 3300005843 Bacteria 5704
61 Ga0068860_100242015 3300005843 Bacteria 1755
62 Ga0068860_102189497 3300005843 Unclassified 574
63 Ga0068862_100929210 3300005844 Bacteria 857
64 Ga0081455_10008463 3300005937 Bacteria 10697
65 Ga0081455_10356594 3300005937 Unclassified 1030
66 Ga0081540_1000080 3300005983 Bacteria 103320
67 Ga0081540_1000114 3300005983 Bacteria 85489
68 Ga0081540_1026224 3300005983 Bacteria 3332
69 Ga0081540_1101119 3300005983 Bacteria 1241
70 Ga0081539_10007592 3300005985 Bacteria 9799
71 Ga0070717_10032116 3300006028 Bacteria 4227
72 Ga0075365_10049970 3300006038 Bacteria 2757
73 Ga0075365_10137927 3300006038 Bacteria 1692
74 Ga0075368_10000963 3300006042 Bacteria 8960
75 Ga0075368_10140976 3300006042 Bacteria 1004
76 Ga0075363_100011807 3300006048 Unclassified 4192
77 Ga0075363_100111486 3300006048 Unclassified 1521
78 Ga0075364_10025485 3300006051 Bacteria 3764
79 Ga0075364_10054828 3300006051 Bacteria 2608
80 Ga0075364_10351888 3300006051 Bacteria 1004
81 Ga0070715_10007006 3300006163 Bacteria 3859
82 Ga0070715_10266642 3300006163 Bacteria 902
83 Ga0070716_100010510 3300006173 Bacteria 4641
84 Ga0070716_100863591 3300006173 Unclassified 705
85 Ga0070712_100056312 3300006175 Bacteria 2757
86 Ga0070712_101061530 3300006175 Bacteria 702
87 Ga0075367_10000251 3300006178 Bacteria 18199
88 Ga0075367_10069255 3300006178 Bacteria 2118
89 Ga0075369_10017516 3300006186 Bacteria 2905
90 Ga0068871_100020565 3300006358 Bacteria 5058
91 Ga0075428_100776135 3300006844 Unclassified 1019
92 Ga0075430_101672217 3300006846 Unclassified 522
93 Ga0068865_100328000 3300006881 Unclassified 1233
94 Ga0075436_100002350 3300006914 Bacteria 13057
95 Ga0097620_100679189 3300006931 Bacteria 1121
96 Ga0075435_100014854 3300007076 Bacteria 5839
97 Ga0105240_10193046 3300009093 Bacteria 2393
98 Ga0111539_10171838 3300009094 Bacteria 2532
99 Ga0111539_10707232 3300009094 Bacteria 1173
100 Ga0105245_10183046 3300009098 Bacteria 2003
101 Ga0105245_12350951 3300009098 Unclassified 587
102 Ga0105247_10106836 3300009101 Bacteria 1796
103 Ga0114129_10098392 3300009147 Bacteria 4049
104 Ga0105243_10011714 3300009148 Bacteria 6634
105 Ga0105241_10031372 3300009174 Bacteria 3979
106 Ga0105241_11969806 3300009174 Unclassified 574
107 Ga0105242_10062839 3300009176 Bacteria 3057
108 Ga0105248_10059319 3300009177 Bacteria 4298
109 Ga0105248_10541336 3300009177 Bacteria 1313
110 Ga0105237_11769919 3300009545 Bacteria 625
111 Ga0105237_12174991 3300009545 Bacteria 564
112 Ga0105238_10264816 3300009551 Bacteria 1699
113 Ga0105238_10722678 3300009551 Bacteria 1009
114 Ga0105249_13024331 3300009553 Unclassified 540
115 Ga0105239_11031855 3300010375 Unclassified 946
116 Ga0105246_10031053 3300011119 Bacteria 3533
117 Ga0105246_10578411 3300011119 Unclassified 967
118 Ga0157374_10918522 3300013296 Bacteria 893
119 Ga0157378_11606699 3300013297 Unclassified 696
120 Ga0163162_10102719 3300013306 Bacteria 2952
121 Ga0163162_11370531 3300013306 Unclassified 804
122 Ga0157372_11035434 3300013307 Bacteria 950
123 Ga0157375_13799307 3300013308 Bacteria 501
124 Ga0163163_10032710 3300014325 Bacteria 5025
125 Ga0163163_10291382 3300014325 Bacteria 1684
126 Ga0163163_10681237 3300014325 Bacteria 1092
127 Ga0157377_11127292 3300014745 Unclassified 603
128 Ga0157379_10246097 3300014968 Bacteria 1622
129 Ga0157379_11868912 3300014968 Bacteria 591
130 Ga0157376_10070557 3300014969 Bacteria 2966
131 Ga0157376_10932472 3300014969 Bacteria 888
132 Ga0163161_10175544 3300017792 Unclassified 1640
133 Ga0224572_1024426 3300024225 Bacteria 1160
134 Ga0207426_1075121 3300025302 Bacteria 931
135 Ga0207692_10098275 3300025898 Bacteria 1602
136 Ga0207710_10093437 3300025900 Bacteria 1411
137 Ga0207685_10003005 3300025905 Bacteria 4002
138 Ga0207645_10464924 3300025907 Bacteria 855
139 Ga0207654_10171789 3300025911 Bacteria 1408
140 Ga0207693_10094227 3300025915 Bacteria 2347
141 Ga0207694_10023152 3300025924 Bacteria 4716
142 Ga0207687_10996620 3300025927 Bacteria 718
143 Ga0207700_10001458 3300025928 Bacteria 13427
144 Ga0207664_10161441 3300025929 Bacteria 1912
145 Ga0207690_10347111 3300025932 Bacteria 1173
146 Ga0207686_10010341 3300025934 Bacteria 5079
147 Ga0207704_10785551 3300025938 Bacteria 794
148 Ga0207665_10012673 3300025939 Bacteria 5544
149 Ga0207665_10848226 3300025939 Unclassified 723
150 Ga0207711_10364476 3300025941 Bacteria 1339
151 Ga0207679_10064297 3300025945 Bacteria 2742
152 Ga0207651_10159390 3300025960 Bacteria 1767
153 Ga0207712_11730639 3300025961 Bacteria 560
154 Ga0207668_10017517 3300025972 Bacteria 4489
155 Ga0207668_10485016 3300025972 Bacteria 1061
156 Ga0207658_10151263 3300025986 Bacteria 1891
157 Ga0207703_10236405 3300026035 Bacteria 1640
158 Ga0207678_10091627 3300026067 Bacteria 2598
159 Ga0207678_10611708 3300026067 Unclassified 956
160 Ga0207678_11661382 3300026067 Unclassified 561
161 Ga0207708_10066701 3300026075 Bacteria 2751
162 Ga0207708_10690337 3300026075 Unclassified 872
163 Ga0207708_10873995 3300026075 Unclassified 777
164 Ga0207641_10031154 3300026088 Bacteria 4422
165 Ga0207641_11182595 3300026088 Bacteria 764
166 Ga0207676_10202159 3300026095 Bacteria 1756
167 Ga0207675_100133638 3300026118 Unclassified 2353
168 Ga0207683_10028581 3300026121 Bacteria 4823
169 Ga0209973_1075310 3300027252 Bacteria 532
170 Ga0209969_1007072 3300027360 Bacteria 1583
171 Ga0209967_1003584 3300027364 Bacteria 2044
172 Ga0210000_1001683 3300027462 Bacteria 3119
173 Ga0209995_1035363 3300027471 Bacteria 840
174 Ga0209999_1007425 3300027543 Bacteria 1975
175 Ga0209970_1001725 3300027614 Bacteria 3793
176 Ga0209983_1007397 3300027665 Bacteria 2251
177 Ga0209971_1043653 3300027682 Bacteria 1080
178 Ga0209813_10000966 3300027866 Bacteria 6460
179 Ga0209813_10112191 3300027866 Bacteria 940
180 Ga0209974_10015287 3300027876 Bacteria 2549
181 Ga0209974_10058318 3300027876 Bacteria 1305
182 Ga0268266_11969675 3300028379 Unclassified 558
183 Ga0268264_10059382 3300028381 Bacteria 3204
184 Ga0268264_10206899 3300028381 Bacteria 1799
185 Ga0265318_10012266 3300028577 Bacteria 3654
186 Ga0265770_1086703 3300030878 Bacteria 619
187 Ga0265330_10033596 3300031235 Bacteria 2293
188 Ga0265330_10294986 3300031235 Bacteria 683
189 Ga0265332_10139018 3300031238 Bacteria 1018
190 Ga0265332_10460180 3300031238 Bacteria 526
191 Ga0265328_10026219 3300031239 Bacteria 2193
192 Ga0265328_10068050 3300031239 Viruses 1308
193 Ga0265320_10030096 3300031240 Bacteria 2803
194 Ga0265320_10130860 3300031240 Bacteria 1140
195 Ga0265325_10000488 3300031241 Bacteria 28779
196 Ga0265325_10008489 3300031241 Bacteria 6058
197 Ga0265325_10061341 3300031241 Bacteria 1907
198 Ga0265325_10307269 3300031241 Bacteria 707
199 Ga0265325_10393959 3300031241 Bacteria 607
200 Ga0265325_10450788 3300031241 Unclassified 560
201 Ga0265329_10040573 3300031242 Bacteria 1493
202 Ga0265340_10001787 3300031247 Bacteria 12273
203 Ga0265340_10475224 3300031247 Bacteria 550
204 Ga0265339_10001333 3300031249 Bacteria 18457
205 Ga0265339_10002468 3300031249 Bacteria 13229
206 Ga0265339_10058730 3300031249 Bacteria 2076
207 Ga0265339_10297534 3300031249 Bacteria 770
208 Ga0265331_10026961 3300031250 Bacteria 2884
209 Ga0265316_10050834 3300031344 Bacteria 3258
210 Ga0265316_10079943 3300031344 Bacteria 2508
211 Ga0265316_10827951 3300031344 Bacteria 648
212 Ga0265313_10000856 3300031595 Bacteria 30671
213 Ga0265313_10002551 3300031595 Bacteria 15587
214 Ga0265313_10032450 3300031595 Bacteria 2666
215 Ga0265314_10005690 3300031711 Bacteria 11186
216 Ga0265314_10040707 3300031711 Bacteria 3333
217 Ga0265314_10495192 3300031711 Bacteria 644
218 Ga0265342_10000039 3300031712 Bacteria 140091
219 Ga0265342_10028027 3300031712 Bacteria 3513
220 Ga0265342_10033593 3300031712 Bacteria 3153
221 Ga0316578_10035620 3300031728 Bacteria 2862
222 Ga0316593_10078406 3300032168 Bacteria 1150
223 Ga0316593_10356676 3300032168 Bacteria 560
224 Ga0373958_0054304 3300034819 Bacteria 853
225 Ga0373962_0199310 3300035242 Unclassified 677
226 Ga0316574_0000191 3300035398 Bacteria 21100
227 Ga0316574_0007181 3300035398 Bacteria 6088
228 Ga0316574_0718699 3300035398 Bacteria 612
229 Ga0316582_0453342 3300036647 Bacteria 884
230 Ga0316584_0026943 3300036712 Bacteria 4227
231 Ga0316584_0223912 3300036712 Bacteria 1381
232 Ga0316584_0751550 3300036712 Bacteria 665
233 Ga0436364_1425548 3300037853 Bacteria 774
234 Ga0436365_0451370 3300039437 Bacteria 1294
235 Ga0436365_1534796 3300039437 Unclassified 1334
236 Ga0436365_1597238 3300039437 Bacteria 692
237 Ga0436363_0055075 3300039450 Bacteria 800
238 Ga0436363_0631606 3300039450 Bacteria 1085
239 Ga0436362_1147789 3300039453 Bacteria 811
240 Ga0451577_1614484 3300042876 Bacteria 572
241 Ga0466963_0311099 3300044694 Bacteria 1108
242 Ga0495648_0003683 3300046524 Bacteria 13395
243 Ga0495668_0495437 3300046616 Unclassified 673
244 Ga0495668_0557135 3300046616 Bacteria 633
245 Ga0495658_0317953 3300046683 Bacteria 986
246 Ga0495672_0074535 3300047320 Bacteria 1911
247 Ga0495672_0163749 3300047320 Unclassified 1141
248 Ga0496100_0005484 3300048903 Bacteria 6837
249 Ga0496100_0864706 3300048903 Bacteria 709
250 Ga0496101_0009593 3300048904 Bacteria 6366
251 Ga0496101_0025512 3300048904 Bacteria 4103
252 Ga0496101_1506203 3300048904 Bacteria 524
253 Ga0496102_0030319 3300048905 Bacteria 4841
254 Ga0496102_0080303 3300048905 Bacteria 3004
255 Ga0496103_0127647 3300048906 Bacteria 1622
256 Ga0496104_0000189 3300048907 Bacteria 55677
257 Ga0496104_0013255 3300048907 Bacteria 7430
258 Ga0496105_0003091 3300048908 Bacteria 12242
259 Ga0496105_0009199 3300048908 Bacteria 7715
260 Ga0496105_0019804 3300048908 Bacteria 5429
261 Ga0496106_0030517 3300048909 Bacteria 4018
262 Ga0496106_0141104 3300048909 Bacteria 1895
263 Ga0496106_0246808 3300048909 Bacteria 1427
264 Ga0496107_0014523 3300048910 Bacteria 5512
265 Ga0496108_0006455 3300048911 Bacteria 9507
266 Ga0496108_0132462 3300048911 Bacteria 2142
267 Ga0496109_0002701 3300048912 Bacteria 14875
268 Ga0496109_0041290 3300048912 Bacteria 4179
269 Ga0496110_0005718 3300048913 Bacteria 9765
270 Ga0496110_0010700 3300048913 Bacteria 7473
271 Ga0496110_0053124 3300048913 Bacteria 3561
272 Ga0496111_0000217 3300048914 Bacteria 27335
273 Ga0496111_0008107 3300048914 Bacteria 6937
274 Ga0496111_0370834 3300048914 Bacteria 1059
275 Ga0496112_0091556 3300048915 Bacteria 3010
276 Ga0496112_0373516 3300048915 Bacteria 1367
277 Ga0496113_0011119 3300048916 Bacteria 5988
278 Ga0496113_0014302 3300048916 Bacteria 5410
279 Ga0496114_0003891 3300048917 Bacteria 11512
280 Ga0496115_0015562 3300048918 Bacteria 5772
281 Ga0496115_0022206 3300048918 Bacteria 4913
282 Ga0501034_0117722 3300049571 Bacteria 2644
283 Ga0501034_0130472 3300049571 Bacteria 2497
284 Ga0501036_0113580 3300049572 Bacteria 2289
285 Ga0501038_0045626 3300049574 Bacteria 3804
286 Ga0501039_0206682 3300049575 Bacteria 1544
287 Ga0501039_0840541 3300049575 Bacteria 716
288 Ga0501040_0134180 3300049576 Unclassified 1742
289 Ga0501040_0163656 3300049576 Bacteria 1573
290 Ga0501040_1185870 3300049576 Unclassified 554
291 Ga0501041_0045749 3300049577 Bacteria 2661
292 Ga0501041_0694085 3300049577 Unclassified 651
293 Ga0501041_0903922 3300049577 Bacteria 567
294 Ga0501041_1145135 3300049577 Unclassified 502
295 Ga0501042_0070442 3300049578 Bacteria 2501
296 Ga0501042_0470455 3300049578 Bacteria 912
297 Ga0501042_0863139 3300049578 Bacteria 659
298 Ga0501048_0740107 3300049582 Bacteria 706
299 Ga0501048_1049014 3300049582 Unclassified 586
300 Ga0501070_0861082 3300049586 Bacteria 709
301 Ga0501072_0375621 3300049588 Unclassified 1128
302 Ga0501072_1308687 3300049588 Bacteria 562
303 Ga0501075_0226223 3300049591 Bacteria 1427
304 Ga0501075_0634727 3300049591 Bacteria 814
305 Ga0501076_0011506 3300049592 Bacteria 6595
306 Ga0501077_0000654 3300049593 Bacteria 20996
307 Ga0501077_0143815 3300049593 Bacteria 1513
308 Ga0501077_0155837 3300049593 Bacteria 1450
309 Ga0501079_0020328 3300049741 Bacteria 5073
310 Ga0501080_0066249 3300049742 Bacteria 3359
311 Ga0501080_0760128 3300049742 Bacteria 852
312 Ga0501081_0016894 3300049743 Bacteria 4822
313 Ga0501081_0439216 3300049743 Bacteria 969
314 Ga0501045_0011875 3300049824 Bacteria 6122
315 Ga0501045_0194939 3300049824 Unclassified 1510
316 Ga0501045_0526907 3300049824 Bacteria 877
317 Ga0501045_0661574 3300049824 Unclassified 772
318 nmdc:mga03n38_10858_c1 3300050490 Unclassified 3369
319 nmdc:mga03n38_7725_c2 3300050490 Unclassified 1094
320 nmdc:mga00v17_261341_c1 3300050491 Bacteria 1123
321 nmdc:mga00v17_28168_c1 3300050491 Bacteria 3289
322 nmdc:mga0yw44_5187_c1 3300050492 Bacteria 6107
323 nmdc:mga06z11_192986_c1 3300050494 Unclassified 1180
324 nmdc:mga06z11_2259_c1 3300050494 Bacteria 7329
325 nmdc:mga06z11_430675_c1 3300050494 Bacteria 796
326 nmdc:mga06z11_46392_c1 3300050494 Bacteria 2202
327 nmdc:mga04h51_132148_c1 3300050495 Bacteria 940
328 nmdc:mga04h51_344_c1 3300050495 Bacteria 11574
329 nmdc:mga07m45_171410_c1 3300050496 Bacteria 1261
330 nmdc:mga05p37_936705_c1 3300050507 Unclassified 929
331 nmdc:mga08y16_179379_c1 3300050511 Bacteria 2199
332 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
333 nmdc:mga0a205_1215154_c1 3300050515 Unclassified 601
334 nmdc:mga0a205_781995_c1 3300050515 Bacteria 802
335 nmdc:mga0sz30_305832_c1 3300050516 Bacteria 709
336 Ga0495619_0331889 3300053085 Bacteria 1053
337 Ga0500555_042144 3300053103 Unclassified 1268
338 Ga0500556_0137926 3300053104 Bacteria 958
339 Ga0500592_044638 3300053116 Bacteria 718
340 Ga0500652_117553 3300053131 Bacteria 1111
341 Ga0500645_023360 3300053730 Bacteria 1895
342 Ga0501084_0060847 3300054114 Bacteria 3161
343 Ga0501084_0854589 3300054114 Bacteria 766
344 Ga0501082_0016868 3300060353 Bacteria 6289
345 Ga0501082_0129436 3300060353 Bacteria 2190
346 Ga0501082_0938598 3300060353 Unclassified 757
347 Ga0501082_1989269 3300060353 Unclassified 507
348 Ga0530510_0001488 3300061734 Bacteria 15738
349 Ga0530510_0381300 3300061734 Unclassified 1061
350 Ga0530510_1304799 3300061734 Unclassified 557
351 2513723428 2513237104 Bacteria 10034502
352 Ga0316575_10023647
353 JGI25404J52841_10012748
354 Ga0065712_10283519
355 Ga0070676_10079908
356 Ga0070670_100103337
357 Ga0070666_10018627
358 Ga0070668_100297181
359 Ga0070668_100951687
360 Ga0070668_101665734
361 Ga0070669_100607286
362 Ga0070675_101262791
363 Ga0070671_100270487
364 Ga0070674_100483251
365 Ga0070674_100510056
366 Ga0070673_100132432
367 Ga0070688_100007651
368 Ga0070688_100603704
369 Ga0070659_101120406
370 Ga0070667_100053779
371 Ga0070709_10003763
372 Ga0070714_100008153
373 Ga0070713_100002516
374 Ga0070710_10015138
375 Ga0070701_10123284
376 Ga0070711_100068834
377 Ga0070705_100410863
378 Ga0070700_100035982
379 Ga0070700_100601740
380 Ga0070694_100956017
381 Ga0070663_100086264
382 Ga0070663_100892189
383 Ga0070678_100020401
384 Ga0070662_100607698
385 Ga0070685_10022464
386 Ga0070706_101919107
387 Ga0070684_100154873
388 Ga0070684_100393519
389 Ga0070697_100103986
390 Ga0068853_100303986
391 Ga0068853_101893389
392 Ga0070686_100371753
393 Ga0070695_100002139
394 Ga0070695_100012605
395 Ga0070696_100912472
396 Ga0070665_100319395
397 Ga0070665_102395142
398 Ga0070704_101964697
399 Ga0070664_100092710
400 Ga0070702_100232463
401 Ga0070702_101470567
402 Ga0068859_100679241
403 Ga0068864_100059380
404 Ga0068866_10166308
405 Ga0068861_100032105
406 Ga0068861_100116133
407 Ga0068861_102358953
408 Ga0068863_100013114
409 Ga0068863_101255321
410 Ga0068858_100018644
411 Ga0068860_100025489
412 Ga0068860_100242015
413 Ga0068860_102189497
414 Ga0068862_100929210
415 Ga0081455_10008463
416 Ga0081455_10356594
417 Ga0081540_1000080
418 Ga0081540_1000114
419 Ga0081540_1026224
420 Ga0081540_1101119
421 Ga0081539_10007592
422 Ga0070717_10032116
423 Ga0075365_10049970
424 Ga0075365_10137927
425 Ga0075368_10000963
426 Ga0075368_10140976
427 Ga0075363_100011807
428 Ga0075363_100111486
429 Ga0075364_10025485
430 Ga0075364_10054828
431 Ga0075364_10351888
432 Ga0070715_10007006
433 Ga0070715_10266642
434 Ga0070716_100010510
435 Ga0070716_100863591
436 Ga0070712_100056312
437 Ga0070712_101061530
438 Ga0075367_10000251
439 Ga0075367_10069255
440 Ga0075369_10017516
441 Ga0068871_100020565
442 Ga0075428_100776135
443 Ga0075430_101672217
444 Ga0068865_100328000
445 Ga0075436_100002350
446 Ga0097620_100679189
447 Ga0075435_100014854
448 Ga0105240_10193046
449 Ga0111539_10171838
450 Ga0111539_10707232
451 Ga0105245_10183046
452 Ga0105245_12350951
453 Ga0105247_10106836
454 Ga0114129_10098392
455 Ga0105243_10011714
456 Ga0105241_10031372
457 Ga0105241_11969806
458 Ga0105242_10062839
459 Ga0105248_10059319
460 Ga0105248_10541336
461 Ga0105237_11769919
462 Ga0105237_12174991
463 Ga0105238_10264816
464 Ga0105238_10722678
465 Ga0105249_13024331
466 Ga0105239_11031855
467 Ga0105246_10031053
468 Ga0105246_10578411
469 Ga0157374_10918522
470 Ga0157378_11606699
471 Ga0163162_10102719
472 Ga0163162_11370531
473 Ga0157372_11035434
474 Ga0157375_13799307
475 Ga0163163_10032710
476 Ga0163163_10291382
477 Ga0163163_10681237
478 Ga0157377_11127292
479 Ga0157379_10246097
480 Ga0157379_11868912
481 Ga0157376_10070557
482 Ga0157376_10932472
483 Ga0163161_10175544
484 Ga0224572_1024426
485 Ga0207426_1075121
486 Ga0207692_10098275
487 Ga0207710_10093437
488 Ga0207685_10003005
489 Ga0207645_10464924
490 Ga0207654_10171789
491 Ga0207693_10094227
492 Ga0207694_10023152
493 Ga0207687_10996620
494 Ga0207700_10001458
495 Ga0207664_10161441
496 Ga0207690_10347111
497 Ga0207686_10010341
498 Ga0207704_10785551
499 Ga0207665_10012673
500 Ga0207665_10848226
501 Ga0207711_10364476
502 Ga0207679_10064297
503 Ga0207651_10159390
504 Ga0207712_11730639
505 Ga0207668_10017517
506 Ga0207668_10485016
507 Ga0207658_10151263
508 Ga0207703_10236405
509 Ga0207678_10091627
510 Ga0207678_10611708
511 Ga0207678_11661382
512 Ga0207708_10066701
513 Ga0207708_10690337
514 Ga0207708_10873995
515 Ga0207641_10031154
516 Ga0207641_11182595
517 Ga0207676_10202159
518 Ga0207675_100133638
519 Ga0207683_10028581
520 Ga0209973_1075310
521 Ga0209969_1007072
522 Ga0209967_1003584
523 Ga0210000_1001683
524 Ga0209995_1035363
525 Ga0209999_1007425
526 Ga0209970_1001725
527 Ga0209983_1007397
528 Ga0209971_1043653
529 Ga0209813_10000966
530 Ga0209813_10112191
531 Ga0209974_10015287
532 Ga0209974_10058318
533 Ga0268266_11969675
534 Ga0268264_10059382
535 Ga0268264_10206899
536 Ga0265318_10012266
537 Ga0265770_1086703
538 Ga0265330_10033596
539 Ga0265330_10294986
540 Ga0265332_10139018
541 Ga0265332_10460180
542 Ga0265328_10026219
543 Ga0265328_10068050
544 Ga0265320_10030096
545 Ga0265320_10130860
546 Ga0265325_10000488
547 Ga0265325_10008489
548 Ga0265325_10061341
549 Ga0265325_10307269
550 Ga0265325_10393959
551 Ga0265325_10450788
552 Ga0265329_10040573
553 Ga0265340_10001787
554 Ga0265340_10475224
555 Ga0265339_10001333
556 Ga0265339_10002468
557 Ga0265339_10058730
558 Ga0265339_10297534
559 Ga0265331_10026961
560 Ga0265316_10050834
561 Ga0265316_10079943
562 Ga0265316_10827951
563 Ga0265313_10000856
564 Ga0265313_10002551
565 Ga0265313_10032450
566 Ga0265314_10005690
567 Ga0265314_10040707
568 Ga0265314_10495192
569 Ga0265342_10000039
570 Ga0265342_10028027
571 Ga0265342_10033593
572 Ga0316578_10035620
573 Ga0316593_10078406
574 Ga0316593_10356676
575 Ga0373958_0054304
576 Ga0373962_0199310
577 Ga0316574_0000191
578 Ga0316574_0007181
579 Ga0316574_0718699
580 Ga0316582_0453342
581 Ga0316584_0026943
582 Ga0316584_0223912
583 Ga0316584_0751550
584 Ga0436364_1425548
585 Ga0436365_0451370
586 Ga0436365_1534796
587 Ga0436365_1597238
588 Ga0436363_0055075
589 Ga0436363_0631606
590 Ga0436362_1147789
591 Ga0451577_1614484
592 Ga0466963_0311099
593 Ga0495648_0003683
594 Ga0495668_0495437
595 Ga0495668_0557135
596 Ga0495658_0317953
597 Ga0495672_0074535
598 Ga0495672_0163749
599 Ga0496100_0005484
600 Ga0496100_0864706
601 Ga0496101_0009593
602 Ga0496101_0025512
603 Ga0496101_1506203
604 Ga0496102_0030319
605 Ga0496102_0080303
606 Ga0496103_0127647
607 Ga0496104_0000189
608 Ga0496104_0013255
609 Ga0496105_0003091
610 Ga0496105_0009199
611 Ga0496105_0019804
612 Ga0496106_0030517
613 Ga0496106_0141104
614 Ga0496106_0246808
615 Ga0496107_0014523
616 Ga0496108_0006455
617 Ga0496108_0132462
618 Ga0496109_0002701
619 Ga0496109_0041290
620 Ga0496110_0005718
621 Ga0496110_0010700
622 Ga0496110_0053124
623 Ga0496111_0000217
624 Ga0496111_0008107
625 Ga0496111_0370834
626 Ga0496112_0091556
627 Ga0496112_0373516
628 Ga0496113_0011119
629 Ga0496113_0014302
630 Ga0496114_0003891
631 Ga0496115_0015562
632 Ga0496115_0022206
633 Ga0501034_0117722
634 Ga0501034_0130472
635 Ga0501036_0113580
636 Ga0501038_0045626
637 Ga0501039_0206682
638 Ga0501039_0840541
639 Ga0501040_0134180
640 Ga0501040_0163656
641 Ga0501040_1185870
642 Ga0501041_0045749
643 Ga0501041_0694085
644 Ga0501041_0903922
645 Ga0501041_1145135
646 Ga0501042_0070442
647 Ga0501042_0470455
648 Ga0501042_0863139
649 Ga0501048_0740107
650 Ga0501048_1049014
651 Ga0501070_0861082
652 Ga0501072_0375621
653 Ga0501072_1308687
654 Ga0501075_0226223
655 Ga0501075_0634727
656 Ga0501076_0011506
657 Ga0501077_0000654
658 Ga0501077_0143815
659 Ga0501077_0155837
660 Ga0501079_0020328
661 Ga0501080_0066249
662 Ga0501080_0760128
663 Ga0501081_0016894
664 Ga0501081_0439216
665 Ga0501045_0011875
666 Ga0501045_0194939
667 Ga0501045_0526907
668 Ga0501045_0661574
669 nmdc:mga03n38_10858_c1
670 nmdc:mga03n38_7725_c2
671 nmdc:mga00v17_261341_c1
672 nmdc:mga00v17_28168_c1
673 nmdc:mga0yw44_5187_c1
674 nmdc:mga06z11_192986_c1
675 nmdc:mga06z11_2259_c1
676 nmdc:mga06z11_430675_c1
677 nmdc:mga06z11_46392_c1
678 nmdc:mga04h51_132148_c1
679 nmdc:mga04h51_344_c1
680 nmdc:mga07m45_171410_c1
681 nmdc:mga05p37_936705_c1
682 nmdc:mga08y16_179379_c1
683 nmdc:mga08x19_22_c1
684 nmdc:mga0a205_1215154_c1
685 nmdc:mga0a205_781995_c1
686 nmdc:mga0sz30_305832_c1
687 Ga0495619_0331889
688 Ga0500555_042144
689 Ga0500556_0137926
690 Ga0500592_044638
691 Ga0500652_117553
692 Ga0500645_023360
693 Ga0501084_0060847
694 Ga0501084_0854589
695 Ga0501082_0016868
696 Ga0501082_0129436
697 Ga0501082_0938598
698 Ga0501082_1989269
699 Ga0530510_0001488
700 Ga0530510_0381300
701 Ga0530510_1304799
702 2513723428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13686

DrsE_2

DsrE/DsrF/DrsH-like family

62

142

0.88

PF02635

DsrE

DsrE/DsrF-like family

23

144

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.816 1 125
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.8099 1 125
6u0s-assembly1.cif.gz_A crystal structure of the flavin-dependent monooxygenase piee in complex with fad and substrate 0.7982 4 41
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.7959 4 125
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.7931 4 125
ID Description Score Start End Superfamily
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.8872 4 41 3.30.300.30
af_Q5ADQ8_44_340_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8688 4 41 3.50.50.60
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8558 1 119 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8203 4 125 3.40.1260.10
af_Q22180_1_276_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8078 1 40 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1Q4DH77-F1-model_v4 Peroxiredoxin 0.981 21 125
AF-A0A431MST6-F1-model_v4 Peroxiredoxin 0.9755 4 125
AF-A0A0Q7TPH8-F1-model_v4 Peroxiredoxin 0.9752 9 125
AF-A0A1Q3JTY7-F1-model_v4 Peroxiredoxin 0.974 1 103
AF-A0A285S6E5-F1-model_v4 Predicted peroxiredoxin 0.9681 1 125

Map