F418660

General Info

Members Datasets Scaffolds Average Seq Length
351 176 351 122

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10014887|Ga0207646_100148879
Length 136
Sequence VRASRRSARRRSELIAVPLAVFLMISSADGAVLGACLALAAATLLFIFYIQPDASDLAPHRSKLDQLMERRDAIYDNLRDLRFEYRAGKYSEDDYEAMKNAMETEAALVLAEIDQVTDAGVKRPRGPRPAAERGPR

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
84 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.85
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10005748 3300005406 Bacteria 3473
2 Ga0070709_10066910 3300005434 Unclassified 2306
3 Ga0070709_10535921 3300005434 Bacteria 894
4 Ga0070709_11012364 3300005434 Unclassified 661
5 Ga0070714_100091362 3300005435 Unclassified 2667
6 Ga0070714_100242178 3300005435 Bacteria 1665
7 Ga0070714_100358284 3300005435 Unclassified 1371
8 Ga0070713_100233909 3300005436 Unclassified 1671
9 Ga0070713_100523419 3300005436 Unclassified 1121
10 Ga0070710_10225912 3300005437 Bacteria 1193
11 Ga0070710_10268918 3300005437 Unclassified 1102
12 Ga0070710_11396806 3300005437 Bacteria 523
13 Ga0070710_11465802 3300005437 Unclassified 512
14 Ga0070711_100015579 3300005439 Bacteria 4812
15 Ga0070711_100026155 3300005439 Bacteria 3823
16 Ga0070711_100165954 3300005439 Bacteria 1678
17 Ga0070711_100339299 3300005439 Bacteria 1205
18 Ga0070711_100539546 3300005439 Archaea 966
19 Ga0070711_101026553 3300005439 Bacteria 708
20 Ga0070711_101034960 3300005439 Bacteria 705
21 Ga0070705_100041740 3300005440 Unclassified 2618
22 Ga0070694_100033774 3300005444 Unclassified 3370
23 Ga0070708_100001983 3300005445 Bacteria 15764
24 Ga0070708_100016658 3300005445 Bacteria 6106
25 Ga0070708_100027431 3300005445 Bacteria 4886
26 Ga0070708_100032966 3300005445 Bacteria 4497
27 Ga0070708_100118103 3300005445 Bacteria 2443
28 Ga0070708_100580056 3300005445 Unclassified 1057
29 Ga0070708_101781730 3300005445 Unclassified 572
30 Ga0070681_10061173 3300005458 Bacteria 3742
31 Ga0068867_100430300 3300005459 Unclassified 1120
32 Ga0070706_100004828 3300005467 Bacteria 12910
33 Ga0070706_100146839 3300005467 Viruses 2202
34 Ga0070706_100266943 3300005467 Bacteria 1597
35 Ga0070707_100018606 3300005468 Bacteria 6536
36 Ga0070707_100023596 3300005468 Bacteria 5818
37 Ga0070707_100113905 3300005468 Bacteria 2624
38 Ga0070707_100186997 3300005468 Unclassified 2020
39 Ga0070707_100468986 3300005468 Viruses 1220
40 Ga0070707_101000444 3300005468 Unclassified 801
41 Ga0070707_102063071 3300005468 Unclassified 538
42 Ga0070707_102229028 3300005468 Unclassified 515
43 Ga0070698_100029548 3300005471 Bacteria 5691
44 Ga0070698_100132715 3300005471 Bacteria 2445
45 Ga0070698_102166923 3300005471 Unclassified 509
46 Ga0070699_100040372 3300005518 Unclassified 4040
47 Ga0070699_100136227 3300005518 Bacteria 2166
48 Ga0070699_100162508 3300005518 Unclassified 1977
49 Ga0070699_100275786 3300005518 Unclassified 1506
50 Ga0070699_101007330 3300005518 Unclassified 764
51 Ga0070679_100228796 3300005530 Unclassified 1819
52 Ga0070697_100000188 3300005536 Bacteria 51099
53 Ga0070697_100001723 3300005536 Bacteria 16697
54 Ga0070686_100067705 3300005544 Bacteria 2327
55 Ga0070695_100013954 3300005545 Bacteria 4836
56 Ga0070695_100076457 3300005545 Unclassified 2205
57 Ga0070696_100001179 3300005546 Bacteria 16921
58 Ga0070696_100944577 3300005546 Bacteria 717
59 Ga0070693_100000095 3300005547 Bacteria 38467
60 Ga0070665_100003590 3300005548 Bacteria 16432
61 Ga0070665_100993821 3300005548 Unclassified 851
62 Ga0070704_100002381 3300005549 Bacteria 10550
63 Ga0070704_100140615 3300005549 Bacteria 1884
64 Ga0068863_100005925 3300005841 Bacteria 11990
65 Ga0068863_100311078 3300005841 Bacteria 1529
66 Ga0068863_100733642 3300005841 Unclassified 983
67 Ga0068858_100025597 3300005842 Bacteria 5490
68 Ga0068858_100855129 3300005842 Bacteria 888
69 Ga0068860_100013682 3300005843 Bacteria 7955
70 Ga0068860_100165869 3300005843 Bacteria 2132
71 Ga0068860_100996569 3300005843 Unclassified 856
72 Ga0081455_10265510 3300005937 Bacteria 1248
73 Ga0070717_10033106 3300006028 Unclassified 4168
74 Ga0070717_10801169 3300006028 Unclassified 857
75 Ga0070717_10996780 3300006028 Bacteria 763
76 Ga0070717_11364732 3300006028 Unclassified 644
77 Ga0070715_10064096 3300006163 Unclassified 1622
78 Ga0070715_10115249 3300006163 Bacteria 1273
79 Ga0070715_10767424 3300006163 Unclassified 582
80 Ga0070716_100000044 3300006173 Bacteria 50397
81 Ga0070716_100035973 3300006173 Unclassified 2727
82 Ga0070716_100110419 3300006173 Unclassified 1703
83 Ga0070716_100126650 3300006173 Unclassified 1607
84 Ga0070716_100170857 3300006173 Bacteria 1418
85 Ga0070716_100176820 3300006173 Unclassified 1398
86 Ga0070716_100345354 3300006173 Bacteria 1051
87 Ga0070716_100410743 3300006173 Unclassified 976
88 Ga0070716_101644600 3300006173 Unclassified 528
89 Ga0070716_101708117 3300006173 Unclassified 519
90 Ga0070712_100021238 3300006175 Unclassified 4261
91 Ga0070712_100024150 3300006175 Bacteria 4024
92 Ga0070712_100044968 3300006175 Bacteria 3047
93 Ga0070712_100984761 3300006175 Unclassified 729
94 Ga0097621_100010961 3300006237 Bacteria 6657
95 Ga0097621_100078760 3300006237 Unclassified 2738
96 Ga0068871_100062325 3300006358 Bacteria 3047
97 Ga0075433_10454174 3300006852 Unclassified 1129
98 Ga0075434_100011928 3300006871 Bacteria 8219
99 Ga0075434_100072504 3300006871 Bacteria 3436
100 Ga0075436_100000079 3300006914 Bacteria 55394
101 Ga0075436_100045653 3300006914 Bacteria 3022
102 Ga0075436_100058712 3300006914 Bacteria 2657
103 Ga0075436_100061674 3300006914 Bacteria 2591
104 Ga0075436_101504292 3300006914 Bacteria 511
105 Ga0075435_100057600 3300007076 Bacteria 3144
106 Ga0099794_10003091 3300007265 Bacteria 6292
107 Ga0099794_10008304 3300007265 Bacteria 4306
108 Ga0099794_10016384 3300007265 Bacteria 3284
109 Ga0099794_10033666 3300007265 Bacteria 2410
110 Ga0099794_10108024 3300007265 Unclassified 1392
111 Ga0099794_10126964 3300007265 Unclassified 1286
112 Ga0099794_10193044 3300007265 Bacteria 1042
113 Ga0099794_10193276 3300007265 Unclassified 1041
114 Ga0099794_10360482 3300007265 Unclassified 757
115 Ga0099794_10580190 3300007265 Unclassified 593
116 Ga0099794_10699789 3300007265 Unclassified 540
117 Ga0099794_10753300 3300007265 Unclassified 520
118 Ga0099795_10028794 3300007788 Unclassified 1892
119 Ga0099795_10078124 3300007788 Bacteria 1261
120 Ga0099795_10297156 3300007788 Unclassified 709
121 Ga0105240_10020804 3300009093 Bacteria 8738
122 Ga0105245_10645328 3300009098 Bacteria 1088
123 Ga0105243_10143913 3300009148 Bacteria 2037
124 Ga0105248_10890230 3300009177 Bacteria 1005
125 Ga0105248_11269685 3300009177 Bacteria 833
126 Ga0105237_10191716 3300009545 Bacteria 2044
127 Ga0105237_10312280 3300009545 Unclassified 1575
128 Ga0105238_11094937 3300009551 Unclassified 819
129 Ga0105249_10801810 3300009553 Bacteria 1006
130 Ga0105249_11321593 3300009553 Unclassified 793
131 Ga0099796_10063047 3300010159 Unclassified 1319
132 Ga0105239_11032880 3300010375 Bacteria 945
133 Ga0157370_10357138 3300013104 Bacteria 1347
134 Ga0157374_11322998 3300013296 Bacteria 743
135 Ga0157378_10000471 3300013297 Bacteria 38401
136 Ga0157378_10002309 3300013297 Bacteria 16963
137 Ga0163162_10063358 3300013306 Bacteria 3740
138 Ga0157372_10460158 3300013307 Unclassified 1483
139 Ga0157375_10508721 3300013308 Unclassified 1368
140 Ga0157375_12853642 3300013308 Unclassified 578
141 Ga0163163_10187261 3300014325 Bacteria 2117
142 Ga0163163_10574320 3300014325 Unclassified 1190
143 Ga0157379_10869526 3300014968 Bacteria 854
144 Ga0157376_10000004 3300014969 Bacteria 508493
145 Ga0157376_10001354 3300014969 Bacteria 16131
146 Ga0157376_11405677 3300014969 Unclassified 729
147 Ga0224572_1062670 3300024225 Unclassified 688
148 Ga0228598_1000308 3300024227 Bacteria 9548
149 Ga0207653_10004052 3300025885 Bacteria 4612
150 Ga0207692_10184078 3300025898 Unclassified 1218
151 Ga0207692_10848700 3300025898 Bacteria 599
152 Ga0207685_10065811 3300025905 Unclassified 1452
153 Ga0207685_10121173 3300025905 Unclassified 1148
154 Ga0207699_10000410 3300025906 Bacteria 22037
155 Ga0207699_10027220 3300025906 Bacteria 3162
156 Ga0207699_10095165 3300025906 Bacteria 1878
157 Ga0207699_10295055 3300025906 Unclassified 1131
158 Ga0207699_10784459 3300025906 Unclassified 700
159 Ga0207699_10831673 3300025906 Unclassified 679
160 Ga0207699_11421360 3300025906 Unclassified 513
161 Ga0207684_10002249 3300025910 Bacteria 19673
162 Ga0207684_10070670 3300025910 Viruses 2967
163 Ga0207684_10294551 3300025910 Bacteria 1399
164 Ga0207684_11455469 3300025910 Unclassified 559
165 Ga0207695_10107367 3300025913 Bacteria 2777
166 Ga0207671_11058341 3300025914 Unclassified 638
167 Ga0207693_10341011 3300025915 Bacteria 1173
168 Ga0207693_10776474 3300025915 Unclassified 739
169 Ga0207663_10056709 3300025916 Unclassified 2465
170 Ga0207663_10696197 3300025916 Unclassified 804
171 Ga0207663_11284262 3300025916 Unclassified 589
172 Ga0207663_11359854 3300025916 Bacteria 572
173 Ga0207652_10152451 3300025921 Unclassified 2070
174 Ga0207646_10014887 3300025922 Bacteria 7367
175 Ga0207646_10037066 3300025922 Bacteria 4398
176 Ga0207687_10467624 3300025927 Bacteria 1048
177 Ga0207700_10266440 3300025928 Unclassified 1469
178 Ga0207700_10343894 3300025928 Unclassified 1297
179 Ga0207700_10784027 3300025928 Unclassified 852
180 Ga0207664_10072910 3300025929 Bacteria 2770
181 Ga0207664_10232635 3300025929 Bacteria 1602
182 Ga0207664_10346896 3300025929 Unclassified 1313
183 Ga0207664_10843985 3300025929 Bacteria 823
184 Ga0207669_11154146 3300025937 Unclassified 655
185 Ga0207665_10000030 3300025939 Bacteria 94900
186 Ga0207665_10009702 3300025939 Bacteria 6321
187 Ga0207665_10053840 3300025939 Bacteria 2713
188 Ga0207665_10076399 3300025939 Bacteria 2296
189 Ga0207665_10081696 3300025939 Unclassified 2226
190 Ga0207665_10383451 3300025939 Unclassified 1067
191 Ga0207665_10483922 3300025939 Bacteria 954
192 Ga0207665_10502899 3300025939 Bacteria 936
193 Ga0207665_10735543 3300025939 Bacteria 777
194 Ga0207665_10862408 3300025939 Bacteria 717
195 Ga0207665_10973093 3300025939 Unclassified 674
196 Ga0207711_10654670 3300025941 Bacteria 980
197 Ga0207689_11326561 3300025942 Bacteria 604
198 Ga0207703_10790417 3300026035 Bacteria 906
199 Ga0207641_10006629 3300026088 Bacteria 9720
200 Ga0207641_10974983 3300026088 Bacteria 844
201 Ga0207641_11567930 3300026088 Unclassified 660
202 Ga0207648_10550273 3300026089 Unclassified 1060
203 Ga0209179_1068031 3300027512 Unclassified 778
204 Ga0209588_1000250 3300027671 Bacteria 14306
205 Ga0209588_1004462 3300027671 Bacteria 3947
206 Ga0209588_1018861 3300027671 Bacteria 2149
207 Ga0209588_1021210 3300027671 Unclassified 2039
208 Ga0209588_1057948 3300027671 Unclassified 1252
209 Ga0209588_1104690 3300027671 Unclassified 910
210 Ga0209588_1111596 3300027671 Unclassified 878
211 Ga0209588_1171605 3300027671 Unclassified 682
212 Ga0265354_1000011 3300028016 Bacteria 29647
213 Ga0265354_1003178 3300028016 Unclassified 1876
214 Ga0265357_1041702 3300028023 Unclassified 539
215 Ga0268266_10000470 3300028379 Bacteria 58333
216 Ga0268264_10768963 3300028381 Bacteria 961
217 Ga0265338_10102250 3300028800 Unclassified 2331
218 Ga0265762_1065409 3300030760 Bacteria 754
219 Ga0265770_1000145 3300030878 Bacteria 8781
220 Ga0265765_1000262 3300030879 Bacteria 3811
221 Ga0265760_10006021 3300031090 Bacteria 3465
222 Ga0265760_10006910 3300031090 Bacteria 3254
223 Ga0265760_10037802 3300031090 Bacteria 1434
224 Ga0265330_10113216 3300031235 Unclassified 1158
225 Ga0265328_10079135 3300031239 Unclassified 1211
226 Ga0265325_10062777 3300031241 Bacteria 1881
227 Ga0265340_10199767 3300031247 Unclassified 899
228 Ga0265339_10218145 3300031249 Unclassified 934
229 Ga0265331_10007778 3300031250 Bacteria 6153
230 Ga0265316_10010776 3300031344 Bacteria 8305
231 Ga0265314_10201768 3300031711 Unclassified 1175
232 Ga0265342_10160229 3300031712 Unclassified 1244
233 Ga0316212_1018585 3300033547 Unclassified 977
234 Ga0373934_0000532 3300035086 Bacteria 13463
235 Ga0373944_0201376 3300035089 Unclassified 721
236 Ga0373923_0030910 3300035111 Bacteria 2156
237 Ga0373923_0224997 3300035111 Bacteria 873
238 Ga0373923_0315942 3300035111 Unclassified 741
239 Ga0373945_0208221 3300035116 Bacteria 814
240 Ga0373953_0005823 3300035117 Bacteria 4029
241 Ga0373954_0001245 3300035118 Bacteria 10252
242 Ga0373954_0631368 3300035118 Unclassified 531
243 Ga0373956_0008977 3300035119 Bacteria 4054
244 Ga0373956_0094127 3300035119 Bacteria 1384
245 Ga0373957_0014733 3300035120 Bacteria 2678
246 Ga0373946_0003377 3300035171 Bacteria 5663
247 Ga0373955_0000888 3300035172 Bacteria 12846
248 Ga0373924_0019384 3300035410 Bacteria 2636
249 Ga0373935_1009002 3300035692 Bacteria 618
250 Ga0373927_0199790 3300035695 Bacteria 1312
251 Ga0373933_0000251 3300035724 Bacteria 35333
252 Ga0373947_0005922 3300035725 Bacteria 7123
253 Ga0373937_0001122 3300036401 Bacteria 22574
254 Ga0373937_0075281 3300036401 Bacteria 3116
255 Ga0373937_0235943 3300036401 Unclassified 1723
256 Ga0373925_0003359 3300037068 Bacteria 12414
257 Ga0373925_0045401 3300037068 Bacteria 3264
258 Ga0395900_1400957 3300037418 Unclassified 612
259 Ga0395898_1189220 3300037466 Bacteria 694
260 Ga0436365_0537176 3300039437 Unclassified 1387
261 Ga0436365_0649915 3300039437 Bacteria 725
262 Ga0436365_1009643 3300039437 Bacteria 14972
263 Ga0436361_0480296 3300039447 Bacteria 952
264 Ga0436363_0352287 3300039450 Bacteria 785
265 Ga0451576_0837126 3300045051 Bacteria 966
266 Ga0495592_0273687 3300046454 Unclassified 1107
267 Ga0495603_0011287 3300046455 Bacteria 5412
268 Ga0495603_0752564 3300046455 Unclassified 556
269 Ga0495629_0022418 3300046459 Bacteria 4503
270 Ga0495641_0042802 3300046461 Unclassified 2097
271 Ga0495641_0076798 3300046461 Unclassified 1497
272 Ga0495651_0040015 3300046462 Bacteria 3646
273 Ga0495651_0437813 3300046462 Unclassified 847
274 Ga0495653_0172035 3300046463 Unclassified 1494
275 Ga0495580_0007052 3300046472 Bacteria 9058
276 Ga0495580_0056519 3300046472 Bacteria 2763
277 Ga0495580_0090561 3300046472 Unclassified 2130
278 Ga0495580_0213127 3300046472 Unclassified 1328
279 Ga0495582_0000527 3300046473 Bacteria 21118
280 Ga0495582_0004757 3300046473 Bacteria 7633
281 Ga0495639_0001706 3300046475 Bacteria 9759
282 Ga0495664_0062632 3300046477 Bacteria 2216
283 Ga0495664_0413571 3300046477 Unclassified 809
284 Ga0495594_0281561 3300046499 Unclassified 947
285 Ga0495618_0054979 3300046514 Bacteria 2520
286 Ga0495618_0116493 3300046514 Unclassified 1711
287 Ga0495628_0070576 3300046516 Bacteria 2724
288 Ga0495628_0779199 3300046516 Unclassified 670
289 Ga0495630_0026394 3300046517 Bacteria 4300
290 Ga0495630_0031427 3300046517 Bacteria 3953
291 Ga0495630_1325606 3300046517 Unclassified 542
292 Ga0495666_0006576 3300046526 Bacteria 5846
293 Ga0495665_0327920 3300046531 Unclassified 781
294 Ga0495640_0019119 3300046533 Bacteria 5062
295 Ga0495586_0015107 3300046535 Bacteria 4108
296 Ga0495587_0001635 3300046536 Bacteria 14936
297 Ga0495587_0008530 3300046536 Bacteria 6582
298 Ga0495587_0224850 3300046536 Bacteria 1058
299 Ga0495667_0288878 3300046559 Unclassified 1040
300 Ga0495667_0872064 3300046559 Unclassified 553
301 Ga0495635_0028536 3300046663 Bacteria 3880
302 Ga0495635_0236251 3300046663 Bacteria 1234
303 Ga0495588_0470680 3300046674 Unclassified 659
304 Ga0495657_0265661 3300046675 Bacteria 1030
305 Ga0495657_0605983 3300046675 Unclassified 633
306 Ga0495599_0552907 3300046678 Unclassified 674
307 Ga0495623_0040778 3300046679 Bacteria 2963
308 Ga0495646_0201676 3300046680 Bacteria 1083
309 Ga0495647_0038937 3300046681 Unclassified 1799
310 Ga0495658_0036765 3300046683 Bacteria 2703
311 Ga0495658_0126360 3300046683 Bacteria 1552
312 Ga0495613_0259685 3300046689 Unclassified 1210
313 Ga0495624_0080933 3300046690 Unclassified 2012
314 Ga0495624_0097902 3300046690 Unclassified 1807
315 Ga0495581_0296283 3300047315 Unclassified 945
316 Ga0495604_0001286 3300047317 Bacteria 20525
317 Ga0495604_0199228 3300047317 Unclassified 1390
318 Ga0495604_0534523 3300047317 Unclassified 757
319 Ga0495674_0026673 3300047319 Bacteria 5285
320 Ga0495674_0043497 3300047319 Bacteria 3997
321 Ga0495674_0069164 3300047319 Bacteria 3054
322 Ga0495676_0029959 3300047321 Bacteria 4626
323 Ga0495680_0093422 3300047322 Unclassified 2252
324 Ga0495680_0116203 3300047322 Unclassified 1978
325 Ga0495680_0295586 3300047322 Unclassified 1138
326 Ga0495684_0011358 3300047471 Bacteria 6876
327 Ga0495684_0032592 3300047471 Bacteria 4001
328 Ga0495684_0273593 3300047471 Bacteria 1221
329 Ga0495593_0064255 3300047673 Unclassified 1916
330 Ga0495602_0015630 3300048088 Bacteria 7654
331 Ga0495602_0353936 3300048088 Unclassified 1059
332 Ga0495614_0011383 3300048089 Bacteria 3916
333 Ga0496100_0123881 3300048903 Unclassified 1812
334 Ga0496101_0099704 3300048904 Unclassified 2172
335 Ga0496102_0024639 3300048905 Bacteria 5350
336 Ga0496104_0350242 3300048907 Bacteria 1390
337 Ga0496106_0020663 3300048909 Bacteria 4889
338 Ga0496107_1102198 3300048910 Unclassified 573
339 Ga0496111_1104194 3300048914 Bacteria 565
340 Ga0496112_0214590 3300048915 Bacteria 1881
341 Ga0496114_0007264 3300048917 Bacteria 8750
342 Ga0496114_0725386 3300048917 Unclassified 870
343 nmdc:mga0n895_115513_c1 3300050512 Unclassified 2702
344 nmdc:mga0n895_397602_c1 3300050512 Unclassified 1394
345 nmdc:mga0n895_39937_c1 3300050512 Bacteria 4557
346 nmdc:mga08x19_1539_c1 3300050514 Bacteria 14302
347 nmdc:mga08x19_172617_c1 3300050514 Bacteria 1473
348 nmdc:mga08x19_47415_c1 3300050514 Bacteria 2750
349 Ga0495601_0077645 3300053077 Unclassified 2127
350 Ga0495601_0114769 3300053077 Bacteria 1746
351 Ga0495619_0017671 3300053085 Bacteria 4518

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100091362 Ga0070714_1000913622 106
2 3300005468 Ga0070707_102229028 Ga0070707_1022290282 106
3 3300006028 Ga0070717_10033106 Ga0070717_100331063 106
4 3300006173 Ga0070716_100410743 Ga0070716_1004107431 106
5 3300025905 Ga0207685_10121173 Ga0207685_101211732 106
6 3300025906 Ga0207699_10027220 Ga0207699_100272203 106
7 3300025928 Ga0207700_10784027 Ga0207700_107840272 106
8 3300025929 Ga0207664_10072910 Ga0207664_100729102 106
9 3300009093 Ga0105240_10020804 Ga0105240_100208043 107
10 3300013104 Ga0157370_10357138 Ga0157370_103571382 107
11 3300025913 Ga0207695_10107367 Ga0207695_101073672 107
12 3300024227 Ga0228598_1000308 Ga0228598_10003083 108
13 3300030760 Ga0265762_1065409 Ga0265762_10654092 108
14 3300031090 Ga0265760_10037802 Ga0265760_100378023 108
15 3300007265 Ga0099794_10360482 Ga0099794_103604822 112
16 3300005434 Ga0070709_10535921 Ga0070709_105359212 113
17 3300005437 Ga0070710_11396806 Ga0070710_113968061 113
18 3300005468 Ga0070707_100186997 Ga0070707_1001869972 113
19 3300006175 Ga0070712_100984761 Ga0070712_1009847611 113
20 3300025915 Ga0207693_10776474 Ga0207693_107764742 113
21 3300025916 Ga0207663_10056709 Ga0207663_100567093 113
22 3300025928 Ga0207700_10343894 Ga0207700_103438942 113
23 3300046680 Ga0495646_0201676 Ga0495646_0201676_451_792 113
24 3300047319 Ga0495674_0026673 Ga0495674_0026673_993_1334 113
25 3300048907 Ga0496104_0350242 Ga0496104_0350242_390_731 113
26 3300048914 Ga0496111_1104194 Ga0496111_1104194_12_353 113
27 3300053077 Ga0495601_0114769 Ga0495601_0114769_1296_1637 113
28 3300005434 Ga0070709_11012364 Ga0070709_110123641 114
29 3300007265 Ga0099794_10003091 Ga0099794_100030913 114
30 3300007265 Ga0099794_10193044 Ga0099794_101930442 114
31 3300006028 Ga0070717_11364732 Ga0070717_113647322 115
32 3300006914 Ga0075436_100058712 Ga0075436_1000587123 115
33 3300039437 Ga0436365_1009643 Ga0436365_1009643_9183_9530 115
34 3300039447 Ga0436361_0480296 Ga0436361_0480296_26_373 115
35 3300046461 Ga0495641_0042802 Ga0495641_0042802_853_1200 115
36 3300046472 Ga0495580_0007052 Ga0495580_0007052_5454_5801 115
37 3300046473 Ga0495582_0000527 Ga0495582_0000527_11129_11476 115
38 3300046517 Ga0495630_1325606 Ga0495630_1325606_108_455 115
39 3300046683 Ga0495658_0126360 Ga0495658_0126360_11_358 115
40 3300050514 nmdc:mga08x19_47415_c1 nmdc:mga08x19_47415_c1_606_953 115
41 3300009177 Ga0105248_11269685 Ga0105248_112696852 116
42 3300026089 Ga0207648_10550273 Ga0207648_105502732 116
43 3300036401 Ga0373937_0235943 Ga0373937_0235943_256_612 116
44 3300028800 Ga0265338_10102250 Ga0265338_101022503 117
45 3300031235 Ga0265330_10113216 Ga0265330_101132162 117
46 3300031239 Ga0265328_10079135 Ga0265328_100791352 117
47 3300031241 Ga0265325_10062777 Ga0265325_100627773 117
48 3300031250 Ga0265331_10007778 Ga0265331_100077785 117
49 3300031344 Ga0265316_10010776 Ga0265316_100107769 117
50 3300031711 Ga0265314_10201768 Ga0265314_102017682 117
51 3300035086 Ga0373934_0000532 Ga0373934_0000532_5500_5853 117
52 3300035111 Ga0373923_0030910 Ga0373923_0030910_793_1146 117
53 3300035117 Ga0373953_0005823 Ga0373953_0005823_1746_2099 117
54 3300035118 Ga0373954_0001245 Ga0373954_0001245_3909_4262 117
55 3300035119 Ga0373956_0008977 Ga0373956_0008977_2691_3044 117
56 3300035120 Ga0373957_0014733 Ga0373957_0014733_2126_2479 117
57 3300035172 Ga0373955_0000888 Ga0373955_0000888_7292_7645 117
58 3300035410 Ga0373924_0019384 Ga0373924_0019384_1474_1827 117
59 3300035724 Ga0373933_0000251 Ga0373933_0000251_9905_10258 117
60 3300036401 Ga0373937_0001122 Ga0373937_0001122_10491_10844 117
61 3300046454 Ga0495592_0273687 Ga0495592_0273687_718_1071 117
62 3300046462 Ga0495651_0040015 Ga0495651_0040015_253_606 117
63 3300046463 Ga0495653_0172035 Ga0495653_0172035_49_402 117
64 3300046472 Ga0495580_0090561 Ga0495580_0090561_1670_2023 117
65 3300046536 Ga0495587_0001635 Ga0495587_0001635_1821_2174 117
66 3300046559 Ga0495667_0288878 Ga0495667_0288878_223_576 117
67 3300046663 Ga0495635_0236251 Ga0495635_0236251_355_708 117
68 3300046679 Ga0495623_0040778 Ga0495623_0040778_1540_1893 117
69 3300047317 Ga0495604_0001286 Ga0495604_0001286_7011_7364 117
70 3300047322 Ga0495680_0295586 Ga0495680_0295586_517_870 117
71 3300047471 Ga0495684_0011358 Ga0495684_0011358_4442_4795 117
72 3300048088 Ga0495602_0015630 Ga0495602_0015630_3887_4240 117
73 3300053085 Ga0495619_0017671 Ga0495619_0017671_3400_3753 117
74 3300025939 Ga0207665_10735543 Ga0207665_107355431 118
75 3300005445 Ga0070708_100016658 Ga0070708_1000166583 119
76 3300005468 Ga0070707_100113905 Ga0070707_1001139052 119
77 3300006173 Ga0070716_100110419 Ga0070716_1001104192 119
78 3300013308 Ga0157375_12853642 Ga0157375_128536422 119
79 3300025910 Ga0207684_11455469 Ga0207684_114554691 119
80 3300031249 Ga0265339_10218145 Ga0265339_102181452 119
81 3300031712 Ga0265342_10160229 Ga0265342_101602291 119
82 3300007788 Ga0099795_10078124 Ga0099795_100781242 120
83 3300045051 Ga0451576_0837126 Ga0451576_0837126_123_485 120
84 3300005439 Ga0070711_100339299 Ga0070711_1003392992 121
85 3300005459 Ga0068867_100430300 Ga0068867_1004303002 121
86 3300005546 Ga0070696_100944577 Ga0070696_1009445772 121
87 3300005548 Ga0070665_100003590 Ga0070665_10000359012 121
88 3300005548 Ga0070665_100993821 Ga0070665_1009938212 121
89 3300005841 Ga0068863_100005925 Ga0068863_10000592513 121
90 3300005841 Ga0068863_100733642 Ga0068863_1007336422 121
91 3300005842 Ga0068858_100025597 Ga0068858_1000255973 121
92 3300005843 Ga0068860_100165869 Ga0068860_1001658692 121
93 3300005843 Ga0068860_100996569 Ga0068860_1009965692 121
94 3300005937 Ga0081455_10265510 Ga0081455_102655102 121
95 3300006173 Ga0070716_100035973 Ga0070716_1000359732 121
96 3300006237 Ga0097621_100010961 Ga0097621_1000109617 121
97 3300006358 Ga0068871_100062325 Ga0068871_1000623253 121
98 3300006852 Ga0075433_10454174 Ga0075433_104541742 121
99 3300006871 Ga0075434_100011928 Ga0075434_1000119288 121
100 3300006871 Ga0075434_100072504 Ga0075434_1000725042 121
101 3300007076 Ga0075435_100057600 Ga0075435_1000576003 121
102 3300009148 Ga0105243_10143913 Ga0105243_101439133 121
103 3300009545 Ga0105237_10312280 Ga0105237_103122802 121
104 3300009553 Ga0105249_11321593 Ga0105249_113215932 121
105 3300013296 Ga0157374_11322998 Ga0157374_113229982 121
106 3300013297 Ga0157378_10002309 Ga0157378_100023092 121
107 3300013308 Ga0157375_10508721 Ga0157375_105087213 121
108 3300014325 Ga0163163_10187261 Ga0163163_101872611 121
109 3300014325 Ga0163163_10574320 Ga0163163_105743202 121
110 3300014969 Ga0157376_10000004 Ga0157376_1000000473 121
111 3300014969 Ga0157376_11405677 Ga0157376_114056772 121
112 3300025910 Ga0207684_10294551 Ga0207684_102945512 121
113 3300025914 Ga0207671_11058341 Ga0207671_110583412 121
114 3300025916 Ga0207663_10696197 Ga0207663_106961972 121
115 3300025937 Ga0207669_11154146 Ga0207669_111541461 121
116 3300025939 Ga0207665_10009702 Ga0207665_100097028 121
117 3300026088 Ga0207641_10006629 Ga0207641_100066295 121
118 3300026088 Ga0207641_11567930 Ga0207641_115679302 121
119 3300028379 Ga0268266_10000470 Ga0268266_100004706 121
120 3300028381 Ga0268264_10768963 Ga0268264_107689632 121
121 3300037418 Ga0395900_1400957 Ga0395900_1400957_79_444 121
122 3300037466 Ga0395898_1189220 Ga0395898_1189220_193_558 121
123 3300048910 Ga0496107_1102198 Ga0496107_1102198_198_563 121
124 3300048917 Ga0496114_0007264 Ga0496114_0007264_6254_6619 121
125 3300050512 nmdc:mga0n895_115513_c1 nmdc:mga0n895_115513_c1_1098_1463 121
126 3300050512 nmdc:mga0n895_397602_c1 nmdc:mga0n895_397602_c1_313_678 121
127 3300050512 nmdc:mga0n895_39937_c1 nmdc:mga0n895_39937_c1_2142_2507 121
128 3300005439 Ga0070711_101026553 Ga0070711_1010265532 122
129 3300005471 Ga0070698_102166923 Ga0070698_1021669231 122
130 3300005544 Ga0070686_100067705 Ga0070686_1000677053 122
131 3300005549 Ga0070704_100140615 Ga0070704_1001406151 122
132 3300005841 Ga0068863_100311078 Ga0068863_1003110782 122
133 3300005842 Ga0068858_100855129 Ga0068858_1008551292 122
134 3300005843 Ga0068860_100013682 Ga0068860_10001368210 122
135 3300006173 Ga0070716_100000044 Ga0070716_10000004424 122
136 3300006173 Ga0070716_100176820 Ga0070716_1001768202 122
137 3300006914 Ga0075436_100000079 Ga0075436_10000007952 122
138 3300006914 Ga0075436_100045653 Ga0075436_1000456532 122
139 3300006914 Ga0075436_100061674 Ga0075436_1000616743 122
140 3300007265 Ga0099794_10108024 Ga0099794_101080242 122
141 3300007265 Ga0099794_10126964 Ga0099794_101269642 122
142 3300007265 Ga0099794_10193276 Ga0099794_101932762 122
143 3300007265 Ga0099794_10753300 Ga0099794_107533002 122
144 3300009098 Ga0105245_10645328 Ga0105245_106453282 122
145 3300009177 Ga0105248_10890230 Ga0105248_108902302 122
146 3300009553 Ga0105249_10801810 Ga0105249_108018102 122
147 3300010375 Ga0105239_11032880 Ga0105239_110328802 122
148 3300013297 Ga0157378_10000471 Ga0157378_1000047113 122
149 3300013306 Ga0163162_10063358 Ga0163162_100633582 122
150 3300014968 Ga0157379_10869526 Ga0157379_108695262 122
151 3300025906 Ga0207699_10831673 Ga0207699_108316732 122
152 3300025906 Ga0207699_11421360 Ga0207699_114213601 122
153 3300025916 Ga0207663_11359854 Ga0207663_113598542 122
154 3300025927 Ga0207687_10467624 Ga0207687_104676242 122
155 3300025939 Ga0207665_10000030 Ga0207665_1000003050 122
156 3300025939 Ga0207665_10053840 Ga0207665_100538403 122
157 3300025939 Ga0207665_10081696 Ga0207665_100816963 122
158 3300025939 Ga0207665_10383451 Ga0207665_103834512 122
159 3300025941 Ga0207711_10654670 Ga0207711_106546702 122
160 3300025942 Ga0207689_11326561 Ga0207689_113265611 122
161 3300026035 Ga0207703_10790417 Ga0207703_107904172 122
162 3300026088 Ga0207641_10974983 Ga0207641_109749832 122
163 3300027671 Ga0209588_1018861 Ga0209588_10188612 122
164 3300027671 Ga0209588_1104690 Ga0209588_11046901 122
165 3300035116 Ga0373945_0208221 Ga0373945_0208221_364_735 122
166 3300035171 Ga0373946_0003377 Ga0373946_0003377_1600_1971 122
167 3300035692 Ga0373935_1009002 Ga0373935_1009002_131_502 122
168 3300035695 Ga0373927_0199790 Ga0373927_0199790_488_859 122
169 3300035725 Ga0373947_0005922 Ga0373947_0005922_1891_2262 122
170 3300037068 Ga0373925_0003359 Ga0373925_0003359_11811_12182 122
171 3300039437 Ga0436365_0649915 Ga0436365_0649915_310_687 122
172 3300039450 Ga0436363_0352287 Ga0436363_0352287_370_741 122
173 3300046517 Ga0495630_0026394 Ga0495630_0026394_2574_2945 122
174 3300046690 Ga0495624_0097902 Ga0495624_0097902_421_792 122
175 3300048904 Ga0496101_0099704 Ga0496101_0099704_859_1227 122
176 3300048905 Ga0496102_0024639 Ga0496102_0024639_4038_4406 122
177 3300048909 Ga0496106_0020663 Ga0496106_0020663_4296_4664 122
178 3300048915 Ga0496112_0214590 Ga0496112_0214590_852_1220 122
179 3300050514 nmdc:mga08x19_1539_c1 nmdc:mga08x19_1539_c1_1598_1969 122
180 3300050514 nmdc:mga08x19_172617_c1 nmdc:mga08x19_172617_c1_640_1011 122
181 3300005434 Ga0070709_10066910 Ga0070709_100669102 123
182 3300005436 Ga0070713_100233909 Ga0070713_1002339092 123
183 3300005437 Ga0070710_10225912 Ga0070710_102259123 123
184 3300005439 Ga0070711_100015579 Ga0070711_1000155793 123
185 3300005439 Ga0070711_100026155 Ga0070711_1000261553 123
186 3300005439 Ga0070711_101034960 Ga0070711_1010349602 123
187 3300005445 Ga0070708_100001983 Ga0070708_1000019838 123
188 3300005445 Ga0070708_100032966 Ga0070708_1000329663 123
189 3300005445 Ga0070708_101781730 Ga0070708_1017817302 123
190 3300005467 Ga0070706_100146839 Ga0070706_1001468393 123
191 3300005468 Ga0070707_100018606 Ga0070707_1000186063 123
192 3300005468 Ga0070707_100023596 Ga0070707_1000235963 123
193 3300005468 Ga0070707_100468986 Ga0070707_1004689862 123
194 3300005471 Ga0070698_100029548 Ga0070698_1000295482 123
195 3300005471 Ga0070698_100132715 Ga0070698_1001327153 123
196 3300005518 Ga0070699_100162508 Ga0070699_1001625083 123
197 3300005518 Ga0070699_100275786 Ga0070699_1002757862 123
198 3300005536 Ga0070697_100001723 Ga0070697_10000172313 123
199 3300006028 Ga0070717_10996780 Ga0070717_109967801 123
200 3300006163 Ga0070715_10767424 Ga0070715_107674242 123
201 3300006173 Ga0070716_100126650 Ga0070716_1001266502 123
202 3300006173 Ga0070716_100170857 Ga0070716_1001708572 123
203 3300006175 Ga0070712_100021238 Ga0070712_1000212384 123
204 3300006175 Ga0070712_100044968 Ga0070712_1000449684 123
205 3300006237 Ga0097621_100078760 Ga0097621_1000787603 123
206 3300007265 Ga0099794_10699789 Ga0099794_106997891 123
207 3300009545 Ga0105237_10191716 Ga0105237_101917161 123
208 3300009551 Ga0105238_11094937 Ga0105238_110949372 123
209 3300013307 Ga0157372_10460158 Ga0157372_104601582 123
210 3300014969 Ga0157376_10001354 Ga0157376_1000135412 123
211 3300025898 Ga0207692_10848700 Ga0207692_108487002 123
212 3300025906 Ga0207699_10000410 Ga0207699_1000041017 123
213 3300025906 Ga0207699_10095165 Ga0207699_100951653 123
214 3300025906 Ga0207699_10784459 Ga0207699_107844591 123
215 3300025910 Ga0207684_10070670 Ga0207684_100706702 123
216 3300025922 Ga0207646_10014887 Ga0207646_100148879 123
217 3300025922 Ga0207646_10037066 Ga0207646_100370663 123
218 3300025929 Ga0207664_10843985 Ga0207664_108439851 123
219 3300025939 Ga0207665_10076399 Ga0207665_100763991 123
220 3300025939 Ga0207665_10973093 Ga0207665_109730932 123
221 3300027671 Ga0209588_1171605 Ga0209588_11716052 123
222 3300035089 Ga0373944_0201376 Ga0373944_0201376_309_680 123
223 3300035111 Ga0373923_0315942 Ga0373923_0315942_169_540 123
224 3300037068 Ga0373925_0045401 Ga0373925_0045401_751_1122 123
225 3300039437 Ga0436365_0537176 Ga0436365_0537176_472_849 123
226 3300046455 Ga0495603_0011287 Ga0495603_0011287_3774_4145 123
227 3300046459 Ga0495629_0022418 Ga0495629_0022418_3418_3789 123
228 3300046461 Ga0495641_0076798 Ga0495641_0076798_208_579 123
229 3300046472 Ga0495580_0213127 Ga0495580_0213127_271_642 123
230 3300046473 Ga0495582_0004757 Ga0495582_0004757_5277_5648 123
231 3300046475 Ga0495639_0001706 Ga0495639_0001706_1473_1844 123
232 3300046477 Ga0495664_0062632 Ga0495664_0062632_1779_2150 123
233 3300046499 Ga0495594_0281561 Ga0495594_0281561_443_814 123
234 3300046514 Ga0495618_0116493 Ga0495618_0116493_983_1354 123
235 3300046517 Ga0495630_0031427 Ga0495630_0031427_2103_2474 123
236 3300046526 Ga0495666_0006576 Ga0495666_0006576_1984_2355 123
237 3300046531 Ga0495665_0327920 Ga0495665_0327920_126_497 123
238 3300046533 Ga0495640_0019119 Ga0495640_0019119_4567_4938 123
239 3300046535 Ga0495586_0015107 Ga0495586_0015107_324_695 123
240 3300046559 Ga0495667_0872064 Ga0495667_0872064_155_526 123
241 3300046663 Ga0495635_0028536 Ga0495635_0028536_1386_1757 123
242 3300046674 Ga0495588_0470680 Ga0495588_0470680_105_476 123
243 3300046681 Ga0495647_0038937 Ga0495647_0038937_262_633 123
244 3300046683 Ga0495658_0036765 Ga0495658_0036765_513_884 123
245 3300046689 Ga0495613_0259685 Ga0495613_0259685_134_505 123
246 3300046690 Ga0495624_0080933 Ga0495624_0080933_525_896 123
247 3300047315 Ga0495581_0296283 Ga0495581_0296283_344_715 123
248 3300047319 Ga0495674_0043497 Ga0495674_0043497_259_630 123
249 3300047321 Ga0495676_0029959 Ga0495676_0029959_861_1232 123
250 3300047322 Ga0495680_0093422 Ga0495680_0093422_875_1246 123
251 3300047471 Ga0495684_0032592 Ga0495684_0032592_3619_3990 123
252 3300047673 Ga0495593_0064255 Ga0495593_0064255_555_926 123
253 3300048089 Ga0495614_0011383 Ga0495614_0011383_1725_2096 123
254 3300048903 Ga0496100_0123881 Ga0496100_0123881_237_608 123
255 3300048917 Ga0496114_0725386 Ga0496114_0725386_344_715 123
256 3300005406 Ga0070703_10005748 Ga0070703_100057482 124
257 3300005435 Ga0070714_100242178 Ga0070714_1002421782 124
258 3300005435 Ga0070714_100358284 Ga0070714_1003582843 124
259 3300005436 Ga0070713_100523419 Ga0070713_1005234191 124
260 3300005437 Ga0070710_10268918 Ga0070710_102689183 124
261 3300005437 Ga0070710_11465802 Ga0070710_114658021 124
262 3300005439 Ga0070711_100165954 Ga0070711_1001659543 124
263 3300005439 Ga0070711_100539546 Ga0070711_1005395462 124
264 3300005440 Ga0070705_100041740 Ga0070705_1000417403 124
265 3300005444 Ga0070694_100033774 Ga0070694_1000337742 124
266 3300005445 Ga0070708_100027431 Ga0070708_1000274315 124
267 3300005445 Ga0070708_100118103 Ga0070708_1001181032 124
268 3300005445 Ga0070708_100580056 Ga0070708_1005800561 124
269 3300005458 Ga0070681_10061173 Ga0070681_100611732 124
270 3300005467 Ga0070706_100004828 Ga0070706_1000048284 124
271 3300005467 Ga0070706_100266943 Ga0070706_1002669432 124
272 3300005468 Ga0070707_101000444 Ga0070707_1010004442 124
273 3300005468 Ga0070707_102063071 Ga0070707_1020630711 124
274 3300005518 Ga0070699_100040372 Ga0070699_1000403725 124
275 3300005518 Ga0070699_100136227 Ga0070699_1001362271 124
276 3300005518 Ga0070699_101007330 Ga0070699_1010073302 124
277 3300005530 Ga0070679_100228796 Ga0070679_1002287961 124
278 3300005536 Ga0070697_100000188 Ga0070697_1000001888 124
279 3300005545 Ga0070695_100013954 Ga0070695_1000139544 124
280 3300005545 Ga0070695_100076457 Ga0070695_1000764573 124
281 3300005546 Ga0070696_100001179 Ga0070696_10000117913 124
282 3300005547 Ga0070693_100000095 Ga0070693_10000009534 124
283 3300005549 Ga0070704_100002381 Ga0070704_1000023818 124
284 3300006028 Ga0070717_10801169 Ga0070717_108011692 124
285 3300006163 Ga0070715_10064096 Ga0070715_100640963 124
286 3300006163 Ga0070715_10115249 Ga0070715_101152492 124
287 3300006173 Ga0070716_100345354 Ga0070716_1003453542 124
288 3300006173 Ga0070716_101644600 Ga0070716_1016446001 124
289 3300006173 Ga0070716_101708117 Ga0070716_1017081172 124
290 3300006175 Ga0070712_100024150 Ga0070712_1000241503 124
291 3300006914 Ga0075436_101504292 Ga0075436_1015042922 124
292 3300007265 Ga0099794_10008304 Ga0099794_100083045 124
293 3300007265 Ga0099794_10016384 Ga0099794_100163843 124
294 3300007265 Ga0099794_10033666 Ga0099794_100336663 124
295 3300007265 Ga0099794_10580190 Ga0099794_105801901 124
296 3300007788 Ga0099795_10028794 Ga0099795_100287942 124
297 3300007788 Ga0099795_10297156 Ga0099795_102971562 124
298 3300010159 Ga0099796_10063047 Ga0099796_100630472 124
299 3300024225 Ga0224572_1062670 Ga0224572_10626702 124
300 3300025885 Ga0207653_10004052 Ga0207653_100040523 124
301 3300025898 Ga0207692_10184078 Ga0207692_101840782 124
302 3300025905 Ga0207685_10065811 Ga0207685_100658113 124
303 3300025906 Ga0207699_10295055 Ga0207699_102950552 124
304 3300025910 Ga0207684_10002249 Ga0207684_1000224915 124
305 3300025915 Ga0207693_10341011 Ga0207693_103410112 124
306 3300025916 Ga0207663_11284262 Ga0207663_112842621 124
307 3300025921 Ga0207652_10152451 Ga0207652_101524512 124
308 3300025928 Ga0207700_10266440 Ga0207700_102664402 124
309 3300025929 Ga0207664_10232635 Ga0207664_102326352 124
310 3300025929 Ga0207664_10346896 Ga0207664_103468963 124
311 3300025939 Ga0207665_10483922 Ga0207665_104839222 124
312 3300025939 Ga0207665_10502899 Ga0207665_105028992 124
313 3300025939 Ga0207665_10862408 Ga0207665_108624082 124
314 3300027512 Ga0209179_1068031 Ga0209179_10680311 124
315 3300027671 Ga0209588_1000250 Ga0209588_10002509 124
316 3300027671 Ga0209588_1004462 Ga0209588_10044623 124
317 3300027671 Ga0209588_1021210 Ga0209588_10212103 124
318 3300027671 Ga0209588_1057948 Ga0209588_10579482 124
319 3300027671 Ga0209588_1111596 Ga0209588_11115962 124
320 3300028016 Ga0265354_1000011 Ga0265354_100001117 124
321 3300028016 Ga0265354_1003178 Ga0265354_10031782 124
322 3300028023 Ga0265357_1041702 Ga0265357_10417021 124
323 3300030878 Ga0265770_1000145 Ga0265770_10001454 124
324 3300030879 Ga0265765_1000262 Ga0265765_10002622 124
325 3300031090 Ga0265760_10006021 Ga0265760_100060214 124
326 3300031090 Ga0265760_10006910 Ga0265760_100069104 124
327 3300031247 Ga0265340_10199767 Ga0265340_101997672 124
328 3300033547 Ga0316212_1018585 Ga0316212_10185852 124
329 3300035111 Ga0373923_0224997 Ga0373923_0224997_110_490 124
330 3300035118 Ga0373954_0631368 Ga0373954_0631368_83_463 124
331 3300035119 Ga0373956_0094127 Ga0373956_0094127_337_717 124
332 3300036401 Ga0373937_0075281 Ga0373937_0075281_702_1082 124
333 3300046455 Ga0495603_0752564 Ga0495603_0752564_30_410 124
334 3300046462 Ga0495651_0437813 Ga0495651_0437813_319_693 124
335 3300046472 Ga0495580_0056519 Ga0495580_0056519_1153_1527 124
336 3300046477 Ga0495664_0413571 Ga0495664_0413571_193_567 124
337 3300046514 Ga0495618_0054979 Ga0495618_0054979_1879_2253 124
338 3300046516 Ga0495628_0070576 Ga0495628_0070576_1941_2315 124
339 3300046516 Ga0495628_0779199 Ga0495628_0779199_46_420 124
340 3300046536 Ga0495587_0008530 Ga0495587_0008530_2876_3256 124
341 3300046536 Ga0495587_0224850 Ga0495587_0224850_32_406 124
342 3300046675 Ga0495657_0265661 Ga0495657_0265661_186_566 124
343 3300046675 Ga0495657_0605983 Ga0495657_0605983_205_585 124
344 3300046678 Ga0495599_0552907 Ga0495599_0552907_147_521 124
345 3300047317 Ga0495604_0199228 Ga0495604_0199228_843_1217 124
346 3300047317 Ga0495604_0534523 Ga0495604_0534523_208_588 124
347 3300047319 Ga0495674_0069164 Ga0495674_0069164_464_844 124
348 3300047322 Ga0495680_0116203 Ga0495680_0116203_884_1258 124
349 3300047471 Ga0495684_0273593 Ga0495684_0273593_147_527 124
350 3300048088 Ga0495602_0353936 Ga0495602_0353936_299_673 124
351 3300053077 Ga0495601_0077645 Ga0495601_0077645_70_444 124

Feature Viewer

pLDDT pTM Quality
75.22 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map