F418660
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 176 | 351 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300025922|Ga0207646_10014887|Ga0207646_100148879 |
| Length | 136 |
| Sequence | VRASRRSARRRSELIAVPLAVFLMISSADGAVLGACLALAAATLLFIFYIQPDASDLAPHRSKLDQLMERRDAIYDNLRDLRFEYRAGKYSEDDYEAMKNAMETEAALVLAEIDQVTDAGVKRPRGPRPAAERGPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 3 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 12 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 38 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 39 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 59 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 60 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 84 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 95 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 96 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 102 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 103 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 104 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 110 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 122 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.29 |
| Metatranscriptomes | 1.71 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.85 |
| Rhizosphere | 95.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070703_10005748 | 3300005406 | Bacteria | 3473 |
| 2 | Ga0070709_10066910 | 3300005434 | Unclassified | 2306 |
| 3 | Ga0070709_10535921 | 3300005434 | Bacteria | 894 |
| 4 | Ga0070709_11012364 | 3300005434 | Unclassified | 661 |
| 5 | Ga0070714_100091362 | 3300005435 | Unclassified | 2667 |
| 6 | Ga0070714_100242178 | 3300005435 | Bacteria | 1665 |
| 7 | Ga0070714_100358284 | 3300005435 | Unclassified | 1371 |
| 8 | Ga0070713_100233909 | 3300005436 | Unclassified | 1671 |
| 9 | Ga0070713_100523419 | 3300005436 | Unclassified | 1121 |
| 10 | Ga0070710_10225912 | 3300005437 | Bacteria | 1193 |
| 11 | Ga0070710_10268918 | 3300005437 | Unclassified | 1102 |
| 12 | Ga0070710_11396806 | 3300005437 | Bacteria | 523 |
| 13 | Ga0070710_11465802 | 3300005437 | Unclassified | 512 |
| 14 | Ga0070711_100015579 | 3300005439 | Bacteria | 4812 |
| 15 | Ga0070711_100026155 | 3300005439 | Bacteria | 3823 |
| 16 | Ga0070711_100165954 | 3300005439 | Bacteria | 1678 |
| 17 | Ga0070711_100339299 | 3300005439 | Bacteria | 1205 |
| 18 | Ga0070711_100539546 | 3300005439 | Archaea | 966 |
| 19 | Ga0070711_101026553 | 3300005439 | Bacteria | 708 |
| 20 | Ga0070711_101034960 | 3300005439 | Bacteria | 705 |
| 21 | Ga0070705_100041740 | 3300005440 | Unclassified | 2618 |
| 22 | Ga0070694_100033774 | 3300005444 | Unclassified | 3370 |
| 23 | Ga0070708_100001983 | 3300005445 | Bacteria | 15764 |
| 24 | Ga0070708_100016658 | 3300005445 | Bacteria | 6106 |
| 25 | Ga0070708_100027431 | 3300005445 | Bacteria | 4886 |
| 26 | Ga0070708_100032966 | 3300005445 | Bacteria | 4497 |
| 27 | Ga0070708_100118103 | 3300005445 | Bacteria | 2443 |
| 28 | Ga0070708_100580056 | 3300005445 | Unclassified | 1057 |
| 29 | Ga0070708_101781730 | 3300005445 | Unclassified | 572 |
| 30 | Ga0070681_10061173 | 3300005458 | Bacteria | 3742 |
| 31 | Ga0068867_100430300 | 3300005459 | Unclassified | 1120 |
| 32 | Ga0070706_100004828 | 3300005467 | Bacteria | 12910 |
| 33 | Ga0070706_100146839 | 3300005467 | Viruses | 2202 |
| 34 | Ga0070706_100266943 | 3300005467 | Bacteria | 1597 |
| 35 | Ga0070707_100018606 | 3300005468 | Bacteria | 6536 |
| 36 | Ga0070707_100023596 | 3300005468 | Bacteria | 5818 |
| 37 | Ga0070707_100113905 | 3300005468 | Bacteria | 2624 |
| 38 | Ga0070707_100186997 | 3300005468 | Unclassified | 2020 |
| 39 | Ga0070707_100468986 | 3300005468 | Viruses | 1220 |
| 40 | Ga0070707_101000444 | 3300005468 | Unclassified | 801 |
| 41 | Ga0070707_102063071 | 3300005468 | Unclassified | 538 |
| 42 | Ga0070707_102229028 | 3300005468 | Unclassified | 515 |
| 43 | Ga0070698_100029548 | 3300005471 | Bacteria | 5691 |
| 44 | Ga0070698_100132715 | 3300005471 | Bacteria | 2445 |
| 45 | Ga0070698_102166923 | 3300005471 | Unclassified | 509 |
| 46 | Ga0070699_100040372 | 3300005518 | Unclassified | 4040 |
| 47 | Ga0070699_100136227 | 3300005518 | Bacteria | 2166 |
| 48 | Ga0070699_100162508 | 3300005518 | Unclassified | 1977 |
| 49 | Ga0070699_100275786 | 3300005518 | Unclassified | 1506 |
| 50 | Ga0070699_101007330 | 3300005518 | Unclassified | 764 |
| 51 | Ga0070679_100228796 | 3300005530 | Unclassified | 1819 |
| 52 | Ga0070697_100000188 | 3300005536 | Bacteria | 51099 |
| 53 | Ga0070697_100001723 | 3300005536 | Bacteria | 16697 |
| 54 | Ga0070686_100067705 | 3300005544 | Bacteria | 2327 |
| 55 | Ga0070695_100013954 | 3300005545 | Bacteria | 4836 |
| 56 | Ga0070695_100076457 | 3300005545 | Unclassified | 2205 |
| 57 | Ga0070696_100001179 | 3300005546 | Bacteria | 16921 |
| 58 | Ga0070696_100944577 | 3300005546 | Bacteria | 717 |
| 59 | Ga0070693_100000095 | 3300005547 | Bacteria | 38467 |
| 60 | Ga0070665_100003590 | 3300005548 | Bacteria | 16432 |
| 61 | Ga0070665_100993821 | 3300005548 | Unclassified | 851 |
| 62 | Ga0070704_100002381 | 3300005549 | Bacteria | 10550 |
| 63 | Ga0070704_100140615 | 3300005549 | Bacteria | 1884 |
| 64 | Ga0068863_100005925 | 3300005841 | Bacteria | 11990 |
| 65 | Ga0068863_100311078 | 3300005841 | Bacteria | 1529 |
| 66 | Ga0068863_100733642 | 3300005841 | Unclassified | 983 |
| 67 | Ga0068858_100025597 | 3300005842 | Bacteria | 5490 |
| 68 | Ga0068858_100855129 | 3300005842 | Bacteria | 888 |
| 69 | Ga0068860_100013682 | 3300005843 | Bacteria | 7955 |
| 70 | Ga0068860_100165869 | 3300005843 | Bacteria | 2132 |
| 71 | Ga0068860_100996569 | 3300005843 | Unclassified | 856 |
| 72 | Ga0081455_10265510 | 3300005937 | Bacteria | 1248 |
| 73 | Ga0070717_10033106 | 3300006028 | Unclassified | 4168 |
| 74 | Ga0070717_10801169 | 3300006028 | Unclassified | 857 |
| 75 | Ga0070717_10996780 | 3300006028 | Bacteria | 763 |
| 76 | Ga0070717_11364732 | 3300006028 | Unclassified | 644 |
| 77 | Ga0070715_10064096 | 3300006163 | Unclassified | 1622 |
| 78 | Ga0070715_10115249 | 3300006163 | Bacteria | 1273 |
| 79 | Ga0070715_10767424 | 3300006163 | Unclassified | 582 |
| 80 | Ga0070716_100000044 | 3300006173 | Bacteria | 50397 |
| 81 | Ga0070716_100035973 | 3300006173 | Unclassified | 2727 |
| 82 | Ga0070716_100110419 | 3300006173 | Unclassified | 1703 |
| 83 | Ga0070716_100126650 | 3300006173 | Unclassified | 1607 |
| 84 | Ga0070716_100170857 | 3300006173 | Bacteria | 1418 |
| 85 | Ga0070716_100176820 | 3300006173 | Unclassified | 1398 |
| 86 | Ga0070716_100345354 | 3300006173 | Bacteria | 1051 |
| 87 | Ga0070716_100410743 | 3300006173 | Unclassified | 976 |
| 88 | Ga0070716_101644600 | 3300006173 | Unclassified | 528 |
| 89 | Ga0070716_101708117 | 3300006173 | Unclassified | 519 |
| 90 | Ga0070712_100021238 | 3300006175 | Unclassified | 4261 |
| 91 | Ga0070712_100024150 | 3300006175 | Bacteria | 4024 |
| 92 | Ga0070712_100044968 | 3300006175 | Bacteria | 3047 |
| 93 | Ga0070712_100984761 | 3300006175 | Unclassified | 729 |
| 94 | Ga0097621_100010961 | 3300006237 | Bacteria | 6657 |
| 95 | Ga0097621_100078760 | 3300006237 | Unclassified | 2738 |
| 96 | Ga0068871_100062325 | 3300006358 | Bacteria | 3047 |
| 97 | Ga0075433_10454174 | 3300006852 | Unclassified | 1129 |
| 98 | Ga0075434_100011928 | 3300006871 | Bacteria | 8219 |
| 99 | Ga0075434_100072504 | 3300006871 | Bacteria | 3436 |
| 100 | Ga0075436_100000079 | 3300006914 | Bacteria | 55394 |
| 101 | Ga0075436_100045653 | 3300006914 | Bacteria | 3022 |
| 102 | Ga0075436_100058712 | 3300006914 | Bacteria | 2657 |
| 103 | Ga0075436_100061674 | 3300006914 | Bacteria | 2591 |
| 104 | Ga0075436_101504292 | 3300006914 | Bacteria | 511 |
| 105 | Ga0075435_100057600 | 3300007076 | Bacteria | 3144 |
| 106 | Ga0099794_10003091 | 3300007265 | Bacteria | 6292 |
| 107 | Ga0099794_10008304 | 3300007265 | Bacteria | 4306 |
| 108 | Ga0099794_10016384 | 3300007265 | Bacteria | 3284 |
| 109 | Ga0099794_10033666 | 3300007265 | Bacteria | 2410 |
| 110 | Ga0099794_10108024 | 3300007265 | Unclassified | 1392 |
| 111 | Ga0099794_10126964 | 3300007265 | Unclassified | 1286 |
| 112 | Ga0099794_10193044 | 3300007265 | Bacteria | 1042 |
| 113 | Ga0099794_10193276 | 3300007265 | Unclassified | 1041 |
| 114 | Ga0099794_10360482 | 3300007265 | Unclassified | 757 |
| 115 | Ga0099794_10580190 | 3300007265 | Unclassified | 593 |
| 116 | Ga0099794_10699789 | 3300007265 | Unclassified | 540 |
| 117 | Ga0099794_10753300 | 3300007265 | Unclassified | 520 |
| 118 | Ga0099795_10028794 | 3300007788 | Unclassified | 1892 |
| 119 | Ga0099795_10078124 | 3300007788 | Bacteria | 1261 |
| 120 | Ga0099795_10297156 | 3300007788 | Unclassified | 709 |
| 121 | Ga0105240_10020804 | 3300009093 | Bacteria | 8738 |
| 122 | Ga0105245_10645328 | 3300009098 | Bacteria | 1088 |
| 123 | Ga0105243_10143913 | 3300009148 | Bacteria | 2037 |
| 124 | Ga0105248_10890230 | 3300009177 | Bacteria | 1005 |
| 125 | Ga0105248_11269685 | 3300009177 | Bacteria | 833 |
| 126 | Ga0105237_10191716 | 3300009545 | Bacteria | 2044 |
| 127 | Ga0105237_10312280 | 3300009545 | Unclassified | 1575 |
| 128 | Ga0105238_11094937 | 3300009551 | Unclassified | 819 |
| 129 | Ga0105249_10801810 | 3300009553 | Bacteria | 1006 |
| 130 | Ga0105249_11321593 | 3300009553 | Unclassified | 793 |
| 131 | Ga0099796_10063047 | 3300010159 | Unclassified | 1319 |
| 132 | Ga0105239_11032880 | 3300010375 | Bacteria | 945 |
| 133 | Ga0157370_10357138 | 3300013104 | Bacteria | 1347 |
| 134 | Ga0157374_11322998 | 3300013296 | Bacteria | 743 |
| 135 | Ga0157378_10000471 | 3300013297 | Bacteria | 38401 |
| 136 | Ga0157378_10002309 | 3300013297 | Bacteria | 16963 |
| 137 | Ga0163162_10063358 | 3300013306 | Bacteria | 3740 |
| 138 | Ga0157372_10460158 | 3300013307 | Unclassified | 1483 |
| 139 | Ga0157375_10508721 | 3300013308 | Unclassified | 1368 |
| 140 | Ga0157375_12853642 | 3300013308 | Unclassified | 578 |
| 141 | Ga0163163_10187261 | 3300014325 | Bacteria | 2117 |
| 142 | Ga0163163_10574320 | 3300014325 | Unclassified | 1190 |
| 143 | Ga0157379_10869526 | 3300014968 | Bacteria | 854 |
| 144 | Ga0157376_10000004 | 3300014969 | Bacteria | 508493 |
| 145 | Ga0157376_10001354 | 3300014969 | Bacteria | 16131 |
| 146 | Ga0157376_11405677 | 3300014969 | Unclassified | 729 |
| 147 | Ga0224572_1062670 | 3300024225 | Unclassified | 688 |
| 148 | Ga0228598_1000308 | 3300024227 | Bacteria | 9548 |
| 149 | Ga0207653_10004052 | 3300025885 | Bacteria | 4612 |
| 150 | Ga0207692_10184078 | 3300025898 | Unclassified | 1218 |
| 151 | Ga0207692_10848700 | 3300025898 | Bacteria | 599 |
| 152 | Ga0207685_10065811 | 3300025905 | Unclassified | 1452 |
| 153 | Ga0207685_10121173 | 3300025905 | Unclassified | 1148 |
| 154 | Ga0207699_10000410 | 3300025906 | Bacteria | 22037 |
| 155 | Ga0207699_10027220 | 3300025906 | Bacteria | 3162 |
| 156 | Ga0207699_10095165 | 3300025906 | Bacteria | 1878 |
| 157 | Ga0207699_10295055 | 3300025906 | Unclassified | 1131 |
| 158 | Ga0207699_10784459 | 3300025906 | Unclassified | 700 |
| 159 | Ga0207699_10831673 | 3300025906 | Unclassified | 679 |
| 160 | Ga0207699_11421360 | 3300025906 | Unclassified | 513 |
| 161 | Ga0207684_10002249 | 3300025910 | Bacteria | 19673 |
| 162 | Ga0207684_10070670 | 3300025910 | Viruses | 2967 |
| 163 | Ga0207684_10294551 | 3300025910 | Bacteria | 1399 |
| 164 | Ga0207684_11455469 | 3300025910 | Unclassified | 559 |
| 165 | Ga0207695_10107367 | 3300025913 | Bacteria | 2777 |
| 166 | Ga0207671_11058341 | 3300025914 | Unclassified | 638 |
| 167 | Ga0207693_10341011 | 3300025915 | Bacteria | 1173 |
| 168 | Ga0207693_10776474 | 3300025915 | Unclassified | 739 |
| 169 | Ga0207663_10056709 | 3300025916 | Unclassified | 2465 |
| 170 | Ga0207663_10696197 | 3300025916 | Unclassified | 804 |
| 171 | Ga0207663_11284262 | 3300025916 | Unclassified | 589 |
| 172 | Ga0207663_11359854 | 3300025916 | Bacteria | 572 |
| 173 | Ga0207652_10152451 | 3300025921 | Unclassified | 2070 |
| 174 | Ga0207646_10014887 | 3300025922 | Bacteria | 7367 |
| 175 | Ga0207646_10037066 | 3300025922 | Bacteria | 4398 |
| 176 | Ga0207687_10467624 | 3300025927 | Bacteria | 1048 |
| 177 | Ga0207700_10266440 | 3300025928 | Unclassified | 1469 |
| 178 | Ga0207700_10343894 | 3300025928 | Unclassified | 1297 |
| 179 | Ga0207700_10784027 | 3300025928 | Unclassified | 852 |
| 180 | Ga0207664_10072910 | 3300025929 | Bacteria | 2770 |
| 181 | Ga0207664_10232635 | 3300025929 | Bacteria | 1602 |
| 182 | Ga0207664_10346896 | 3300025929 | Unclassified | 1313 |
| 183 | Ga0207664_10843985 | 3300025929 | Bacteria | 823 |
| 184 | Ga0207669_11154146 | 3300025937 | Unclassified | 655 |
| 185 | Ga0207665_10000030 | 3300025939 | Bacteria | 94900 |
| 186 | Ga0207665_10009702 | 3300025939 | Bacteria | 6321 |
| 187 | Ga0207665_10053840 | 3300025939 | Bacteria | 2713 |
| 188 | Ga0207665_10076399 | 3300025939 | Bacteria | 2296 |
| 189 | Ga0207665_10081696 | 3300025939 | Unclassified | 2226 |
| 190 | Ga0207665_10383451 | 3300025939 | Unclassified | 1067 |
| 191 | Ga0207665_10483922 | 3300025939 | Bacteria | 954 |
| 192 | Ga0207665_10502899 | 3300025939 | Bacteria | 936 |
| 193 | Ga0207665_10735543 | 3300025939 | Bacteria | 777 |
| 194 | Ga0207665_10862408 | 3300025939 | Bacteria | 717 |
| 195 | Ga0207665_10973093 | 3300025939 | Unclassified | 674 |
| 196 | Ga0207711_10654670 | 3300025941 | Bacteria | 980 |
| 197 | Ga0207689_11326561 | 3300025942 | Bacteria | 604 |
| 198 | Ga0207703_10790417 | 3300026035 | Bacteria | 906 |
| 199 | Ga0207641_10006629 | 3300026088 | Bacteria | 9720 |
| 200 | Ga0207641_10974983 | 3300026088 | Bacteria | 844 |
| 201 | Ga0207641_11567930 | 3300026088 | Unclassified | 660 |
| 202 | Ga0207648_10550273 | 3300026089 | Unclassified | 1060 |
| 203 | Ga0209179_1068031 | 3300027512 | Unclassified | 778 |
| 204 | Ga0209588_1000250 | 3300027671 | Bacteria | 14306 |
| 205 | Ga0209588_1004462 | 3300027671 | Bacteria | 3947 |
| 206 | Ga0209588_1018861 | 3300027671 | Bacteria | 2149 |
| 207 | Ga0209588_1021210 | 3300027671 | Unclassified | 2039 |
| 208 | Ga0209588_1057948 | 3300027671 | Unclassified | 1252 |
| 209 | Ga0209588_1104690 | 3300027671 | Unclassified | 910 |
| 210 | Ga0209588_1111596 | 3300027671 | Unclassified | 878 |
| 211 | Ga0209588_1171605 | 3300027671 | Unclassified | 682 |
| 212 | Ga0265354_1000011 | 3300028016 | Bacteria | 29647 |
| 213 | Ga0265354_1003178 | 3300028016 | Unclassified | 1876 |
| 214 | Ga0265357_1041702 | 3300028023 | Unclassified | 539 |
| 215 | Ga0268266_10000470 | 3300028379 | Bacteria | 58333 |
| 216 | Ga0268264_10768963 | 3300028381 | Bacteria | 961 |
| 217 | Ga0265338_10102250 | 3300028800 | Unclassified | 2331 |
| 218 | Ga0265762_1065409 | 3300030760 | Bacteria | 754 |
| 219 | Ga0265770_1000145 | 3300030878 | Bacteria | 8781 |
| 220 | Ga0265765_1000262 | 3300030879 | Bacteria | 3811 |
| 221 | Ga0265760_10006021 | 3300031090 | Bacteria | 3465 |
| 222 | Ga0265760_10006910 | 3300031090 | Bacteria | 3254 |
| 223 | Ga0265760_10037802 | 3300031090 | Bacteria | 1434 |
| 224 | Ga0265330_10113216 | 3300031235 | Unclassified | 1158 |
| 225 | Ga0265328_10079135 | 3300031239 | Unclassified | 1211 |
| 226 | Ga0265325_10062777 | 3300031241 | Bacteria | 1881 |
| 227 | Ga0265340_10199767 | 3300031247 | Unclassified | 899 |
| 228 | Ga0265339_10218145 | 3300031249 | Unclassified | 934 |
| 229 | Ga0265331_10007778 | 3300031250 | Bacteria | 6153 |
| 230 | Ga0265316_10010776 | 3300031344 | Bacteria | 8305 |
| 231 | Ga0265314_10201768 | 3300031711 | Unclassified | 1175 |
| 232 | Ga0265342_10160229 | 3300031712 | Unclassified | 1244 |
| 233 | Ga0316212_1018585 | 3300033547 | Unclassified | 977 |
| 234 | Ga0373934_0000532 | 3300035086 | Bacteria | 13463 |
| 235 | Ga0373944_0201376 | 3300035089 | Unclassified | 721 |
| 236 | Ga0373923_0030910 | 3300035111 | Bacteria | 2156 |
| 237 | Ga0373923_0224997 | 3300035111 | Bacteria | 873 |
| 238 | Ga0373923_0315942 | 3300035111 | Unclassified | 741 |
| 239 | Ga0373945_0208221 | 3300035116 | Bacteria | 814 |
| 240 | Ga0373953_0005823 | 3300035117 | Bacteria | 4029 |
| 241 | Ga0373954_0001245 | 3300035118 | Bacteria | 10252 |
| 242 | Ga0373954_0631368 | 3300035118 | Unclassified | 531 |
| 243 | Ga0373956_0008977 | 3300035119 | Bacteria | 4054 |
| 244 | Ga0373956_0094127 | 3300035119 | Bacteria | 1384 |
| 245 | Ga0373957_0014733 | 3300035120 | Bacteria | 2678 |
| 246 | Ga0373946_0003377 | 3300035171 | Bacteria | 5663 |
| 247 | Ga0373955_0000888 | 3300035172 | Bacteria | 12846 |
| 248 | Ga0373924_0019384 | 3300035410 | Bacteria | 2636 |
| 249 | Ga0373935_1009002 | 3300035692 | Bacteria | 618 |
| 250 | Ga0373927_0199790 | 3300035695 | Bacteria | 1312 |
| 251 | Ga0373933_0000251 | 3300035724 | Bacteria | 35333 |
| 252 | Ga0373947_0005922 | 3300035725 | Bacteria | 7123 |
| 253 | Ga0373937_0001122 | 3300036401 | Bacteria | 22574 |
| 254 | Ga0373937_0075281 | 3300036401 | Bacteria | 3116 |
| 255 | Ga0373937_0235943 | 3300036401 | Unclassified | 1723 |
| 256 | Ga0373925_0003359 | 3300037068 | Bacteria | 12414 |
| 257 | Ga0373925_0045401 | 3300037068 | Bacteria | 3264 |
| 258 | Ga0395900_1400957 | 3300037418 | Unclassified | 612 |
| 259 | Ga0395898_1189220 | 3300037466 | Bacteria | 694 |
| 260 | Ga0436365_0537176 | 3300039437 | Unclassified | 1387 |
| 261 | Ga0436365_0649915 | 3300039437 | Bacteria | 725 |
| 262 | Ga0436365_1009643 | 3300039437 | Bacteria | 14972 |
| 263 | Ga0436361_0480296 | 3300039447 | Bacteria | 952 |
| 264 | Ga0436363_0352287 | 3300039450 | Bacteria | 785 |
| 265 | Ga0451576_0837126 | 3300045051 | Bacteria | 966 |
| 266 | Ga0495592_0273687 | 3300046454 | Unclassified | 1107 |
| 267 | Ga0495603_0011287 | 3300046455 | Bacteria | 5412 |
| 268 | Ga0495603_0752564 | 3300046455 | Unclassified | 556 |
| 269 | Ga0495629_0022418 | 3300046459 | Bacteria | 4503 |
| 270 | Ga0495641_0042802 | 3300046461 | Unclassified | 2097 |
| 271 | Ga0495641_0076798 | 3300046461 | Unclassified | 1497 |
| 272 | Ga0495651_0040015 | 3300046462 | Bacteria | 3646 |
| 273 | Ga0495651_0437813 | 3300046462 | Unclassified | 847 |
| 274 | Ga0495653_0172035 | 3300046463 | Unclassified | 1494 |
| 275 | Ga0495580_0007052 | 3300046472 | Bacteria | 9058 |
| 276 | Ga0495580_0056519 | 3300046472 | Bacteria | 2763 |
| 277 | Ga0495580_0090561 | 3300046472 | Unclassified | 2130 |
| 278 | Ga0495580_0213127 | 3300046472 | Unclassified | 1328 |
| 279 | Ga0495582_0000527 | 3300046473 | Bacteria | 21118 |
| 280 | Ga0495582_0004757 | 3300046473 | Bacteria | 7633 |
| 281 | Ga0495639_0001706 | 3300046475 | Bacteria | 9759 |
| 282 | Ga0495664_0062632 | 3300046477 | Bacteria | 2216 |
| 283 | Ga0495664_0413571 | 3300046477 | Unclassified | 809 |
| 284 | Ga0495594_0281561 | 3300046499 | Unclassified | 947 |
| 285 | Ga0495618_0054979 | 3300046514 | Bacteria | 2520 |
| 286 | Ga0495618_0116493 | 3300046514 | Unclassified | 1711 |
| 287 | Ga0495628_0070576 | 3300046516 | Bacteria | 2724 |
| 288 | Ga0495628_0779199 | 3300046516 | Unclassified | 670 |
| 289 | Ga0495630_0026394 | 3300046517 | Bacteria | 4300 |
| 290 | Ga0495630_0031427 | 3300046517 | Bacteria | 3953 |
| 291 | Ga0495630_1325606 | 3300046517 | Unclassified | 542 |
| 292 | Ga0495666_0006576 | 3300046526 | Bacteria | 5846 |
| 293 | Ga0495665_0327920 | 3300046531 | Unclassified | 781 |
| 294 | Ga0495640_0019119 | 3300046533 | Bacteria | 5062 |
| 295 | Ga0495586_0015107 | 3300046535 | Bacteria | 4108 |
| 296 | Ga0495587_0001635 | 3300046536 | Bacteria | 14936 |
| 297 | Ga0495587_0008530 | 3300046536 | Bacteria | 6582 |
| 298 | Ga0495587_0224850 | 3300046536 | Bacteria | 1058 |
| 299 | Ga0495667_0288878 | 3300046559 | Unclassified | 1040 |
| 300 | Ga0495667_0872064 | 3300046559 | Unclassified | 553 |
| 301 | Ga0495635_0028536 | 3300046663 | Bacteria | 3880 |
| 302 | Ga0495635_0236251 | 3300046663 | Bacteria | 1234 |
| 303 | Ga0495588_0470680 | 3300046674 | Unclassified | 659 |
| 304 | Ga0495657_0265661 | 3300046675 | Bacteria | 1030 |
| 305 | Ga0495657_0605983 | 3300046675 | Unclassified | 633 |
| 306 | Ga0495599_0552907 | 3300046678 | Unclassified | 674 |
| 307 | Ga0495623_0040778 | 3300046679 | Bacteria | 2963 |
| 308 | Ga0495646_0201676 | 3300046680 | Bacteria | 1083 |
| 309 | Ga0495647_0038937 | 3300046681 | Unclassified | 1799 |
| 310 | Ga0495658_0036765 | 3300046683 | Bacteria | 2703 |
| 311 | Ga0495658_0126360 | 3300046683 | Bacteria | 1552 |
| 312 | Ga0495613_0259685 | 3300046689 | Unclassified | 1210 |
| 313 | Ga0495624_0080933 | 3300046690 | Unclassified | 2012 |
| 314 | Ga0495624_0097902 | 3300046690 | Unclassified | 1807 |
| 315 | Ga0495581_0296283 | 3300047315 | Unclassified | 945 |
| 316 | Ga0495604_0001286 | 3300047317 | Bacteria | 20525 |
| 317 | Ga0495604_0199228 | 3300047317 | Unclassified | 1390 |
| 318 | Ga0495604_0534523 | 3300047317 | Unclassified | 757 |
| 319 | Ga0495674_0026673 | 3300047319 | Bacteria | 5285 |
| 320 | Ga0495674_0043497 | 3300047319 | Bacteria | 3997 |
| 321 | Ga0495674_0069164 | 3300047319 | Bacteria | 3054 |
| 322 | Ga0495676_0029959 | 3300047321 | Bacteria | 4626 |
| 323 | Ga0495680_0093422 | 3300047322 | Unclassified | 2252 |
| 324 | Ga0495680_0116203 | 3300047322 | Unclassified | 1978 |
| 325 | Ga0495680_0295586 | 3300047322 | Unclassified | 1138 |
| 326 | Ga0495684_0011358 | 3300047471 | Bacteria | 6876 |
| 327 | Ga0495684_0032592 | 3300047471 | Bacteria | 4001 |
| 328 | Ga0495684_0273593 | 3300047471 | Bacteria | 1221 |
| 329 | Ga0495593_0064255 | 3300047673 | Unclassified | 1916 |
| 330 | Ga0495602_0015630 | 3300048088 | Bacteria | 7654 |
| 331 | Ga0495602_0353936 | 3300048088 | Unclassified | 1059 |
| 332 | Ga0495614_0011383 | 3300048089 | Bacteria | 3916 |
| 333 | Ga0496100_0123881 | 3300048903 | Unclassified | 1812 |
| 334 | Ga0496101_0099704 | 3300048904 | Unclassified | 2172 |
| 335 | Ga0496102_0024639 | 3300048905 | Bacteria | 5350 |
| 336 | Ga0496104_0350242 | 3300048907 | Bacteria | 1390 |
| 337 | Ga0496106_0020663 | 3300048909 | Bacteria | 4889 |
| 338 | Ga0496107_1102198 | 3300048910 | Unclassified | 573 |
| 339 | Ga0496111_1104194 | 3300048914 | Bacteria | 565 |
| 340 | Ga0496112_0214590 | 3300048915 | Bacteria | 1881 |
| 341 | Ga0496114_0007264 | 3300048917 | Bacteria | 8750 |
| 342 | Ga0496114_0725386 | 3300048917 | Unclassified | 870 |
| 343 | nmdc:mga0n895_115513_c1 | 3300050512 | Unclassified | 2702 |
| 344 | nmdc:mga0n895_397602_c1 | 3300050512 | Unclassified | 1394 |
| 345 | nmdc:mga0n895_39937_c1 | 3300050512 | Bacteria | 4557 |
| 346 | nmdc:mga08x19_1539_c1 | 3300050514 | Bacteria | 14302 |
| 347 | nmdc:mga08x19_172617_c1 | 3300050514 | Bacteria | 1473 |
| 348 | nmdc:mga08x19_47415_c1 | 3300050514 | Bacteria | 2750 |
| 349 | Ga0495601_0077645 | 3300053077 | Unclassified | 2127 |
| 350 | Ga0495601_0114769 | 3300053077 | Bacteria | 1746 |
| 351 | Ga0495619_0017671 | 3300053085 | Bacteria | 4518 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100091362 | Ga0070714_1000913622 | 106 |
| 2 | 3300005468 | Ga0070707_102229028 | Ga0070707_1022290282 | 106 |
| 3 | 3300006028 | Ga0070717_10033106 | Ga0070717_100331063 | 106 |
| 4 | 3300006173 | Ga0070716_100410743 | Ga0070716_1004107431 | 106 |
| 5 | 3300025905 | Ga0207685_10121173 | Ga0207685_101211732 | 106 |
| 6 | 3300025906 | Ga0207699_10027220 | Ga0207699_100272203 | 106 |
| 7 | 3300025928 | Ga0207700_10784027 | Ga0207700_107840272 | 106 |
| 8 | 3300025929 | Ga0207664_10072910 | Ga0207664_100729102 | 106 |
| 9 | 3300009093 | Ga0105240_10020804 | Ga0105240_100208043 | 107 |
| 10 | 3300013104 | Ga0157370_10357138 | Ga0157370_103571382 | 107 |
| 11 | 3300025913 | Ga0207695_10107367 | Ga0207695_101073672 | 107 |
| 12 | 3300024227 | Ga0228598_1000308 | Ga0228598_10003083 | 108 |
| 13 | 3300030760 | Ga0265762_1065409 | Ga0265762_10654092 | 108 |
| 14 | 3300031090 | Ga0265760_10037802 | Ga0265760_100378023 | 108 |
| 15 | 3300007265 | Ga0099794_10360482 | Ga0099794_103604822 | 112 |
| 16 | 3300005434 | Ga0070709_10535921 | Ga0070709_105359212 | 113 |
| 17 | 3300005437 | Ga0070710_11396806 | Ga0070710_113968061 | 113 |
| 18 | 3300005468 | Ga0070707_100186997 | Ga0070707_1001869972 | 113 |
| 19 | 3300006175 | Ga0070712_100984761 | Ga0070712_1009847611 | 113 |
| 20 | 3300025915 | Ga0207693_10776474 | Ga0207693_107764742 | 113 |
| 21 | 3300025916 | Ga0207663_10056709 | Ga0207663_100567093 | 113 |
| 22 | 3300025928 | Ga0207700_10343894 | Ga0207700_103438942 | 113 |
| 23 | 3300046680 | Ga0495646_0201676 | Ga0495646_0201676_451_792 | 113 |
| 24 | 3300047319 | Ga0495674_0026673 | Ga0495674_0026673_993_1334 | 113 |
| 25 | 3300048907 | Ga0496104_0350242 | Ga0496104_0350242_390_731 | 113 |
| 26 | 3300048914 | Ga0496111_1104194 | Ga0496111_1104194_12_353 | 113 |
| 27 | 3300053077 | Ga0495601_0114769 | Ga0495601_0114769_1296_1637 | 113 |
| 28 | 3300005434 | Ga0070709_11012364 | Ga0070709_110123641 | 114 |
| 29 | 3300007265 | Ga0099794_10003091 | Ga0099794_100030913 | 114 |
| 30 | 3300007265 | Ga0099794_10193044 | Ga0099794_101930442 | 114 |
| 31 | 3300006028 | Ga0070717_11364732 | Ga0070717_113647322 | 115 |
| 32 | 3300006914 | Ga0075436_100058712 | Ga0075436_1000587123 | 115 |
| 33 | 3300039437 | Ga0436365_1009643 | Ga0436365_1009643_9183_9530 | 115 |
| 34 | 3300039447 | Ga0436361_0480296 | Ga0436361_0480296_26_373 | 115 |
| 35 | 3300046461 | Ga0495641_0042802 | Ga0495641_0042802_853_1200 | 115 |
| 36 | 3300046472 | Ga0495580_0007052 | Ga0495580_0007052_5454_5801 | 115 |
| 37 | 3300046473 | Ga0495582_0000527 | Ga0495582_0000527_11129_11476 | 115 |
| 38 | 3300046517 | Ga0495630_1325606 | Ga0495630_1325606_108_455 | 115 |
| 39 | 3300046683 | Ga0495658_0126360 | Ga0495658_0126360_11_358 | 115 |
| 40 | 3300050514 | nmdc:mga08x19_47415_c1 | nmdc:mga08x19_47415_c1_606_953 | 115 |
| 41 | 3300009177 | Ga0105248_11269685 | Ga0105248_112696852 | 116 |
| 42 | 3300026089 | Ga0207648_10550273 | Ga0207648_105502732 | 116 |
| 43 | 3300036401 | Ga0373937_0235943 | Ga0373937_0235943_256_612 | 116 |
| 44 | 3300028800 | Ga0265338_10102250 | Ga0265338_101022503 | 117 |
| 45 | 3300031235 | Ga0265330_10113216 | Ga0265330_101132162 | 117 |
| 46 | 3300031239 | Ga0265328_10079135 | Ga0265328_100791352 | 117 |
| 47 | 3300031241 | Ga0265325_10062777 | Ga0265325_100627773 | 117 |
| 48 | 3300031250 | Ga0265331_10007778 | Ga0265331_100077785 | 117 |
| 49 | 3300031344 | Ga0265316_10010776 | Ga0265316_100107769 | 117 |
| 50 | 3300031711 | Ga0265314_10201768 | Ga0265314_102017682 | 117 |
| 51 | 3300035086 | Ga0373934_0000532 | Ga0373934_0000532_5500_5853 | 117 |
| 52 | 3300035111 | Ga0373923_0030910 | Ga0373923_0030910_793_1146 | 117 |
| 53 | 3300035117 | Ga0373953_0005823 | Ga0373953_0005823_1746_2099 | 117 |
| 54 | 3300035118 | Ga0373954_0001245 | Ga0373954_0001245_3909_4262 | 117 |
| 55 | 3300035119 | Ga0373956_0008977 | Ga0373956_0008977_2691_3044 | 117 |
| 56 | 3300035120 | Ga0373957_0014733 | Ga0373957_0014733_2126_2479 | 117 |
| 57 | 3300035172 | Ga0373955_0000888 | Ga0373955_0000888_7292_7645 | 117 |
| 58 | 3300035410 | Ga0373924_0019384 | Ga0373924_0019384_1474_1827 | 117 |
| 59 | 3300035724 | Ga0373933_0000251 | Ga0373933_0000251_9905_10258 | 117 |
| 60 | 3300036401 | Ga0373937_0001122 | Ga0373937_0001122_10491_10844 | 117 |
| 61 | 3300046454 | Ga0495592_0273687 | Ga0495592_0273687_718_1071 | 117 |
| 62 | 3300046462 | Ga0495651_0040015 | Ga0495651_0040015_253_606 | 117 |
| 63 | 3300046463 | Ga0495653_0172035 | Ga0495653_0172035_49_402 | 117 |
| 64 | 3300046472 | Ga0495580_0090561 | Ga0495580_0090561_1670_2023 | 117 |
| 65 | 3300046536 | Ga0495587_0001635 | Ga0495587_0001635_1821_2174 | 117 |
| 66 | 3300046559 | Ga0495667_0288878 | Ga0495667_0288878_223_576 | 117 |
| 67 | 3300046663 | Ga0495635_0236251 | Ga0495635_0236251_355_708 | 117 |
| 68 | 3300046679 | Ga0495623_0040778 | Ga0495623_0040778_1540_1893 | 117 |
| 69 | 3300047317 | Ga0495604_0001286 | Ga0495604_0001286_7011_7364 | 117 |
| 70 | 3300047322 | Ga0495680_0295586 | Ga0495680_0295586_517_870 | 117 |
| 71 | 3300047471 | Ga0495684_0011358 | Ga0495684_0011358_4442_4795 | 117 |
| 72 | 3300048088 | Ga0495602_0015630 | Ga0495602_0015630_3887_4240 | 117 |
| 73 | 3300053085 | Ga0495619_0017671 | Ga0495619_0017671_3400_3753 | 117 |
| 74 | 3300025939 | Ga0207665_10735543 | Ga0207665_107355431 | 118 |
| 75 | 3300005445 | Ga0070708_100016658 | Ga0070708_1000166583 | 119 |
| 76 | 3300005468 | Ga0070707_100113905 | Ga0070707_1001139052 | 119 |
| 77 | 3300006173 | Ga0070716_100110419 | Ga0070716_1001104192 | 119 |
| 78 | 3300013308 | Ga0157375_12853642 | Ga0157375_128536422 | 119 |
| 79 | 3300025910 | Ga0207684_11455469 | Ga0207684_114554691 | 119 |
| 80 | 3300031249 | Ga0265339_10218145 | Ga0265339_102181452 | 119 |
| 81 | 3300031712 | Ga0265342_10160229 | Ga0265342_101602291 | 119 |
| 82 | 3300007788 | Ga0099795_10078124 | Ga0099795_100781242 | 120 |
| 83 | 3300045051 | Ga0451576_0837126 | Ga0451576_0837126_123_485 | 120 |
| 84 | 3300005439 | Ga0070711_100339299 | Ga0070711_1003392992 | 121 |
| 85 | 3300005459 | Ga0068867_100430300 | Ga0068867_1004303002 | 121 |
| 86 | 3300005546 | Ga0070696_100944577 | Ga0070696_1009445772 | 121 |
| 87 | 3300005548 | Ga0070665_100003590 | Ga0070665_10000359012 | 121 |
| 88 | 3300005548 | Ga0070665_100993821 | Ga0070665_1009938212 | 121 |
| 89 | 3300005841 | Ga0068863_100005925 | Ga0068863_10000592513 | 121 |
| 90 | 3300005841 | Ga0068863_100733642 | Ga0068863_1007336422 | 121 |
| 91 | 3300005842 | Ga0068858_100025597 | Ga0068858_1000255973 | 121 |
| 92 | 3300005843 | Ga0068860_100165869 | Ga0068860_1001658692 | 121 |
| 93 | 3300005843 | Ga0068860_100996569 | Ga0068860_1009965692 | 121 |
| 94 | 3300005937 | Ga0081455_10265510 | Ga0081455_102655102 | 121 |
| 95 | 3300006173 | Ga0070716_100035973 | Ga0070716_1000359732 | 121 |
| 96 | 3300006237 | Ga0097621_100010961 | Ga0097621_1000109617 | 121 |
| 97 | 3300006358 | Ga0068871_100062325 | Ga0068871_1000623253 | 121 |
| 98 | 3300006852 | Ga0075433_10454174 | Ga0075433_104541742 | 121 |
| 99 | 3300006871 | Ga0075434_100011928 | Ga0075434_1000119288 | 121 |
| 100 | 3300006871 | Ga0075434_100072504 | Ga0075434_1000725042 | 121 |
| 101 | 3300007076 | Ga0075435_100057600 | Ga0075435_1000576003 | 121 |
| 102 | 3300009148 | Ga0105243_10143913 | Ga0105243_101439133 | 121 |
| 103 | 3300009545 | Ga0105237_10312280 | Ga0105237_103122802 | 121 |
| 104 | 3300009553 | Ga0105249_11321593 | Ga0105249_113215932 | 121 |
| 105 | 3300013296 | Ga0157374_11322998 | Ga0157374_113229982 | 121 |
| 106 | 3300013297 | Ga0157378_10002309 | Ga0157378_100023092 | 121 |
| 107 | 3300013308 | Ga0157375_10508721 | Ga0157375_105087213 | 121 |
| 108 | 3300014325 | Ga0163163_10187261 | Ga0163163_101872611 | 121 |
| 109 | 3300014325 | Ga0163163_10574320 | Ga0163163_105743202 | 121 |
| 110 | 3300014969 | Ga0157376_10000004 | Ga0157376_1000000473 | 121 |
| 111 | 3300014969 | Ga0157376_11405677 | Ga0157376_114056772 | 121 |
| 112 | 3300025910 | Ga0207684_10294551 | Ga0207684_102945512 | 121 |
| 113 | 3300025914 | Ga0207671_11058341 | Ga0207671_110583412 | 121 |
| 114 | 3300025916 | Ga0207663_10696197 | Ga0207663_106961972 | 121 |
| 115 | 3300025937 | Ga0207669_11154146 | Ga0207669_111541461 | 121 |
| 116 | 3300025939 | Ga0207665_10009702 | Ga0207665_100097028 | 121 |
| 117 | 3300026088 | Ga0207641_10006629 | Ga0207641_100066295 | 121 |
| 118 | 3300026088 | Ga0207641_11567930 | Ga0207641_115679302 | 121 |
| 119 | 3300028379 | Ga0268266_10000470 | Ga0268266_100004706 | 121 |
| 120 | 3300028381 | Ga0268264_10768963 | Ga0268264_107689632 | 121 |
| 121 | 3300037418 | Ga0395900_1400957 | Ga0395900_1400957_79_444 | 121 |
| 122 | 3300037466 | Ga0395898_1189220 | Ga0395898_1189220_193_558 | 121 |
| 123 | 3300048910 | Ga0496107_1102198 | Ga0496107_1102198_198_563 | 121 |
| 124 | 3300048917 | Ga0496114_0007264 | Ga0496114_0007264_6254_6619 | 121 |
| 125 | 3300050512 | nmdc:mga0n895_115513_c1 | nmdc:mga0n895_115513_c1_1098_1463 | 121 |
| 126 | 3300050512 | nmdc:mga0n895_397602_c1 | nmdc:mga0n895_397602_c1_313_678 | 121 |
| 127 | 3300050512 | nmdc:mga0n895_39937_c1 | nmdc:mga0n895_39937_c1_2142_2507 | 121 |
| 128 | 3300005439 | Ga0070711_101026553 | Ga0070711_1010265532 | 122 |
| 129 | 3300005471 | Ga0070698_102166923 | Ga0070698_1021669231 | 122 |
| 130 | 3300005544 | Ga0070686_100067705 | Ga0070686_1000677053 | 122 |
| 131 | 3300005549 | Ga0070704_100140615 | Ga0070704_1001406151 | 122 |
| 132 | 3300005841 | Ga0068863_100311078 | Ga0068863_1003110782 | 122 |
| 133 | 3300005842 | Ga0068858_100855129 | Ga0068858_1008551292 | 122 |
| 134 | 3300005843 | Ga0068860_100013682 | Ga0068860_10001368210 | 122 |
| 135 | 3300006173 | Ga0070716_100000044 | Ga0070716_10000004424 | 122 |
| 136 | 3300006173 | Ga0070716_100176820 | Ga0070716_1001768202 | 122 |
| 137 | 3300006914 | Ga0075436_100000079 | Ga0075436_10000007952 | 122 |
| 138 | 3300006914 | Ga0075436_100045653 | Ga0075436_1000456532 | 122 |
| 139 | 3300006914 | Ga0075436_100061674 | Ga0075436_1000616743 | 122 |
| 140 | 3300007265 | Ga0099794_10108024 | Ga0099794_101080242 | 122 |
| 141 | 3300007265 | Ga0099794_10126964 | Ga0099794_101269642 | 122 |
| 142 | 3300007265 | Ga0099794_10193276 | Ga0099794_101932762 | 122 |
| 143 | 3300007265 | Ga0099794_10753300 | Ga0099794_107533002 | 122 |
| 144 | 3300009098 | Ga0105245_10645328 | Ga0105245_106453282 | 122 |
| 145 | 3300009177 | Ga0105248_10890230 | Ga0105248_108902302 | 122 |
| 146 | 3300009553 | Ga0105249_10801810 | Ga0105249_108018102 | 122 |
| 147 | 3300010375 | Ga0105239_11032880 | Ga0105239_110328802 | 122 |
| 148 | 3300013297 | Ga0157378_10000471 | Ga0157378_1000047113 | 122 |
| 149 | 3300013306 | Ga0163162_10063358 | Ga0163162_100633582 | 122 |
| 150 | 3300014968 | Ga0157379_10869526 | Ga0157379_108695262 | 122 |
| 151 | 3300025906 | Ga0207699_10831673 | Ga0207699_108316732 | 122 |
| 152 | 3300025906 | Ga0207699_11421360 | Ga0207699_114213601 | 122 |
| 153 | 3300025916 | Ga0207663_11359854 | Ga0207663_113598542 | 122 |
| 154 | 3300025927 | Ga0207687_10467624 | Ga0207687_104676242 | 122 |
| 155 | 3300025939 | Ga0207665_10000030 | Ga0207665_1000003050 | 122 |
| 156 | 3300025939 | Ga0207665_10053840 | Ga0207665_100538403 | 122 |
| 157 | 3300025939 | Ga0207665_10081696 | Ga0207665_100816963 | 122 |
| 158 | 3300025939 | Ga0207665_10383451 | Ga0207665_103834512 | 122 |
| 159 | 3300025941 | Ga0207711_10654670 | Ga0207711_106546702 | 122 |
| 160 | 3300025942 | Ga0207689_11326561 | Ga0207689_113265611 | 122 |
| 161 | 3300026035 | Ga0207703_10790417 | Ga0207703_107904172 | 122 |
| 162 | 3300026088 | Ga0207641_10974983 | Ga0207641_109749832 | 122 |
| 163 | 3300027671 | Ga0209588_1018861 | Ga0209588_10188612 | 122 |
| 164 | 3300027671 | Ga0209588_1104690 | Ga0209588_11046901 | 122 |
| 165 | 3300035116 | Ga0373945_0208221 | Ga0373945_0208221_364_735 | 122 |
| 166 | 3300035171 | Ga0373946_0003377 | Ga0373946_0003377_1600_1971 | 122 |
| 167 | 3300035692 | Ga0373935_1009002 | Ga0373935_1009002_131_502 | 122 |
| 168 | 3300035695 | Ga0373927_0199790 | Ga0373927_0199790_488_859 | 122 |
| 169 | 3300035725 | Ga0373947_0005922 | Ga0373947_0005922_1891_2262 | 122 |
| 170 | 3300037068 | Ga0373925_0003359 | Ga0373925_0003359_11811_12182 | 122 |
| 171 | 3300039437 | Ga0436365_0649915 | Ga0436365_0649915_310_687 | 122 |
| 172 | 3300039450 | Ga0436363_0352287 | Ga0436363_0352287_370_741 | 122 |
| 173 | 3300046517 | Ga0495630_0026394 | Ga0495630_0026394_2574_2945 | 122 |
| 174 | 3300046690 | Ga0495624_0097902 | Ga0495624_0097902_421_792 | 122 |
| 175 | 3300048904 | Ga0496101_0099704 | Ga0496101_0099704_859_1227 | 122 |
| 176 | 3300048905 | Ga0496102_0024639 | Ga0496102_0024639_4038_4406 | 122 |
| 177 | 3300048909 | Ga0496106_0020663 | Ga0496106_0020663_4296_4664 | 122 |
| 178 | 3300048915 | Ga0496112_0214590 | Ga0496112_0214590_852_1220 | 122 |
| 179 | 3300050514 | nmdc:mga08x19_1539_c1 | nmdc:mga08x19_1539_c1_1598_1969 | 122 |
| 180 | 3300050514 | nmdc:mga08x19_172617_c1 | nmdc:mga08x19_172617_c1_640_1011 | 122 |
| 181 | 3300005434 | Ga0070709_10066910 | Ga0070709_100669102 | 123 |
| 182 | 3300005436 | Ga0070713_100233909 | Ga0070713_1002339092 | 123 |
| 183 | 3300005437 | Ga0070710_10225912 | Ga0070710_102259123 | 123 |
| 184 | 3300005439 | Ga0070711_100015579 | Ga0070711_1000155793 | 123 |
| 185 | 3300005439 | Ga0070711_100026155 | Ga0070711_1000261553 | 123 |
| 186 | 3300005439 | Ga0070711_101034960 | Ga0070711_1010349602 | 123 |
| 187 | 3300005445 | Ga0070708_100001983 | Ga0070708_1000019838 | 123 |
| 188 | 3300005445 | Ga0070708_100032966 | Ga0070708_1000329663 | 123 |
| 189 | 3300005445 | Ga0070708_101781730 | Ga0070708_1017817302 | 123 |
| 190 | 3300005467 | Ga0070706_100146839 | Ga0070706_1001468393 | 123 |
| 191 | 3300005468 | Ga0070707_100018606 | Ga0070707_1000186063 | 123 |
| 192 | 3300005468 | Ga0070707_100023596 | Ga0070707_1000235963 | 123 |
| 193 | 3300005468 | Ga0070707_100468986 | Ga0070707_1004689862 | 123 |
| 194 | 3300005471 | Ga0070698_100029548 | Ga0070698_1000295482 | 123 |
| 195 | 3300005471 | Ga0070698_100132715 | Ga0070698_1001327153 | 123 |
| 196 | 3300005518 | Ga0070699_100162508 | Ga0070699_1001625083 | 123 |
| 197 | 3300005518 | Ga0070699_100275786 | Ga0070699_1002757862 | 123 |
| 198 | 3300005536 | Ga0070697_100001723 | Ga0070697_10000172313 | 123 |
| 199 | 3300006028 | Ga0070717_10996780 | Ga0070717_109967801 | 123 |
| 200 | 3300006163 | Ga0070715_10767424 | Ga0070715_107674242 | 123 |
| 201 | 3300006173 | Ga0070716_100126650 | Ga0070716_1001266502 | 123 |
| 202 | 3300006173 | Ga0070716_100170857 | Ga0070716_1001708572 | 123 |
| 203 | 3300006175 | Ga0070712_100021238 | Ga0070712_1000212384 | 123 |
| 204 | 3300006175 | Ga0070712_100044968 | Ga0070712_1000449684 | 123 |
| 205 | 3300006237 | Ga0097621_100078760 | Ga0097621_1000787603 | 123 |
| 206 | 3300007265 | Ga0099794_10699789 | Ga0099794_106997891 | 123 |
| 207 | 3300009545 | Ga0105237_10191716 | Ga0105237_101917161 | 123 |
| 208 | 3300009551 | Ga0105238_11094937 | Ga0105238_110949372 | 123 |
| 209 | 3300013307 | Ga0157372_10460158 | Ga0157372_104601582 | 123 |
| 210 | 3300014969 | Ga0157376_10001354 | Ga0157376_1000135412 | 123 |
| 211 | 3300025898 | Ga0207692_10848700 | Ga0207692_108487002 | 123 |
| 212 | 3300025906 | Ga0207699_10000410 | Ga0207699_1000041017 | 123 |
| 213 | 3300025906 | Ga0207699_10095165 | Ga0207699_100951653 | 123 |
| 214 | 3300025906 | Ga0207699_10784459 | Ga0207699_107844591 | 123 |
| 215 | 3300025910 | Ga0207684_10070670 | Ga0207684_100706702 | 123 |
| 216 | 3300025922 | Ga0207646_10014887 | Ga0207646_100148879 | 123 |
| 217 | 3300025922 | Ga0207646_10037066 | Ga0207646_100370663 | 123 |
| 218 | 3300025929 | Ga0207664_10843985 | Ga0207664_108439851 | 123 |
| 219 | 3300025939 | Ga0207665_10076399 | Ga0207665_100763991 | 123 |
| 220 | 3300025939 | Ga0207665_10973093 | Ga0207665_109730932 | 123 |
| 221 | 3300027671 | Ga0209588_1171605 | Ga0209588_11716052 | 123 |
| 222 | 3300035089 | Ga0373944_0201376 | Ga0373944_0201376_309_680 | 123 |
| 223 | 3300035111 | Ga0373923_0315942 | Ga0373923_0315942_169_540 | 123 |
| 224 | 3300037068 | Ga0373925_0045401 | Ga0373925_0045401_751_1122 | 123 |
| 225 | 3300039437 | Ga0436365_0537176 | Ga0436365_0537176_472_849 | 123 |
| 226 | 3300046455 | Ga0495603_0011287 | Ga0495603_0011287_3774_4145 | 123 |
| 227 | 3300046459 | Ga0495629_0022418 | Ga0495629_0022418_3418_3789 | 123 |
| 228 | 3300046461 | Ga0495641_0076798 | Ga0495641_0076798_208_579 | 123 |
| 229 | 3300046472 | Ga0495580_0213127 | Ga0495580_0213127_271_642 | 123 |
| 230 | 3300046473 | Ga0495582_0004757 | Ga0495582_0004757_5277_5648 | 123 |
| 231 | 3300046475 | Ga0495639_0001706 | Ga0495639_0001706_1473_1844 | 123 |
| 232 | 3300046477 | Ga0495664_0062632 | Ga0495664_0062632_1779_2150 | 123 |
| 233 | 3300046499 | Ga0495594_0281561 | Ga0495594_0281561_443_814 | 123 |
| 234 | 3300046514 | Ga0495618_0116493 | Ga0495618_0116493_983_1354 | 123 |
| 235 | 3300046517 | Ga0495630_0031427 | Ga0495630_0031427_2103_2474 | 123 |
| 236 | 3300046526 | Ga0495666_0006576 | Ga0495666_0006576_1984_2355 | 123 |
| 237 | 3300046531 | Ga0495665_0327920 | Ga0495665_0327920_126_497 | 123 |
| 238 | 3300046533 | Ga0495640_0019119 | Ga0495640_0019119_4567_4938 | 123 |
| 239 | 3300046535 | Ga0495586_0015107 | Ga0495586_0015107_324_695 | 123 |
| 240 | 3300046559 | Ga0495667_0872064 | Ga0495667_0872064_155_526 | 123 |
| 241 | 3300046663 | Ga0495635_0028536 | Ga0495635_0028536_1386_1757 | 123 |
| 242 | 3300046674 | Ga0495588_0470680 | Ga0495588_0470680_105_476 | 123 |
| 243 | 3300046681 | Ga0495647_0038937 | Ga0495647_0038937_262_633 | 123 |
| 244 | 3300046683 | Ga0495658_0036765 | Ga0495658_0036765_513_884 | 123 |
| 245 | 3300046689 | Ga0495613_0259685 | Ga0495613_0259685_134_505 | 123 |
| 246 | 3300046690 | Ga0495624_0080933 | Ga0495624_0080933_525_896 | 123 |
| 247 | 3300047315 | Ga0495581_0296283 | Ga0495581_0296283_344_715 | 123 |
| 248 | 3300047319 | Ga0495674_0043497 | Ga0495674_0043497_259_630 | 123 |
| 249 | 3300047321 | Ga0495676_0029959 | Ga0495676_0029959_861_1232 | 123 |
| 250 | 3300047322 | Ga0495680_0093422 | Ga0495680_0093422_875_1246 | 123 |
| 251 | 3300047471 | Ga0495684_0032592 | Ga0495684_0032592_3619_3990 | 123 |
| 252 | 3300047673 | Ga0495593_0064255 | Ga0495593_0064255_555_926 | 123 |
| 253 | 3300048089 | Ga0495614_0011383 | Ga0495614_0011383_1725_2096 | 123 |
| 254 | 3300048903 | Ga0496100_0123881 | Ga0496100_0123881_237_608 | 123 |
| 255 | 3300048917 | Ga0496114_0725386 | Ga0496114_0725386_344_715 | 123 |
| 256 | 3300005406 | Ga0070703_10005748 | Ga0070703_100057482 | 124 |
| 257 | 3300005435 | Ga0070714_100242178 | Ga0070714_1002421782 | 124 |
| 258 | 3300005435 | Ga0070714_100358284 | Ga0070714_1003582843 | 124 |
| 259 | 3300005436 | Ga0070713_100523419 | Ga0070713_1005234191 | 124 |
| 260 | 3300005437 | Ga0070710_10268918 | Ga0070710_102689183 | 124 |
| 261 | 3300005437 | Ga0070710_11465802 | Ga0070710_114658021 | 124 |
| 262 | 3300005439 | Ga0070711_100165954 | Ga0070711_1001659543 | 124 |
| 263 | 3300005439 | Ga0070711_100539546 | Ga0070711_1005395462 | 124 |
| 264 | 3300005440 | Ga0070705_100041740 | Ga0070705_1000417403 | 124 |
| 265 | 3300005444 | Ga0070694_100033774 | Ga0070694_1000337742 | 124 |
| 266 | 3300005445 | Ga0070708_100027431 | Ga0070708_1000274315 | 124 |
| 267 | 3300005445 | Ga0070708_100118103 | Ga0070708_1001181032 | 124 |
| 268 | 3300005445 | Ga0070708_100580056 | Ga0070708_1005800561 | 124 |
| 269 | 3300005458 | Ga0070681_10061173 | Ga0070681_100611732 | 124 |
| 270 | 3300005467 | Ga0070706_100004828 | Ga0070706_1000048284 | 124 |
| 271 | 3300005467 | Ga0070706_100266943 | Ga0070706_1002669432 | 124 |
| 272 | 3300005468 | Ga0070707_101000444 | Ga0070707_1010004442 | 124 |
| 273 | 3300005468 | Ga0070707_102063071 | Ga0070707_1020630711 | 124 |
| 274 | 3300005518 | Ga0070699_100040372 | Ga0070699_1000403725 | 124 |
| 275 | 3300005518 | Ga0070699_100136227 | Ga0070699_1001362271 | 124 |
| 276 | 3300005518 | Ga0070699_101007330 | Ga0070699_1010073302 | 124 |
| 277 | 3300005530 | Ga0070679_100228796 | Ga0070679_1002287961 | 124 |
| 278 | 3300005536 | Ga0070697_100000188 | Ga0070697_1000001888 | 124 |
| 279 | 3300005545 | Ga0070695_100013954 | Ga0070695_1000139544 | 124 |
| 280 | 3300005545 | Ga0070695_100076457 | Ga0070695_1000764573 | 124 |
| 281 | 3300005546 | Ga0070696_100001179 | Ga0070696_10000117913 | 124 |
| 282 | 3300005547 | Ga0070693_100000095 | Ga0070693_10000009534 | 124 |
| 283 | 3300005549 | Ga0070704_100002381 | Ga0070704_1000023818 | 124 |
| 284 | 3300006028 | Ga0070717_10801169 | Ga0070717_108011692 | 124 |
| 285 | 3300006163 | Ga0070715_10064096 | Ga0070715_100640963 | 124 |
| 286 | 3300006163 | Ga0070715_10115249 | Ga0070715_101152492 | 124 |
| 287 | 3300006173 | Ga0070716_100345354 | Ga0070716_1003453542 | 124 |
| 288 | 3300006173 | Ga0070716_101644600 | Ga0070716_1016446001 | 124 |
| 289 | 3300006173 | Ga0070716_101708117 | Ga0070716_1017081172 | 124 |
| 290 | 3300006175 | Ga0070712_100024150 | Ga0070712_1000241503 | 124 |
| 291 | 3300006914 | Ga0075436_101504292 | Ga0075436_1015042922 | 124 |
| 292 | 3300007265 | Ga0099794_10008304 | Ga0099794_100083045 | 124 |
| 293 | 3300007265 | Ga0099794_10016384 | Ga0099794_100163843 | 124 |
| 294 | 3300007265 | Ga0099794_10033666 | Ga0099794_100336663 | 124 |
| 295 | 3300007265 | Ga0099794_10580190 | Ga0099794_105801901 | 124 |
| 296 | 3300007788 | Ga0099795_10028794 | Ga0099795_100287942 | 124 |
| 297 | 3300007788 | Ga0099795_10297156 | Ga0099795_102971562 | 124 |
| 298 | 3300010159 | Ga0099796_10063047 | Ga0099796_100630472 | 124 |
| 299 | 3300024225 | Ga0224572_1062670 | Ga0224572_10626702 | 124 |
| 300 | 3300025885 | Ga0207653_10004052 | Ga0207653_100040523 | 124 |
| 301 | 3300025898 | Ga0207692_10184078 | Ga0207692_101840782 | 124 |
| 302 | 3300025905 | Ga0207685_10065811 | Ga0207685_100658113 | 124 |
| 303 | 3300025906 | Ga0207699_10295055 | Ga0207699_102950552 | 124 |
| 304 | 3300025910 | Ga0207684_10002249 | Ga0207684_1000224915 | 124 |
| 305 | 3300025915 | Ga0207693_10341011 | Ga0207693_103410112 | 124 |
| 306 | 3300025916 | Ga0207663_11284262 | Ga0207663_112842621 | 124 |
| 307 | 3300025921 | Ga0207652_10152451 | Ga0207652_101524512 | 124 |
| 308 | 3300025928 | Ga0207700_10266440 | Ga0207700_102664402 | 124 |
| 309 | 3300025929 | Ga0207664_10232635 | Ga0207664_102326352 | 124 |
| 310 | 3300025929 | Ga0207664_10346896 | Ga0207664_103468963 | 124 |
| 311 | 3300025939 | Ga0207665_10483922 | Ga0207665_104839222 | 124 |
| 312 | 3300025939 | Ga0207665_10502899 | Ga0207665_105028992 | 124 |
| 313 | 3300025939 | Ga0207665_10862408 | Ga0207665_108624082 | 124 |
| 314 | 3300027512 | Ga0209179_1068031 | Ga0209179_10680311 | 124 |
| 315 | 3300027671 | Ga0209588_1000250 | Ga0209588_10002509 | 124 |
| 316 | 3300027671 | Ga0209588_1004462 | Ga0209588_10044623 | 124 |
| 317 | 3300027671 | Ga0209588_1021210 | Ga0209588_10212103 | 124 |
| 318 | 3300027671 | Ga0209588_1057948 | Ga0209588_10579482 | 124 |
| 319 | 3300027671 | Ga0209588_1111596 | Ga0209588_11115962 | 124 |
| 320 | 3300028016 | Ga0265354_1000011 | Ga0265354_100001117 | 124 |
| 321 | 3300028016 | Ga0265354_1003178 | Ga0265354_10031782 | 124 |
| 322 | 3300028023 | Ga0265357_1041702 | Ga0265357_10417021 | 124 |
| 323 | 3300030878 | Ga0265770_1000145 | Ga0265770_10001454 | 124 |
| 324 | 3300030879 | Ga0265765_1000262 | Ga0265765_10002622 | 124 |
| 325 | 3300031090 | Ga0265760_10006021 | Ga0265760_100060214 | 124 |
| 326 | 3300031090 | Ga0265760_10006910 | Ga0265760_100069104 | 124 |
| 327 | 3300031247 | Ga0265340_10199767 | Ga0265340_101997672 | 124 |
| 328 | 3300033547 | Ga0316212_1018585 | Ga0316212_10185852 | 124 |
| 329 | 3300035111 | Ga0373923_0224997 | Ga0373923_0224997_110_490 | 124 |
| 330 | 3300035118 | Ga0373954_0631368 | Ga0373954_0631368_83_463 | 124 |
| 331 | 3300035119 | Ga0373956_0094127 | Ga0373956_0094127_337_717 | 124 |
| 332 | 3300036401 | Ga0373937_0075281 | Ga0373937_0075281_702_1082 | 124 |
| 333 | 3300046455 | Ga0495603_0752564 | Ga0495603_0752564_30_410 | 124 |
| 334 | 3300046462 | Ga0495651_0437813 | Ga0495651_0437813_319_693 | 124 |
| 335 | 3300046472 | Ga0495580_0056519 | Ga0495580_0056519_1153_1527 | 124 |
| 336 | 3300046477 | Ga0495664_0413571 | Ga0495664_0413571_193_567 | 124 |
| 337 | 3300046514 | Ga0495618_0054979 | Ga0495618_0054979_1879_2253 | 124 |
| 338 | 3300046516 | Ga0495628_0070576 | Ga0495628_0070576_1941_2315 | 124 |
| 339 | 3300046516 | Ga0495628_0779199 | Ga0495628_0779199_46_420 | 124 |
| 340 | 3300046536 | Ga0495587_0008530 | Ga0495587_0008530_2876_3256 | 124 |
| 341 | 3300046536 | Ga0495587_0224850 | Ga0495587_0224850_32_406 | 124 |
| 342 | 3300046675 | Ga0495657_0265661 | Ga0495657_0265661_186_566 | 124 |
| 343 | 3300046675 | Ga0495657_0605983 | Ga0495657_0605983_205_585 | 124 |
| 344 | 3300046678 | Ga0495599_0552907 | Ga0495599_0552907_147_521 | 124 |
| 345 | 3300047317 | Ga0495604_0199228 | Ga0495604_0199228_843_1217 | 124 |
| 346 | 3300047317 | Ga0495604_0534523 | Ga0495604_0534523_208_588 | 124 |
| 347 | 3300047319 | Ga0495674_0069164 | Ga0495674_0069164_464_844 | 124 |
| 348 | 3300047322 | Ga0495680_0116203 | Ga0495680_0116203_884_1258 | 124 |
| 349 | 3300047471 | Ga0495684_0273593 | Ga0495684_0273593_147_527 | 124 |
| 350 | 3300048088 | Ga0495602_0353936 | Ga0495602_0353936_299_673 | 124 |
| 351 | 3300053077 | Ga0495601_0077645 | Ga0495601_0077645_70_444 | 124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar