F418637

General Info

Members Datasets Scaffolds Average Seq Length
351 118 702 282

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10011433|Ga0157372_100114333
Length 328
Sequence VTAIVRFGHLQTWPPDAVLAARVSRFGAASRFPRKENDMNRFQFKSRIFAQTPLARLWLAIAVCAFTSFAAANASAQLADNQTEGFGNNRLVTFTYLQNFDCVDQPLMDLDFNNKLAQSDPNEMQTPICQPVTEPTQDPAGANIKHTAHLYVFVPMFSVDNDQNPNDAMACPNGGRPGELCGPALGAALIKLFGFVPEAWKTHPAVSTQCPDPNNPVPGTCTMHASSVDLSVTLNALGKTGPPTMPVFVPTPNHDHVVDNSRVNTTPIWWEVRPVLIMDQSDWPAADGSSGITSSKAMDDAESAGRAIEVGSNFFLFFSSQMSSHGSH

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
66 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.92
Metatranscriptomes 21.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 26.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10011433 3300013307 Bacteria 9438
2 rootH1_10281574 3300003323 Unclassified 2181
3 Ga0058863_11265434 3300004799 Bacteria 1955
4 Ga0058863_11800759 3300004799 Bacteria 1054
5 Ga0058863_11801824 3300004799 Unclassified 1147
6 Ga0058863_11852757 3300004799 Bacteria 1474
7 Ga0058863_11923438 3300004799 Bacteria 2492
8 Ga0058861_10132900 3300004800 Unclassified 1971
9 Ga0058861_10567780 3300004800 Unclassified 1360
10 Ga0058861_11388766 3300004800 Unclassified 1151
11 Ga0058861_11567773 3300004800 Bacteria 1374
12 Ga0058861_11741686 3300004800 Bacteria 1679
13 Ga0058861_11801768 3300004800 Bacteria 973
14 Ga0058862_10027005 3300004803 Bacteria 1033
15 Ga0058862_10035513 3300004803 Unclassified 3048
16 Ga0058862_10037053 3300004803 Bacteria 2804
17 Ga0058862_10040528 3300004803 Unclassified 2830
18 Ga0058862_10238468 3300004803 Unclassified 1944
19 Ga0058862_12275231 3300004803 Bacteria 1901
20 Ga0058862_12291975 3300004803 Unclassified 1074
21 Ga0058862_12529459 3300004803 Unclassified 963
22 Ga0058862_12795798 3300004803 Bacteria 2739
23 Ga0058862_12805099 3300004803 Unclassified 1321
24 Ga0070658_10076838 3300005327 Bacteria 2739
25 Ga0070658_10137624 3300005327 Bacteria 2038
26 Ga0070683_100123448 3300005329 Bacteria 2447
27 Ga0070680_100083535 3300005336 Bacteria 2637
28 Ga0070680_100116464 3300005336 Bacteria 2228
29 Ga0070680_100203814 3300005336 Unclassified 1668
30 Ga0070680_100278980 3300005336 Bacteria 1416
31 Ga0070680_100344403 3300005336 Bacteria 1267
32 Ga0070660_100008645 3300005339 Bacteria 7131
33 Ga0070660_100028190 3300005339 Bacteria 4199
34 Ga0070660_100140580 3300005339 Unclassified 1937
35 Ga0070660_100258647 3300005339 Bacteria 1421
36 Ga0070691_10017299 3300005341 Bacteria 3317
37 Ga0070661_100043778 3300005344 Bacteria 3270
38 Ga0070659_100134061 3300005366 Bacteria 2014
39 Ga0070709_10104866 3300005434 Bacteria 1890
40 Ga0070714_100004455 3300005435 Bacteria 10549
41 Ga0070714_100016121 3300005435 Bacteria 6026
42 Ga0070714_100024671 3300005435 Bacteria 4955
43 Ga0070714_100028970 3300005435 Bacteria 4599
44 Ga0070714_100034222 3300005435 Bacteria 4254
45 Ga0070714_100042548 3300005435 Unclassified 3838
46 Ga0070714_100069792 3300005435 Bacteria 3036
47 Ga0070713_100003340 3300005436 Bacteria 10588
48 Ga0070713_100098320 3300005436 Bacteria 2531
49 Ga0070713_100176009 3300005436 Bacteria 1920
50 Ga0070713_100250822 3300005436 Unclassified 1614
51 Ga0070711_100032463 3300005439 Bacteria 3471
52 Ga0070711_100098912 3300005439 Unclassified 2119
53 Ga0070708_100043552 3300005445 Bacteria 3944
54 Ga0070708_100057906 3300005445 Bacteria 3452
55 Ga0070681_10000034 3300005458 Bacteria 98600
56 Ga0070681_10012953 3300005458 Bacteria 8281
57 Ga0070681_10121939 3300005458 Bacteria 2541
58 Ga0070681_10133113 3300005458 Unclassified 2418
59 Ga0070681_10198161 3300005458 Unclassified 1926
60 Ga0070681_10241691 3300005458 Bacteria 1719
61 Ga0070706_100010419 3300005467 Bacteria 8631
62 Ga0070706_100023125 3300005467 Bacteria 5723
63 Ga0070706_100063911 3300005467 Unclassified 3401
64 Ga0070706_100093158 3300005467 Bacteria 2795
65 Ga0070706_100165779 3300005467 Bacteria 2063
66 Ga0070706_100266751 3300005467 Unclassified 1598
67 Ga0070707_100010060 3300005468 Bacteria 8806
68 Ga0070707_100073813 3300005468 Bacteria 3289
69 Ga0070707_100373272 3300005468 Bacteria 1386
70 Ga0070707_100385498 3300005468 Unclassified 1361
71 Ga0070698_100030332 3300005471 Bacteria 5607
72 Ga0070698_100202220 3300005471 Bacteria 1922
73 Ga0070699_100024967 3300005518 Bacteria 5152
74 Ga0070699_100051933 3300005518 Bacteria 3549
75 Ga0070699_100081869 3300005518 Bacteria 2814
76 Ga0070679_100011342 3300005530 Bacteria 8493
77 Ga0070679_100062417 3300005530 Bacteria 3715
78 Ga0070679_100151331 3300005530 Bacteria 2297
79 Ga0070684_100189321 3300005535 Bacteria 1872
80 Ga0070684_100523547 3300005535 Bacteria 1099
81 Ga0070697_100010361 3300005536 Bacteria 7271
82 Ga0068853_100005955 3300005539 Bacteria 9633
83 Ga0068853_100008385 3300005539 Bacteria 8301
84 Ga0068853_100161448 3300005539 Bacteria 2023
85 Ga0068853_100312156 3300005539 Unclassified 1456
86 Ga0070696_100000163 3300005546 Bacteria 37742
87 Ga0070693_100061080 3300005547 Unclassified 2190
88 Ga0070665_100001969 3300005548 Bacteria 23093
89 Ga0068855_100000345 3300005563 Bacteria 57734
90 Ga0068855_100020157 3300005563 Bacteria 8007
91 Ga0068855_100052338 3300005563 Bacteria 4808
92 Ga0068855_100085422 3300005563 Bacteria 3651
93 Ga0068855_100249231 3300005563 Bacteria 1981
94 Ga0068855_100349079 3300005563 Bacteria 1630
95 Ga0068855_100400935 3300005563 Unclassified 1503
96 Ga0068855_100407302 3300005563 Bacteria 1489
97 Ga0068855_100811977 3300005563 Unclassified 993
98 Ga0070664_100037754 3300005564 Bacteria 4062
99 Ga0070664_100121661 3300005564 Unclassified 2286
100 Ga0068857_100003493 3300005577 Bacteria 13119
101 Ga0068857_100011482 3300005577 Bacteria 7704
102 Ga0068857_100063309 3300005577 Bacteria 3288
103 Ga0068857_100680769 3300005577 Bacteria 976
104 Ga0068854_100079621 3300005578 Bacteria 2416
105 Ga0068854_100094846 3300005578 Bacteria 2226
106 Ga0068856_100000578 3300005614 Bacteria 40018
107 Ga0068856_100005898 3300005614 Bacteria 12068
108 Ga0068856_100014125 3300005614 Bacteria 7722
109 Ga0068856_100055227 3300005614 Bacteria 3919
110 Ga0068856_100113332 3300005614 Unclassified 2710
111 Ga0068856_100191751 3300005614 Bacteria 2057
112 Ga0068856_100372095 3300005614 Bacteria 1448
113 Ga0068856_100532315 3300005614 Bacteria 1196
114 Ga0068856_100798077 3300005614 Unclassified 964
115 Ga0068852_100049137 3300005616 Bacteria 3607
116 Ga0068852_100187771 3300005616 Unclassified 1948
117 Ga0068851_10038071 3300005834 Bacteria 2412
118 Ga0068851_10100537 3300005834 Bacteria 1534
119 Ga0068858_100015697 3300005842 Bacteria 7125
120 Ga0070717_10000295 3300006028 Bacteria 33556
121 Ga0070717_10043822 3300006028 Bacteria 3653
122 Ga0070717_10063057 3300006028 Bacteria 3075
123 Ga0070717_10097070 3300006028 Bacteria 2496
124 Ga0097621_100000014 3300006237 Bacteria 100839
125 Ga0068871_100000552 3300006358 Bacteria 25519
126 Ga0075433_10001254 3300006852 Bacteria 18518
127 Ga0075434_100000921 3300006871 Bacteria 23590
128 Ga0075436_100245440 3300006914 Bacteria 1274
129 Ga0075435_100002754 3300007076 Bacteria 11737
130 Ga0105240_10001575 3300009093 Bacteria 38691
131 Ga0105240_10004465 3300009093 Bacteria 21309
132 Ga0105240_10006372 3300009093 Bacteria 17376
133 Ga0105240_10015178 3300009093 Bacteria 10485
134 Ga0105240_10037822 3300009093 Bacteria 6197
135 Ga0105240_10076582 3300009093 Bacteria 4123
136 Ga0105240_10101582 3300009093 Bacteria 3497
137 Ga0105240_10186006 3300009093 Unclassified 2447
138 Ga0105240_10242038 3300009093 Bacteria 2091
139 Ga0114129_10003272 3300009147 Bacteria 22737
140 Ga0105241_10027210 3300009174 Bacteria 4257
141 Ga0105237_10003456 3300009545 Bacteria 18756
142 Ga0105237_10107505 3300009545 Bacteria 2781
143 Ga0105237_10206173 3300009545 Unclassified 1966
144 Ga0105237_10225534 3300009545 Bacteria 1874
145 Ga0105238_10000099 3300009551 Bacteria 97818
146 Ga0105238_10003508 3300009551 Bacteria 15620
147 Ga0105238_10059339 3300009551 Bacteria 3833
148 Ga0105238_10079727 3300009551 Bacteria 3264
149 Ga0105238_10304881 3300009551 Bacteria 1577
150 Ga0105238_10305519 3300009551 Bacteria 1575
151 Ga0105238_10324556 3300009551 Unclassified 1526
152 Ga0105239_10047418 3300010375 Unclassified 4708
153 Ga0105239_10108376 3300010375 Bacteria 3078
154 Ga0154012_176890 3300013059 Bacteria 2029
155 Ga0157371_10023693 3300013102 Bacteria 4488
156 Ga0157371_10067328 3300013102 Bacteria 2535
157 Ga0157371_10134869 3300013102 Bacteria 1758
158 Ga0157370_10014397 3300013104 Bacteria 8086
159 Ga0157370_10031626 3300013104 Bacteria 5175
160 Ga0157370_10041466 3300013104 Bacteria 4440
161 Ga0157370_10131732 3300013104 Unclassified 2332
162 Ga0157369_10000042 3300013105 Bacteria 181784
163 Ga0157369_10007294 3300013105 Bacteria 12725
164 Ga0157369_10012472 3300013105 Bacteria 9644
165 Ga0157369_10014662 3300013105 Bacteria 8843
166 Ga0157369_10024906 3300013105 Bacteria 6649
167 Ga0157369_10083592 3300013105 Bacteria 3414
168 Ga0157369_10251356 3300013105 Bacteria 1845
169 Ga0157369_10312309 3300013105 Bacteria 1634
170 Ga0157374_10002804 3300013296 Bacteria 14633
171 Ga0157374_10028106 3300013296 Bacteria 5080
172 Ga0157378_10003318 3300013297 Bacteria 14315
173 Ga0157372_10000452 3300013307 Bacteria 45098
174 Ga0157372_10002149 3300013307 Bacteria 21435
175 Ga0157372_10003818 3300013307 Bacteria 16188
176 Ga0157372_10012299 3300013307 Bacteria 9120
177 Ga0157372_10042801 3300013307 Bacteria 5011
178 Ga0157372_10081973 3300013307 Bacteria 3652
179 Ga0157372_10110848 3300013307 Unclassified 3143
180 Ga0157372_10120658 3300013307 Unclassified 3011
181 Ga0157372_10141596 3300013307 Bacteria 2771
182 Ga0157372_10333726 3300013307 Bacteria 1766
183 Ga0157372_10403959 3300013307 Unclassified 1592
184 Ga0157372_10480042 3300013307 Unclassified 1449
185 Ga0163163_10484243 3300014325 Bacteria 1298
186 Ga0182008_10015099 3300014497 Unclassified 4037
187 Ga0182008_10061515 3300014497 Bacteria 1851
188 Ga0157376_10022500 3300014969 Unclassified 4917
189 Ga0182006_1039456 3300015261 Unclassified 1863
190 Ga0182007_10052352 3300015262 Unclassified 1345
191 Ga0197907_10352007 3300020069 Unclassified 2873
192 Ga0197907_10605526 3300020069 Archaea 1308
193 Ga0197907_10880853 3300020069 Bacteria 3494
194 Ga0197907_10931017 3300020069 Bacteria 1334
195 Ga0197907_10992046 3300020069 Bacteria 2665
196 Ga0197907_11270220 3300020069 Bacteria 1935
197 Ga0206356_10068678 3300020070 Unclassified 1006
198 Ga0206356_10169795 3300020070 Unclassified 1578
199 Ga0206356_10460491 3300020070 Bacteria 1130
200 Ga0206356_10492650 3300020070 Bacteria 1161
201 Ga0206356_10644080 3300020070 Bacteria 1138
202 Ga0206356_10691941 3300020070 Unclassified 1368
203 Ga0206356_10783463 3300020070 Unclassified 1514
204 Ga0206356_10993072 3300020070 Bacteria 1918
205 Ga0206356_11224990 3300020070 Bacteria 1449
206 Ga0206356_11230954 3300020070 Bacteria 1353
207 Ga0206356_11895060 3300020070 Unclassified 2522
208 Ga0206349_1038407 3300020075 Unclassified 1247
209 Ga0206349_1040746 3300020075 Bacteria 2935
210 Ga0206349_1849033 3300020075 Bacteria 1209
211 Ga0206355_1491969 3300020076 Bacteria 1266
212 Ga0206351_10028168 3300020077 Bacteria 1147
213 Ga0206351_10114049 3300020077 Bacteria 2375
214 Ga0206352_10214493 3300020078 Bacteria 4774
215 Ga0206352_10471738 3300020078 Unclassified 1878
216 Ga0206352_10679449 3300020078 Bacteria 1441
217 Ga0206352_10744286 3300020078 Bacteria 1974
218 Ga0206352_10914886 3300020078 Bacteria 945
219 Ga0206352_10988006 3300020078 Bacteria 1473
220 Ga0206352_11146833 3300020078 Unclassified 1523
221 Ga0206350_10145040 3300020080 Bacteria 2118
222 Ga0206350_10351149 3300020080 Bacteria 2646
223 Ga0206350_10384443 3300020080 Bacteria 1205
224 Ga0206350_10566642 3300020080 Bacteria 1507
225 Ga0206350_10731429 3300020080 Bacteria 996
226 Ga0206354_10294005 3300020081 Bacteria 2367
227 Ga0206354_10426872 3300020081 Bacteria 1359
228 Ga0206354_10934306 3300020081 Unclassified 1357
229 Ga0206354_11598845 3300020081 Bacteria 1181
230 Ga0206354_11601141 3300020081 Unclassified 899
231 Ga0206353_10502870 3300020082 Unclassified 1190
232 Ga0206353_11234468 3300020082 Bacteria 1116
233 Ga0206353_11467059 3300020082 Unclassified 1228
234 Ga0206353_11646503 3300020082 Unclassified 1064
235 Ga0154015_1311633 3300020610 Bacteria 2707
236 Ga0224712_10013805 3300022467 Unclassified 2584
237 Ga0224712_10069208 3300022467 Bacteria 1428
238 Ga0224712_10072786 3300022467 Bacteria 1400
239 Ga0224712_10091886 3300022467 Bacteria 1273
240 Ga0224712_10162729 3300022467 Bacteria 996
241 Ga0224712_10164374 3300022467 Unclassified 992
242 Ga0207656_10156255 3300025321 Unclassified 1083
243 Ga0207699_10180844 3300025906 Unclassified 1417
244 Ga0207699_10335578 3300025906 Unclassified 1064
245 Ga0207705_10046176 3300025909 Bacteria 3129
246 Ga0207684_10000773 3300025910 Bacteria 37123
247 Ga0207684_10005652 3300025910 Bacteria 11487
248 Ga0207684_10076266 3300025910 Bacteria 2849
249 Ga0207684_10128472 3300025910 Bacteria 2175
250 Ga0207684_10141952 3300025910 Bacteria 2065
251 Ga0207684_10259645 3300025910 Unclassified 1499
252 Ga0207654_10002214 3300025911 Bacteria 9974
253 Ga0207654_10152557 3300025911 Unclassified 1484
254 Ga0207707_10000155 3300025912 Bacteria 71477
255 Ga0207707_10052734 3300025912 Bacteria 3540
256 Ga0207707_10132938 3300025912 Unclassified 2176
257 Ga0207707_10138325 3300025912 Bacteria 2129
258 Ga0207707_10239577 3300025912 Unclassified 1577
259 Ga0207695_10000832 3300025913 Bacteria 57182
260 Ga0207695_10000958 3300025913 Bacteria 51395
261 Ga0207695_10007335 3300025913 Bacteria 14078
262 Ga0207695_10019475 3300025913 Bacteria 7815
263 Ga0207695_10129172 3300025913 Bacteria 2486
264 Ga0207695_10138125 3300025913 Bacteria 2389
265 Ga0207695_10159057 3300025913 Bacteria 2192
266 Ga0207671_10029690 3300025914 Unclassified 4081
267 Ga0207671_10142401 3300025914 Bacteria 1848
268 Ga0207663_10096071 3300025916 Unclassified 1978
269 Ga0207663_10148665 3300025916 Bacteria 1641
270 Ga0207660_10141741 3300025917 Bacteria 1838
271 Ga0207657_10011237 3300025919 Bacteria 8897
272 Ga0207657_10020112 3300025919 Bacteria 6317
273 Ga0207657_10062743 3300025919 Bacteria 3180
274 Ga0207649_10051175 3300025920 Bacteria 2557
275 Ga0207652_10081439 3300025921 Bacteria 2832
276 Ga0207646_10004106 3300025922 Bacteria 16042
277 Ga0207646_10016355 3300025922 Bacteria 6962
278 Ga0207646_10281123 3300025922 Bacteria 1504
279 Ga0207694_10002276 3300025924 Bacteria 15709
280 Ga0207694_10008786 3300025924 Bacteria 7621
281 Ga0207694_10105505 3300025924 Bacteria 2237
282 Ga0207694_10119776 3300025924 Unclassified 2100
283 Ga0207694_10326616 3300025924 Bacteria 1267
284 Ga0207700_10120098 3300025928 Unclassified 2130
285 Ga0207700_10141806 3300025928 Unclassified 1975
286 Ga0207700_10146068 3300025928 Bacteria 1949
287 Ga0207700_10244368 3300025928 Unclassified 1531
288 Ga0207664_10010770 3300025929 Bacteria 6467
289 Ga0207664_10025990 3300025929 Bacteria 4419
290 Ga0207664_10040308 3300025929 Bacteria 3631
291 Ga0207664_10042975 3300025929 Bacteria 3532
292 Ga0207664_10050013 3300025929 Bacteria 3294
293 Ga0207664_10106353 3300025929 Unclassified 2326
294 Ga0207664_10137967 3300025929 Bacteria 2060
295 Ga0207690_10181161 3300025932 Bacteria 1586
296 Ga0207661_10116319 3300025944 Bacteria 2270
297 Ga0207661_10154297 3300025944 Bacteria 1987
298 Ga0207661_10184264 3300025944 Unclassified 1826
299 Ga0207661_10305351 3300025944 Unclassified 1427
300 Ga0207667_10002055 3300025949 Bacteria 25228
301 Ga0207667_10030061 3300025949 Bacteria 5881
302 Ga0207667_10047575 3300025949 Bacteria 4540
303 Ga0207667_10072390 3300025949 Unclassified 3583
304 Ga0207667_10089779 3300025949 Bacteria 3175
305 Ga0207667_10135194 3300025949 Bacteria 2539
306 Ga0207667_10255754 3300025949 Unclassified 1791
307 Ga0207667_10283572 3300025949 Bacteria 1692
308 Ga0207640_10129412 3300025981 Unclassified 1822
309 Ga0207640_10203933 3300025981 Unclassified 1501
310 Ga0207703_10037704 3300026035 Unclassified 3852
311 Ga0207639_10005446 3300026041 Bacteria 8597
312 Ga0207639_10012051 3300026041 Bacteria 6015
313 Ga0207639_10078213 3300026041 Bacteria 2610
314 Ga0207639_10235362 3300026041 Unclassified 1590
315 Ga0207639_10421699 3300026041 Bacteria 1206
316 Ga0207639_10583736 3300026041 Unclassified 1029
317 Ga0207702_10000303 3300026078 Bacteria 56839
318 Ga0207702_10051936 3300026078 Unclassified 3467
319 Ga0207702_10057759 3300026078 Bacteria 3300
320 Ga0207702_10060700 3300026078 Bacteria 3223
321 Ga0207702_10159291 3300026078 Unclassified 2060
322 Ga0207702_10441309 3300026078 Unclassified 1261
323 Ga0207674_10003019 3300026116 Bacteria 20864
324 Ga0207674_10107284 3300026116 Bacteria 2770
325 Ga0207674_10116921 3300026116 Bacteria 2637
326 Ga0207698_10027286 3300026142 Bacteria 4052
327 Ga0207698_10127823 3300026142 Bacteria 2165
328 Ga0268266_10027617 3300028379 Bacteria 4824
329 Ga0373936_0095356 3300035113 Unclassified 1251
330 Ga0373954_0012776 3300035118 Bacteria 3739
331 Ga0373927_0025657 3300035695 Unclassified 3853
332 Ga0373933_0040201 3300035724 Bacteria 2754
333 Ga0373925_0007858 3300037068 Bacteria 7768
334 Ga0373925_0014252 3300037068 Bacteria 5751
335 Ga0395900_0186208 3300037418 Unclassified 2107
336 Ga0395900_0562663 3300037418 Unclassified 1084
337 Ga0395898_0037374 3300037466 Unclassified 4817
338 Ga0395898_0113230 3300037466 Unclassified 2600
339 Ga0395901_0352307 3300038443 Unclassified 1519
340 Ga0466963_0145894 3300044694 Bacteria 1642
341 Ga0466959_0176522 3300045049 Bacteria 1496
342 Ga0466967_0631223 3300045976 Bacteria 1059
343 Ga0495674_0032333 3300047319 Bacteria 4745
344 Ga0496109_0467401 3300048912 Unclassified 1191
345 Ga0496109_0726601 3300048912 Bacteria 931
346 Ga0496112_0010582 3300048915 Bacteria 8378
347 nmdc:mga05p37_3942_c1 3300050507 Bacteria 17384
348 nmdc:mga0n895_43801_c1 3300050512 Bacteria 4363
349 nmdc:mga0rr50_2415_c1 3300050513 Bacteria 10516
350 nmdc:mga08x19_228865_c1 3300050514 Bacteria 1279
351 Ga0587071_009869 3300060344 Unclassified 1581
352 Ga0157372_10011433
353 rootH1_10281574
354 Ga0058863_11265434
355 Ga0058863_11800759
356 Ga0058863_11801824
357 Ga0058863_11852757
358 Ga0058863_11923438
359 Ga0058861_10132900
360 Ga0058861_10567780
361 Ga0058861_11388766
362 Ga0058861_11567773
363 Ga0058861_11741686
364 Ga0058861_11801768
365 Ga0058862_10027005
366 Ga0058862_10035513
367 Ga0058862_10037053
368 Ga0058862_10040528
369 Ga0058862_10238468
370 Ga0058862_12275231
371 Ga0058862_12291975
372 Ga0058862_12529459
373 Ga0058862_12795798
374 Ga0058862_12805099
375 Ga0070658_10076838
376 Ga0070658_10137624
377 Ga0070683_100123448
378 Ga0070680_100083535
379 Ga0070680_100116464
380 Ga0070680_100203814
381 Ga0070680_100278980
382 Ga0070680_100344403
383 Ga0070660_100008645
384 Ga0070660_100028190
385 Ga0070660_100140580
386 Ga0070660_100258647
387 Ga0070691_10017299
388 Ga0070661_100043778
389 Ga0070659_100134061
390 Ga0070709_10104866
391 Ga0070714_100004455
392 Ga0070714_100016121
393 Ga0070714_100024671
394 Ga0070714_100028970
395 Ga0070714_100034222
396 Ga0070714_100042548
397 Ga0070714_100069792
398 Ga0070713_100003340
399 Ga0070713_100098320
400 Ga0070713_100176009
401 Ga0070713_100250822
402 Ga0070711_100032463
403 Ga0070711_100098912
404 Ga0070708_100043552
405 Ga0070708_100057906
406 Ga0070681_10000034
407 Ga0070681_10012953
408 Ga0070681_10121939
409 Ga0070681_10133113
410 Ga0070681_10198161
411 Ga0070681_10241691
412 Ga0070706_100010419
413 Ga0070706_100023125
414 Ga0070706_100063911
415 Ga0070706_100093158
416 Ga0070706_100165779
417 Ga0070706_100266751
418 Ga0070707_100010060
419 Ga0070707_100073813
420 Ga0070707_100373272
421 Ga0070707_100385498
422 Ga0070698_100030332
423 Ga0070698_100202220
424 Ga0070699_100024967
425 Ga0070699_100051933
426 Ga0070699_100081869
427 Ga0070679_100011342
428 Ga0070679_100062417
429 Ga0070679_100151331
430 Ga0070684_100189321
431 Ga0070684_100523547
432 Ga0070697_100010361
433 Ga0068853_100005955
434 Ga0068853_100008385
435 Ga0068853_100161448
436 Ga0068853_100312156
437 Ga0070696_100000163
438 Ga0070693_100061080
439 Ga0070665_100001969
440 Ga0068855_100000345
441 Ga0068855_100020157
442 Ga0068855_100052338
443 Ga0068855_100085422
444 Ga0068855_100249231
445 Ga0068855_100349079
446 Ga0068855_100400935
447 Ga0068855_100407302
448 Ga0068855_100811977
449 Ga0070664_100037754
450 Ga0070664_100121661
451 Ga0068857_100003493
452 Ga0068857_100011482
453 Ga0068857_100063309
454 Ga0068857_100680769
455 Ga0068854_100079621
456 Ga0068854_100094846
457 Ga0068856_100000578
458 Ga0068856_100005898
459 Ga0068856_100014125
460 Ga0068856_100055227
461 Ga0068856_100113332
462 Ga0068856_100191751
463 Ga0068856_100372095
464 Ga0068856_100532315
465 Ga0068856_100798077
466 Ga0068852_100049137
467 Ga0068852_100187771
468 Ga0068851_10038071
469 Ga0068851_10100537
470 Ga0068858_100015697
471 Ga0070717_10000295
472 Ga0070717_10043822
473 Ga0070717_10063057
474 Ga0070717_10097070
475 Ga0097621_100000014
476 Ga0068871_100000552
477 Ga0075433_10001254
478 Ga0075434_100000921
479 Ga0075436_100245440
480 Ga0075435_100002754
481 Ga0105240_10001575
482 Ga0105240_10004465
483 Ga0105240_10006372
484 Ga0105240_10015178
485 Ga0105240_10037822
486 Ga0105240_10076582
487 Ga0105240_10101582
488 Ga0105240_10186006
489 Ga0105240_10242038
490 Ga0114129_10003272
491 Ga0105241_10027210
492 Ga0105237_10003456
493 Ga0105237_10107505
494 Ga0105237_10206173
495 Ga0105237_10225534
496 Ga0105238_10000099
497 Ga0105238_10003508
498 Ga0105238_10059339
499 Ga0105238_10079727
500 Ga0105238_10304881
501 Ga0105238_10305519
502 Ga0105238_10324556
503 Ga0105239_10047418
504 Ga0105239_10108376
505 Ga0154012_176890
506 Ga0157371_10023693
507 Ga0157371_10067328
508 Ga0157371_10134869
509 Ga0157370_10014397
510 Ga0157370_10031626
511 Ga0157370_10041466
512 Ga0157370_10131732
513 Ga0157369_10000042
514 Ga0157369_10007294
515 Ga0157369_10012472
516 Ga0157369_10014662
517 Ga0157369_10024906
518 Ga0157369_10083592
519 Ga0157369_10251356
520 Ga0157369_10312309
521 Ga0157374_10002804
522 Ga0157374_10028106
523 Ga0157378_10003318
524 Ga0157372_10000452
525 Ga0157372_10002149
526 Ga0157372_10003818
527 Ga0157372_10012299
528 Ga0157372_10042801
529 Ga0157372_10081973
530 Ga0157372_10110848
531 Ga0157372_10120658
532 Ga0157372_10141596
533 Ga0157372_10333726
534 Ga0157372_10403959
535 Ga0157372_10480042
536 Ga0163163_10484243
537 Ga0182008_10015099
538 Ga0182008_10061515
539 Ga0157376_10022500
540 Ga0182006_1039456
541 Ga0182007_10052352
542 Ga0197907_10352007
543 Ga0197907_10605526
544 Ga0197907_10880853
545 Ga0197907_10931017
546 Ga0197907_10992046
547 Ga0197907_11270220
548 Ga0206356_10068678
549 Ga0206356_10169795
550 Ga0206356_10460491
551 Ga0206356_10492650
552 Ga0206356_10644080
553 Ga0206356_10691941
554 Ga0206356_10783463
555 Ga0206356_10993072
556 Ga0206356_11224990
557 Ga0206356_11230954
558 Ga0206356_11895060
559 Ga0206349_1038407
560 Ga0206349_1040746
561 Ga0206349_1849033
562 Ga0206355_1491969
563 Ga0206351_10028168
564 Ga0206351_10114049
565 Ga0206352_10214493
566 Ga0206352_10471738
567 Ga0206352_10679449
568 Ga0206352_10744286
569 Ga0206352_10914886
570 Ga0206352_10988006
571 Ga0206352_11146833
572 Ga0206350_10145040
573 Ga0206350_10351149
574 Ga0206350_10384443
575 Ga0206350_10566642
576 Ga0206350_10731429
577 Ga0206354_10294005
578 Ga0206354_10426872
579 Ga0206354_10934306
580 Ga0206354_11598845
581 Ga0206354_11601141
582 Ga0206353_10502870
583 Ga0206353_11234468
584 Ga0206353_11467059
585 Ga0206353_11646503
586 Ga0154015_1311633
587 Ga0224712_10013805
588 Ga0224712_10069208
589 Ga0224712_10072786
590 Ga0224712_10091886
591 Ga0224712_10162729
592 Ga0224712_10164374
593 Ga0207656_10156255
594 Ga0207699_10180844
595 Ga0207699_10335578
596 Ga0207705_10046176
597 Ga0207684_10000773
598 Ga0207684_10005652
599 Ga0207684_10076266
600 Ga0207684_10128472
601 Ga0207684_10141952
602 Ga0207684_10259645
603 Ga0207654_10002214
604 Ga0207654_10152557
605 Ga0207707_10000155
606 Ga0207707_10052734
607 Ga0207707_10132938
608 Ga0207707_10138325
609 Ga0207707_10239577
610 Ga0207695_10000832
611 Ga0207695_10000958
612 Ga0207695_10007335
613 Ga0207695_10019475
614 Ga0207695_10129172
615 Ga0207695_10138125
616 Ga0207695_10159057
617 Ga0207671_10029690
618 Ga0207671_10142401
619 Ga0207663_10096071
620 Ga0207663_10148665
621 Ga0207660_10141741
622 Ga0207657_10011237
623 Ga0207657_10020112
624 Ga0207657_10062743
625 Ga0207649_10051175
626 Ga0207652_10081439
627 Ga0207646_10004106
628 Ga0207646_10016355
629 Ga0207646_10281123
630 Ga0207694_10002276
631 Ga0207694_10008786
632 Ga0207694_10105505
633 Ga0207694_10119776
634 Ga0207694_10326616
635 Ga0207700_10120098
636 Ga0207700_10141806
637 Ga0207700_10146068
638 Ga0207700_10244368
639 Ga0207664_10010770
640 Ga0207664_10025990
641 Ga0207664_10040308
642 Ga0207664_10042975
643 Ga0207664_10050013
644 Ga0207664_10106353
645 Ga0207664_10137967
646 Ga0207690_10181161
647 Ga0207661_10116319
648 Ga0207661_10154297
649 Ga0207661_10184264
650 Ga0207661_10305351
651 Ga0207667_10002055
652 Ga0207667_10030061
653 Ga0207667_10047575
654 Ga0207667_10072390
655 Ga0207667_10089779
656 Ga0207667_10135194
657 Ga0207667_10255754
658 Ga0207667_10283572
659 Ga0207640_10129412
660 Ga0207640_10203933
661 Ga0207703_10037704
662 Ga0207639_10005446
663 Ga0207639_10012051
664 Ga0207639_10078213
665 Ga0207639_10235362
666 Ga0207639_10421699
667 Ga0207639_10583736
668 Ga0207702_10000303
669 Ga0207702_10051936
670 Ga0207702_10057759
671 Ga0207702_10060700
672 Ga0207702_10159291
673 Ga0207702_10441309
674 Ga0207674_10003019
675 Ga0207674_10107284
676 Ga0207674_10116921
677 Ga0207698_10027286
678 Ga0207698_10127823
679 Ga0268266_10027617
680 Ga0373936_0095356
681 Ga0373954_0012776
682 Ga0373927_0025657
683 Ga0373933_0040201
684 Ga0373925_0007858
685 Ga0373925_0014252
686 Ga0395900_0186208
687 Ga0395900_0562663
688 Ga0395898_0037374
689 Ga0395898_0113230
690 Ga0395901_0352307
691 Ga0466963_0145894
692 Ga0466959_0176522
693 Ga0466967_0631223
694 Ga0495674_0032333
695 Ga0496109_0467401
696 Ga0496109_0726601
697 Ga0496112_0010582
698 nmdc:mga05p37_3942_c1
699 nmdc:mga0n895_43801_c1
700 nmdc:mga0rr50_2415_c1
701 nmdc:mga08x19_228865_c1
702 Ga0587071_009869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3akj-assembly1.cif.gz_A crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.5052 23 54
6ewv-assembly1.cif.gz_A solution structure of docking domain complex of rxp nrps: kj12c ndd - kj12b cdd 0.4659 28 45
1eue-assembly2.cif.gz_B rat outer mitochondrial membrane cytochrome b5 0.4203 18 39
6gjh-assembly1.cif.gz_A human hsp27 (hspb1) alpha-crystallin domain in complex with a peptide mimic of its phosphorylatable n-terminal region 0.3825 21 49
7o3h-assembly1.cif.gz_P murine ciii2 focus-refined from supercomplex ciciii2 0.3781 2 53
ID Description Score Start End Superfamily
af_Q9LU90_53_414_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6354 27 45 2.120.10.30
af_A0A1D6HCR7_100_169_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6027 25 55 3.30.200.20
af_Q54GE1_34_326_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.5742 25 41 3.20.20.80
af_O62280_7_321_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5712 28 41 1.20.1070.10
af_Q1L8U8_722_786_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.5351 24 45 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A2V8VVU7-F1-model_v4 Uncharacterized protein 0.8598 78 272
AF-A0A2V8X4Y4-F1-model_v4 Uncharacterized protein 0.8595 78 272
AF-A0A2V9BRS2-F1-model_v4 Uncharacterized protein 0.8139 20 272
AF-A0A522RZR6-F1-model_v4 Uncharacterized protein 0.8072 24 272
AF-A0A368KGB1-F1-model_v4 Uncharacterized protein 0.7997 24 272

Map