F418532

General Info

Members Datasets Scaffolds Average Seq Length
351 200 702 186

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10370978|Ga0070709_103709782
Length 210
Sequence VAAARVVSLAAIDVPAHEVDPRLTRLEGELKRLEAEYNMYFAGRLPKPPWETRARVDTLIKTIERGHIQNFGDRFRLSTLQARFAAFVDLWDRGLRAREEGRAGPFAHLKNENQPAEARPPQDRVLHVAKFRDPAAEMDKLHELYDSLADARRQIGHDSVPFHKFAELVKTQVEKLQASGSTEVAFRVAMKDGKVDFTARALHDAVDSEE

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.56
Rhizosphere 97.44
Stem 0
Stem Tuber 0
Unclassified 14.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10370978 3300005434 Bacteria 1062
2 JGI25406J46586_10000551 3300003203 Bacteria 17619
3 JGI25406J46586_10001000 3300003203 Bacteria 13255
4 Ga0065712_10069073 3300005290 Bacteria 8082
5 Ga0065715_10093477 3300005293 Bacteria 4665
6 Ga0070658_10030579 3300005327 Bacteria 4326
7 Ga0070676_10017881 3300005328 Bacteria 3925
8 Ga0070676_10040035 3300005328 Bacteria 2713
9 Ga0070676_10048145 3300005328 Bacteria 2492
10 Ga0070676_10163911 3300005328 Bacteria 1433
11 Ga0070690_100035508 3300005330 Bacteria 3128
12 Ga0070690_100554957 3300005330 Bacteria 866
13 Ga0070670_100028207 3300005331 Bacteria 4831
14 Ga0070680_100030214 3300005336 Bacteria 4353
15 Ga0068868_100329580 3300005338 Bacteria 1303
16 Ga0070660_100002101 3300005339 Bacteria 13741
17 Ga0070660_100255727 3300005339 Unclassified 1429
18 Ga0070689_100071210 3300005340 Bacteria 2715
19 Ga0070691_10000787 3300005341 Bacteria 12611
20 Ga0070687_100448095 3300005343 Unclassified 858
21 Ga0070692_10376578 3300005345 Unclassified 889
22 Ga0070668_100053256 3300005347 Bacteria 3120
23 Ga0070669_100033715 3300005353 Bacteria 3705
24 Ga0070675_100081037 3300005354 Bacteria 2706
25 Ga0070675_100575344 3300005354 Bacteria 1020
26 Ga0070671_100251631 3300005355 Bacteria 1501
27 Ga0070671_100322256 3300005355 Bacteria 1317
28 Ga0070671_100991489 3300005355 Unclassified 736
29 Ga0070674_100072979 3300005356 Bacteria 2432
30 Ga0070673_100025649 3300005364 Bacteria 4342
31 Ga0070673_100201728 3300005364 Bacteria 1713
32 Ga0070673_100387168 3300005364 Bacteria 1248
33 Ga0070688_100020989 3300005365 Bacteria 3808
34 Ga0070688_100091227 3300005365 Bacteria 1991
35 Ga0070659_100147586 3300005366 Bacteria 1917
36 Ga0070659_100970741 3300005366 Unclassified 745
37 Ga0070667_100212519 3300005367 Bacteria 1720
38 Ga0070667_100231692 3300005367 Bacteria 1647
39 Ga0070714_100054422 3300005435 Bacteria 3419
40 Ga0070713_100042574 3300005436 Bacteria 3707
41 Ga0070701_10013051 3300005438 Bacteria 3769
42 Ga0070701_10110556 3300005438 Bacteria 1535
43 Ga0070705_100025770 3300005440 Bacteria 3192
44 Ga0070705_100311282 3300005440 Bacteria 1133
45 Ga0070700_100001858 3300005441 Bacteria 10658
46 Ga0070700_100699753 3300005441 Bacteria 806
47 Ga0070694_100027075 3300005444 Bacteria 3721
48 Ga0070694_100031967 3300005444 Bacteria 3453
49 Ga0070694_100249998 3300005444 Bacteria 1341
50 Ga0070694_100522109 3300005444 Bacteria 947
51 Ga0070708_100083081 3300005445 Bacteria 2902
52 Ga0070708_100270679 3300005445 Bacteria 1598
53 Ga0070662_100162050 3300005457 Bacteria 1750
54 Ga0070681_10074374 3300005458 Bacteria 3359
55 Ga0070681_11214399 3300005458 Unclassified 676
56 Ga0070685_10009015 3300005466 Bacteria 5146
57 Ga0070685_10018157 3300005466 Bacteria 3778
58 Ga0070706_100519239 3300005467 Unclassified 1108
59 Ga0070707_100055965 3300005468 Bacteria 3782
60 Ga0070707_101323299 3300005468 Unclassified 687
61 Ga0070698_100160085 3300005471 Bacteria 2195
62 Ga0070698_100669876 3300005471 Bacteria 979
63 Ga0070699_100023474 3300005518 Bacteria 5313
64 Ga0070699_100410663 3300005518 Bacteria 1225
65 Ga0070679_100240794 3300005530 Bacteria 1766
66 Ga0070697_100198069 3300005536 Bacteria 1707
67 Ga0070672_100033349 3300005543 Bacteria 3899
68 Ga0070672_100065656 3300005543 Bacteria 2871
69 Ga0070686_100040414 3300005544 Bacteria 2909
70 Ga0070686_100534652 3300005544 Bacteria 915
71 Ga0070695_100041941 3300005545 Bacteria 2903
72 Ga0070695_100055231 3300005545 Bacteria 2559
73 Ga0070695_100202430 3300005545 Bacteria 1420
74 Ga0070696_100011102 3300005546 Bacteria 6028
75 Ga0070696_100011678 3300005546 Bacteria 5885
76 Ga0070696_100253019 3300005546 Bacteria 1333
77 Ga0070704_100018572 3300005549 Bacteria 4449
78 Ga0070704_100027670 3300005549 Bacteria 3763
79 Ga0068855_100051946 3300005563 Bacteria 4827
80 Ga0068855_100378490 3300005563 Bacteria 1555
81 Ga0068855_100764222 3300005563 Bacteria 1029
82 Ga0068855_100945936 3300005563 Bacteria 908
83 Ga0070664_100046165 3300005564 Bacteria 3679
84 Ga0068857_100812958 3300005577 Unclassified 893
85 Ga0068857_101287674 3300005577 Unclassified 709
86 Ga0068854_100546431 3300005578 Bacteria 982
87 Ga0068856_100487844 3300005614 Bacteria 1253
88 Ga0068856_100867133 3300005614 Bacteria 922
89 Ga0070702_100019393 3300005615 Bacteria 3546
90 Ga0068859_100006510 3300005617 Bacteria 11857
91 Ga0068859_100155928 3300005617 Bacteria 2361
92 Ga0068859_100439562 3300005617 Bacteria 1401
93 Ga0068859_100632400 3300005617 Bacteria 1163
94 Ga0068864_100002917 3300005618 Bacteria 14142
95 Ga0068864_100132267 3300005618 Bacteria 2243
96 Ga0068864_100175596 3300005618 Bacteria 1955
97 Ga0068864_100400758 3300005618 Bacteria 1304
98 Ga0068866_10790935 3300005718 Bacteria 659
99 Ga0068861_100002363 3300005719 Bacteria 12279
100 Ga0068861_100076322 3300005719 Bacteria 2611
101 Ga0068861_100243206 3300005719 Bacteria 1532
102 Ga0068861_100294637 3300005719 Bacteria 1402
103 Ga0068861_100712241 3300005719 Bacteria 934
104 Ga0068870_10041920 3300005840 Bacteria 2381
105 Ga0068863_100220421 3300005841 Bacteria 1827
106 Ga0068863_100543193 3300005841 Bacteria 1147
107 Ga0068858_100050841 3300005842 Bacteria 3836
108 Ga0068858_100195961 3300005842 Bacteria 1909
109 Ga0068858_100233532 3300005842 Unclassified 1744
110 Ga0068860_100361253 3300005843 Bacteria 1431
111 Ga0068862_100141549 3300005844 Bacteria 2135
112 Ga0081539_10000074 3300005985 Bacteria 231435
113 Ga0081539_10001302 3300005985 Bacteria 43747
114 Ga0081539_10011203 3300005985 Bacteria 7137
115 Ga0075432_10110698 3300006058 Unclassified 1023
116 Ga0070715_10031325 3300006163 Bacteria 2158
117 Ga0070716_100374055 3300006173 Unclassified 1016
118 Ga0070712_100211721 3300006175 Unclassified 1529
119 Ga0097621_100438857 3300006237 Unclassified 1174
120 Ga0068871_100008309 3300006358 Bacteria 7459
121 Ga0075428_101300649 3300006844 Unclassified 765
122 Ga0075430_100314489 3300006846 Bacteria 1295
123 Ga0075430_100711413 3300006846 Bacteria 828
124 Ga0075433_10103103 3300006852 Bacteria 2527
125 Ga0075433_10133411 3300006852 Bacteria 2207
126 Ga0075433_10141837 3300006852 Bacteria 2135
127 Ga0075433_10268295 3300006852 Bacteria 1513
128 Ga0075433_10550994 3300006852 Bacteria 1014
129 Ga0075433_10715444 3300006852 Bacteria 877
130 Ga0075434_100004316 3300006871 Bacteria 12781
131 Ga0075434_100117533 3300006871 Bacteria 2672
132 Ga0075434_100382812 3300006871 Bacteria 1428
133 Ga0075434_100561688 3300006871 Bacteria 1161
134 Ga0075434_101494603 3300006871 Unclassified 685
135 Ga0075429_100243330 3300006880 Bacteria 1575
136 Ga0068865_100287676 3300006881 Bacteria 1311
137 Ga0075436_100007630 3300006914 Bacteria 7391
138 Ga0075436_100013832 3300006914 Bacteria 5526
139 Ga0075436_100051461 3300006914 Bacteria 2842
140 Ga0097620_100006510 3300006931 Bacteria 11857
141 Ga0097620_100155921 3300006931 Bacteria 2361
142 Ga0097620_100439545 3300006931 Bacteria 1401
143 Ga0097620_100632403 3300006931 Bacteria 1163
144 Ga0075435_100003488 3300007076 Bacteria 10668
145 Ga0075435_100049725 3300007076 Bacteria 3372
146 Ga0075435_100110177 3300007076 Bacteria 2289
147 Ga0075435_100824923 3300007076 Bacteria 808
148 Ga0105240_10567672 3300009093 Bacteria 1253
149 Ga0111539_10041326 3300009094 Bacteria 5545
150 Ga0111539_10048897 3300009094 Bacteria 5048
151 Ga0114129_10061482 3300009147 Bacteria 5248
152 Ga0114129_10138144 3300009147 Bacteria 3343
153 Ga0114129_10724998 3300009147 Bacteria 1275
154 Ga0114129_11078193 3300009147 Bacteria 1007
155 Ga0105243_10012473 3300009148 Bacteria 6425
156 Ga0105243_10155163 3300009148 Bacteria 1968
157 Ga0105243_11245465 3300009148 Unclassified 759
158 Ga0105242_10078445 3300009176 Bacteria 2757
159 Ga0105242_10208747 3300009176 Bacteria 1739
160 Ga0105242_10273868 3300009176 Unclassified 1530
161 Ga0105242_11555268 3300009176 Bacteria 694
162 Ga0105248_10031288 3300009177 Bacteria 5948
163 Ga0105248_10795206 3300009177 Unclassified 1067
164 Ga0105248_10817917 3300009177 Bacteria 1051
165 Ga0105237_10472996 3300009545 Bacteria 1259
166 Ga0105238_10460558 3300009551 Bacteria 1269
167 Ga0105249_10265432 3300009553 Bacteria 1708
168 Ga0105249_10746981 3300009553 Bacteria 1040
169 Ga0157374_11013922 3300013296 Bacteria 849
170 Ga0157375_10439794 3300013308 Bacteria 1470
171 Ga0157375_10525086 3300013308 Bacteria 1347
172 Ga0157375_11210137 3300013308 Unclassified 886
173 Ga0163163_10011097 3300014325 Bacteria 8155
174 Ga0163163_10020713 3300014325 Bacteria 6198
175 Ga0157380_10263391 3300014326 Bacteria 1567
176 Ga0157380_10529248 3300014326 Unclassified 1151
177 Ga0157380_11162185 3300014326 Unclassified 814
178 Ga0157380_11764925 3300014326 Bacteria 677
179 Ga0157377_10039352 3300014745 Bacteria 2615
180 Ga0157377_10293437 3300014745 Bacteria 1070
181 Ga0157376_10035298 3300014969 Bacteria 4044
182 Ga0157376_10233608 3300014969 Bacteria 1709
183 Ga0163161_10465425 3300017792 Bacteria 1024
184 Ga0207697_10132144 3300025315 Bacteria 1079
185 Ga0207682_10241299 3300025893 Bacteria 840
186 Ga0207685_10079957 3300025905 Unclassified 1350
187 Ga0207685_10211098 3300025905 Bacteria 918
188 Ga0207645_10005730 3300025907 Bacteria 8964
189 Ga0207645_10170295 3300025907 Bacteria 1427
190 Ga0207645_10235488 3300025907 Bacteria 1209
191 Ga0207643_10051746 3300025908 Bacteria 2332
192 Ga0207705_10119737 3300025909 Bacteria 1952
193 Ga0207684_10404476 3300025910 Unclassified 1173
194 Ga0207684_10823415 3300025910 Unclassified 784
195 Ga0207707_10029087 3300025912 Bacteria 4828
196 Ga0207693_10277805 3300025915 Bacteria 1312
197 Ga0207660_10277876 3300025917 Bacteria 1328
198 Ga0207662_10025223 3300025918 Bacteria 3424
199 Ga0207662_10286101 3300025918 Bacteria 1092
200 Ga0207657_10008743 3300025919 Bacteria 10248
201 Ga0207652_10340007 3300025921 Bacteria 1355
202 Ga0207646_10067929 3300025922 Bacteria 3183
203 Ga0207681_10021743 3300025923 Bacteria 4082
204 Ga0207650_10050837 3300025925 Bacteria 3066
205 Ga0207659_10017748 3300025926 Bacteria 4652
206 Ga0207687_10220733 3300025927 Bacteria 1492
207 Ga0207700_10153323 3300025928 Bacteria 1906
208 Ga0207644_10169598 3300025931 Unclassified 1703
209 Ga0207644_10332336 3300025931 Bacteria 1231
210 Ga0207690_10076082 3300025932 Bacteria 2330
211 Ga0207709_10015026 3300025935 Bacteria 4287
212 Ga0207669_10093687 3300025937 Bacteria 1963
213 Ga0207704_10260638 3300025938 Bacteria 1307
214 Ga0207704_10561718 3300025938 Unclassified 929
215 Ga0207665_10100652 3300025939 Bacteria 2017
216 Ga0207665_10262218 3300025939 Bacteria 1280
217 Ga0207691_10048207 3300025940 Bacteria 3907
218 Ga0207689_10116984 3300025942 Bacteria 2192
219 Ga0207679_10174368 3300025945 Bacteria 1773
220 Ga0207651_10230268 3300025960 Bacteria 1504
221 Ga0207712_10245185 3300025961 Bacteria 1445
222 Ga0207668_10072656 3300025972 Bacteria 2462
223 Ga0207640_10055976 3300025981 Bacteria 2586
224 Ga0207640_10281351 3300025981 Unclassified 1307
225 Ga0207658_10372586 3300025986 Bacteria 1249
226 Ga0207658_10461617 3300025986 Unclassified 1126
227 Ga0207677_10145475 3300026023 Bacteria 1821
228 Ga0207703_10298697 3300026035 Unclassified 1468
229 Ga0207708_10051120 3300026075 Bacteria 3146
230 Ga0207708_10081942 3300026075 Bacteria 2480
231 Ga0207702_10702339 3300026078 Bacteria 997
232 Ga0207641_10117730 3300026088 Bacteria 2366
233 Ga0207648_10006132 3300026089 Bacteria 11984
234 Ga0207676_10101258 3300026095 Bacteria 2388
235 Ga0207676_10188605 3300026095 Bacteria 1812
236 Ga0207676_10367317 3300026095 Bacteria 1336
237 Ga0207674_10598246 3300026116 Bacteria 1065
238 Ga0207675_100000149 3300026118 Bacteria 61117
239 Ga0207675_100038004 3300026118 Bacteria 4492
240 Ga0207675_100099810 3300026118 Bacteria 2734
241 Ga0207675_100218195 3300026118 Bacteria 1837
242 Ga0207675_100629288 3300026118 Bacteria 1078
243 Ga0207675_100923535 3300026118 Unclassified 889
244 Ga0207698_10480994 3300026142 Bacteria 1204
245 Ga0207428_10003265 3300027907 Bacteria 15801
246 Ga0268265_10232718 3300028380 Bacteria 1620
247 Ga0268265_10553628 3300028380 Unclassified 1092
248 Ga0316182_1375263 3300030745 Unclassified 725
249 Ga0307408_100355504 3300031548 Bacteria 1244
250 Ga0307408_100900862 3300031548 Bacteria 810
251 Ga0307405_10298278 3300031731 Bacteria 1221
252 Ga0307413_10017898 3300031824 Bacteria 3703
253 Ga0307413_10800522 3300031824 Bacteria 792
254 Ga0307410_10130907 3300031852 Bacteria 1843
255 Ga0307406_10016500 3300031901 Bacteria 4293
256 Ga0307407_10058153 3300031903 Bacteria 2246
257 Ga0307407_10409042 3300031903 Bacteria 975
258 Ga0307409_100144238 3300031995 Bacteria 2056
259 Ga0307409_101485380 3300031995 Unclassified 705
260 Ga0307416_100097083 3300032002 Bacteria 2550
261 Ga0307416_101211862 3300032002 Unclassified 860
262 Ga0307416_102220459 3300032002 Bacteria 650
263 Ga0307411_10004141 3300032005 Bacteria 6887
264 Ga0307411_10157019 3300032005 Unclassified 1698
265 Ga0307411_10304342 3300032005 Bacteria 1280
266 Ga0307411_10779087 3300032005 Bacteria 840
267 Ga0307415_100950493 3300032126 Bacteria 795
268 Ga0373926_0080298 3300035083 Unclassified 1206
269 Ga0373953_0105289 3300035117 Bacteria 1190
270 Ga0373954_0209090 3300035118 Bacteria 959
271 Ga0373943_0769949 3300035170 Bacteria 572
272 Ga0373955_0048712 3300035172 Bacteria 2299
273 Ga0373935_0298428 3300035692 Unclassified 1138
274 Ga0373935_0736137 3300035692 Bacteria 726
275 Ga0373947_0109465 3300035725 Bacteria 1744
276 Ga0373937_0036892 3300036401 Bacteria 4454
277 Ga0373937_1045498 3300036401 Unclassified 765
278 Ga0373925_0753393 3300037068 Unclassified 803
279 Ga0373925_0797473 3300037068 Unclassified 779
280 Ga0395905_1310683 3300037471 Unclassified 628
281 Ga0436362_0757221 3300039453 Bacteria 1468
282 Ga0466963_0626144 3300044694 Bacteria 760
283 Ga0466967_2202359 3300045976 Bacteria 547
284 Ga0495592_0299430 3300046454 Bacteria 1046
285 Ga0495629_0439810 3300046459 Bacteria 884
286 Ga0495629_0692416 3300046459 Bacteria 677
287 Ga0495639_0221345 3300046475 Bacteria 931
288 Ga0495628_0154379 3300046516 Bacteria 1747
289 Ga0495628_0196819 3300046516 Bacteria 1520
290 Ga0495628_0326111 3300046516 Bacteria 1132
291 Ga0495628_0334814 3300046516 Unclassified 1115
292 Ga0495630_0151432 3300046517 Bacteria 1765
293 Ga0495630_0359913 3300046517 Unclassified 1114
294 Ga0495643_0051766 3300046522 Bacteria 2207
295 Ga0495645_0057724 3300046543 Bacteria 2816
296 Ga0495633_0022675 3300046558 Bacteria 3120
297 Ga0495667_0432151 3300046559 Bacteria 828
298 Ga0495667_0780499 3300046559 Unclassified 590
299 Ga0495657_0323707 3300046675 Bacteria 916
300 Ga0495647_0106647 3300046681 Bacteria 1165
301 Ga0495647_0311612 3300046681 Bacteria 711
302 Ga0495658_0129532 3300046683 Bacteria 1534
303 Ga0495658_0498625 3300046683 Unclassified 779
304 Ga0495600_0210816 3300046809 Bacteria 1245
305 Ga0495600_0236130 3300046809 Bacteria 1166
306 Ga0495680_0090782 3300047322 Bacteria 2291
307 Ga0495680_0472330 3300047322 Unclassified 855
308 Ga0495684_0168339 3300047471 Bacteria 1631
309 Ga0496100_0014237 3300048903 Bacteria 4613
310 Ga0496101_0003217 3300048904 Bacteria 10128
311 Ga0496102_0078312 3300048905 Bacteria 3043
312 Ga0496104_0068842 3300048907 Bacteria 3363
313 Ga0496105_0215747 3300048908 Unclassified 1563
314 Ga0496106_0039512 3300048909 Bacteria 3534
315 Ga0496112_0020436 3300048915 Bacteria 6277
316 Ga0496114_0002430 3300048917 Bacteria 14208
317 Ga0496115_0240803 3300048918 Bacteria 1491
318 Ga0501034_0292897 3300049571 Bacteria 1565
319 Ga0501036_0648636 3300049572 Bacteria 874
320 Ga0501076_0242514 3300049592 Bacteria 1475
321 nmdc:mga05p37_1660078_c1 3300050507 Unclassified 626
322 nmdc:mga05p37_421447_c1 3300050507 Bacteria 1553
323 nmdc:mga05p37_49121_c1 3300050507 Bacteria 5190
324 nmdc:mga05p37_70879_c1 3300050507 Bacteria 4287
325 nmdc:mga05p37_94107_c1 3300050507 Bacteria 1577
326 nmdc:mga09592_253248_c1 3300050508 Bacteria 1526
327 nmdc:mga0qj67_691344_c1 3300050509 Bacteria 812
328 nmdc:mga08y16_10786_c1 3300050511 Bacteria 9591
329 nmdc:mga08y16_32012_c1 3300050511 Bacteria 5531
330 nmdc:mga0n895_3498_c1 3300050512 Bacteria 12688
331 nmdc:mga0n895_376786_c1 3300050512 Bacteria 1436
332 nmdc:mga0n895_628789_c1 3300050512 Bacteria 1074
333 nmdc:mga0n895_640504_c1 3300050512 Bacteria 1062
334 nmdc:mga0n895_69157_c1 3300050512 Bacteria 3498
335 nmdc:mga0n895_94691_c1 3300050512 Bacteria 2990
336 nmdc:mga0rr50_132_c1 3300050513 Bacteria 40800
337 nmdc:mga0rr50_37601_c1 3300050513 Bacteria 3496
338 nmdc:mga0rr50_726800_c1 3300050513 Bacteria 847
339 nmdc:mga08x19_171086_c1 3300050514 Bacteria 1480
340 nmdc:mga08x19_5411_c1 3300050514 Bacteria 7551
341 nmdc:mga0a205_157506_c1 3300050515 Bacteria 2169
342 nmdc:mga0a205_276053_c1 3300050515 Bacteria 1557
343 nmdc:mga0a205_339871_c1 3300050515 Bacteria 1370
344 nmdc:mga0a205_54171_c1 3300050515 Bacteria 3872
345 nmdc:mga0a205_804924_c1 3300050515 Bacteria 787
346 Ga0495601_0128295 3300053077 Bacteria 1651
347 Ga0495601_0144934 3300053077 Bacteria 1550
348 Ga0495601_0573604 3300053077 Unclassified 725
349 Ga0495595_0017736 3300053084 Bacteria 3066
350 Ga0495619_0078898 3300053085 Bacteria 2214
351 Ga0501082_0151111 3300060353 Bacteria 2017
352 Ga0070709_10370978
353 JGI25406J46586_10000551
354 JGI25406J46586_10001000
355 Ga0065712_10069073
356 Ga0065715_10093477
357 Ga0070658_10030579
358 Ga0070676_10017881
359 Ga0070676_10040035
360 Ga0070676_10048145
361 Ga0070676_10163911
362 Ga0070690_100035508
363 Ga0070690_100554957
364 Ga0070670_100028207
365 Ga0070680_100030214
366 Ga0068868_100329580
367 Ga0070660_100002101
368 Ga0070660_100255727
369 Ga0070689_100071210
370 Ga0070691_10000787
371 Ga0070687_100448095
372 Ga0070692_10376578
373 Ga0070668_100053256
374 Ga0070669_100033715
375 Ga0070675_100081037
376 Ga0070675_100575344
377 Ga0070671_100251631
378 Ga0070671_100322256
379 Ga0070671_100991489
380 Ga0070674_100072979
381 Ga0070673_100025649
382 Ga0070673_100201728
383 Ga0070673_100387168
384 Ga0070688_100020989
385 Ga0070688_100091227
386 Ga0070659_100147586
387 Ga0070659_100970741
388 Ga0070667_100212519
389 Ga0070667_100231692
390 Ga0070714_100054422
391 Ga0070713_100042574
392 Ga0070701_10013051
393 Ga0070701_10110556
394 Ga0070705_100025770
395 Ga0070705_100311282
396 Ga0070700_100001858
397 Ga0070700_100699753
398 Ga0070694_100027075
399 Ga0070694_100031967
400 Ga0070694_100249998
401 Ga0070694_100522109
402 Ga0070708_100083081
403 Ga0070708_100270679
404 Ga0070662_100162050
405 Ga0070681_10074374
406 Ga0070681_11214399
407 Ga0070685_10009015
408 Ga0070685_10018157
409 Ga0070706_100519239
410 Ga0070707_100055965
411 Ga0070707_101323299
412 Ga0070698_100160085
413 Ga0070698_100669876
414 Ga0070699_100023474
415 Ga0070699_100410663
416 Ga0070679_100240794
417 Ga0070697_100198069
418 Ga0070672_100033349
419 Ga0070672_100065656
420 Ga0070686_100040414
421 Ga0070686_100534652
422 Ga0070695_100041941
423 Ga0070695_100055231
424 Ga0070695_100202430
425 Ga0070696_100011102
426 Ga0070696_100011678
427 Ga0070696_100253019
428 Ga0070704_100018572
429 Ga0070704_100027670
430 Ga0068855_100051946
431 Ga0068855_100378490
432 Ga0068855_100764222
433 Ga0068855_100945936
434 Ga0070664_100046165
435 Ga0068857_100812958
436 Ga0068857_101287674
437 Ga0068854_100546431
438 Ga0068856_100487844
439 Ga0068856_100867133
440 Ga0070702_100019393
441 Ga0068859_100006510
442 Ga0068859_100155928
443 Ga0068859_100439562
444 Ga0068859_100632400
445 Ga0068864_100002917
446 Ga0068864_100132267
447 Ga0068864_100175596
448 Ga0068864_100400758
449 Ga0068866_10790935
450 Ga0068861_100002363
451 Ga0068861_100076322
452 Ga0068861_100243206
453 Ga0068861_100294637
454 Ga0068861_100712241
455 Ga0068870_10041920
456 Ga0068863_100220421
457 Ga0068863_100543193
458 Ga0068858_100050841
459 Ga0068858_100195961
460 Ga0068858_100233532
461 Ga0068860_100361253
462 Ga0068862_100141549
463 Ga0081539_10000074
464 Ga0081539_10001302
465 Ga0081539_10011203
466 Ga0075432_10110698
467 Ga0070715_10031325
468 Ga0070716_100374055
469 Ga0070712_100211721
470 Ga0097621_100438857
471 Ga0068871_100008309
472 Ga0075428_101300649
473 Ga0075430_100314489
474 Ga0075430_100711413
475 Ga0075433_10103103
476 Ga0075433_10133411
477 Ga0075433_10141837
478 Ga0075433_10268295
479 Ga0075433_10550994
480 Ga0075433_10715444
481 Ga0075434_100004316
482 Ga0075434_100117533
483 Ga0075434_100382812
484 Ga0075434_100561688
485 Ga0075434_101494603
486 Ga0075429_100243330
487 Ga0068865_100287676
488 Ga0075436_100007630
489 Ga0075436_100013832
490 Ga0075436_100051461
491 Ga0097620_100006510
492 Ga0097620_100155921
493 Ga0097620_100439545
494 Ga0097620_100632403
495 Ga0075435_100003488
496 Ga0075435_100049725
497 Ga0075435_100110177
498 Ga0075435_100824923
499 Ga0105240_10567672
500 Ga0111539_10041326
501 Ga0111539_10048897
502 Ga0114129_10061482
503 Ga0114129_10138144
504 Ga0114129_10724998
505 Ga0114129_11078193
506 Ga0105243_10012473
507 Ga0105243_10155163
508 Ga0105243_11245465
509 Ga0105242_10078445
510 Ga0105242_10208747
511 Ga0105242_10273868
512 Ga0105242_11555268
513 Ga0105248_10031288
514 Ga0105248_10795206
515 Ga0105248_10817917
516 Ga0105237_10472996
517 Ga0105238_10460558
518 Ga0105249_10265432
519 Ga0105249_10746981
520 Ga0157374_11013922
521 Ga0157375_10439794
522 Ga0157375_10525086
523 Ga0157375_11210137
524 Ga0163163_10011097
525 Ga0163163_10020713
526 Ga0157380_10263391
527 Ga0157380_10529248
528 Ga0157380_11162185
529 Ga0157380_11764925
530 Ga0157377_10039352
531 Ga0157377_10293437
532 Ga0157376_10035298
533 Ga0157376_10233608
534 Ga0163161_10465425
535 Ga0207697_10132144
536 Ga0207682_10241299
537 Ga0207685_10079957
538 Ga0207685_10211098
539 Ga0207645_10005730
540 Ga0207645_10170295
541 Ga0207645_10235488
542 Ga0207643_10051746
543 Ga0207705_10119737
544 Ga0207684_10404476
545 Ga0207684_10823415
546 Ga0207707_10029087
547 Ga0207693_10277805
548 Ga0207660_10277876
549 Ga0207662_10025223
550 Ga0207662_10286101
551 Ga0207657_10008743
552 Ga0207652_10340007
553 Ga0207646_10067929
554 Ga0207681_10021743
555 Ga0207650_10050837
556 Ga0207659_10017748
557 Ga0207687_10220733
558 Ga0207700_10153323
559 Ga0207644_10169598
560 Ga0207644_10332336
561 Ga0207690_10076082
562 Ga0207709_10015026
563 Ga0207669_10093687
564 Ga0207704_10260638
565 Ga0207704_10561718
566 Ga0207665_10100652
567 Ga0207665_10262218
568 Ga0207691_10048207
569 Ga0207689_10116984
570 Ga0207679_10174368
571 Ga0207651_10230268
572 Ga0207712_10245185
573 Ga0207668_10072656
574 Ga0207640_10055976
575 Ga0207640_10281351
576 Ga0207658_10372586
577 Ga0207658_10461617
578 Ga0207677_10145475
579 Ga0207703_10298697
580 Ga0207708_10051120
581 Ga0207708_10081942
582 Ga0207702_10702339
583 Ga0207641_10117730
584 Ga0207648_10006132
585 Ga0207676_10101258
586 Ga0207676_10188605
587 Ga0207676_10367317
588 Ga0207674_10598246
589 Ga0207675_100000149
590 Ga0207675_100038004
591 Ga0207675_100099810
592 Ga0207675_100218195
593 Ga0207675_100629288
594 Ga0207675_100923535
595 Ga0207698_10480994
596 Ga0207428_10003265
597 Ga0268265_10232718
598 Ga0268265_10553628
599 Ga0316182_1375263
600 Ga0307408_100355504
601 Ga0307408_100900862
602 Ga0307405_10298278
603 Ga0307413_10017898
604 Ga0307413_10800522
605 Ga0307410_10130907
606 Ga0307406_10016500
607 Ga0307407_10058153
608 Ga0307407_10409042
609 Ga0307409_100144238
610 Ga0307409_101485380
611 Ga0307416_100097083
612 Ga0307416_101211862
613 Ga0307416_102220459
614 Ga0307411_10004141
615 Ga0307411_10157019
616 Ga0307411_10304342
617 Ga0307411_10779087
618 Ga0307415_100950493
619 Ga0373926_0080298
620 Ga0373953_0105289
621 Ga0373954_0209090
622 Ga0373943_0769949
623 Ga0373955_0048712
624 Ga0373935_0298428
625 Ga0373935_0736137
626 Ga0373947_0109465
627 Ga0373937_0036892
628 Ga0373937_1045498
629 Ga0373925_0753393
630 Ga0373925_0797473
631 Ga0395905_1310683
632 Ga0436362_0757221
633 Ga0466963_0626144
634 Ga0466967_2202359
635 Ga0495592_0299430
636 Ga0495629_0439810
637 Ga0495629_0692416
638 Ga0495639_0221345
639 Ga0495628_0154379
640 Ga0495628_0196819
641 Ga0495628_0326111
642 Ga0495628_0334814
643 Ga0495630_0151432
644 Ga0495630_0359913
645 Ga0495643_0051766
646 Ga0495645_0057724
647 Ga0495633_0022675
648 Ga0495667_0432151
649 Ga0495667_0780499
650 Ga0495657_0323707
651 Ga0495647_0106647
652 Ga0495647_0311612
653 Ga0495658_0129532
654 Ga0495658_0498625
655 Ga0495600_0210816
656 Ga0495600_0236130
657 Ga0495680_0090782
658 Ga0495680_0472330
659 Ga0495684_0168339
660 Ga0496100_0014237
661 Ga0496101_0003217
662 Ga0496102_0078312
663 Ga0496104_0068842
664 Ga0496105_0215747
665 Ga0496106_0039512
666 Ga0496112_0020436
667 Ga0496114_0002430
668 Ga0496115_0240803
669 Ga0501034_0292897
670 Ga0501036_0648636
671 Ga0501076_0242514
672 nmdc:mga05p37_1660078_c1
673 nmdc:mga05p37_421447_c1
674 nmdc:mga05p37_49121_c1
675 nmdc:mga05p37_70879_c1
676 nmdc:mga05p37_94107_c1
677 nmdc:mga09592_253248_c1
678 nmdc:mga0qj67_691344_c1
679 nmdc:mga08y16_10786_c1
680 nmdc:mga08y16_32012_c1
681 nmdc:mga0n895_3498_c1
682 nmdc:mga0n895_376786_c1
683 nmdc:mga0n895_628789_c1
684 nmdc:mga0n895_640504_c1
685 nmdc:mga0n895_69157_c1
686 nmdc:mga0n895_94691_c1
687 nmdc:mga0rr50_132_c1
688 nmdc:mga0rr50_37601_c1
689 nmdc:mga0rr50_726800_c1
690 nmdc:mga08x19_171086_c1
691 nmdc:mga08x19_5411_c1
692 nmdc:mga0a205_157506_c1
693 nmdc:mga0a205_276053_c1
694 nmdc:mga0a205_339871_c1
695 nmdc:mga0a205_54171_c1
696 nmdc:mga0a205_804924_c1
697 Ga0495601_0128295
698 Ga0495601_0144934
699 Ga0495601_0573604
700 Ga0495595_0017736
701 Ga0495619_0078898
702 Ga0501082_0151111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map