F418463

General Info

Members Datasets Scaffolds Average Seq Length
350 257 700 439

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8007371054|8007374899
Length 428
Sequence GTTEVRDNNLYIGGVNTVDLANEYSTPLYVIDEAFVREKCRRYFKAFKLQERNNRVAYAGKAFLTLAMCQLIKAEGLCLDVVSGGELYTAIKSGFPLDKVYFHGNNKTIEEIDMGIRSGVGKFVVDNFYEIEKINEIAALYNKTQQILLRITPGIEAHTHDYIRTGQIDSKFGFTILNNNTLDAVKKAIELPNIELIGLHCHIGSQIFDITPYEDAIEVMMSLIASINEELDYEIKELDLGGGFGIHYRKGDNPRSIEEFCRAIINKADKTSEELGIKLPSLTIEPGRSIIGKAGTTLYTVGSIKEIPEVRKYVSVDGGMTDNIRPALYKAEYECVIANRVEDISKETVTISGKCCESGDILLSDVQIPRVESGDILAVLSTGAYGYSMSSNYNKIPKAAVVFVSEGKSKLICKRQSYEEVIANEISM

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
34 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
35 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
36 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
37 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
38 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
43 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
44 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
45 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
46 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
47 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
48 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
49 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
50 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
51 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
52 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
53 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
54 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
57 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
58 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
59 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
60 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
61 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
62 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
63 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
64 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
65 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
66 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
67 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
68 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
69 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
79 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
80 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
81 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
82 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
83 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
84 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
85 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
86 2554235283 Bacillus safensis VK Isolate Rhizosphere
87 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
88 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
89 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
90 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
91 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
92 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
93 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
94 2643221729 Bacillus sp. Root11 Isolate Unclassified
95 2643221730 Bacillus sp. Root131 Isolate Unclassified
96 2643221731 Bacillus sp. Root147 Isolate Unclassified
97 2643221732 Bacillus sp. Root239 Isolate Unclassified
98 2643221735 Bacillus sp. Root920 Isolate Unclassified
99 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
100 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
101 2671180694 Paenibacillus sp. A3 Isolate Unclassified
102 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
103 2684622632 Bacillus cereus 905 Isolate Unclassified
104 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
105 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
106 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
107 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
108 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
109 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
110 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
111 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
112 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
113 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
114 2738541358 Bacillus sp. OV752 Isolate Unclassified
115 2738543006 Bacillus sp. OK077 Isolate Unclassified
116 2738543010 Bacillus sp. YR335 Isolate Unclassified
117 2738543017 Bacillus sp. OV186 Isolate Unclassified
118 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
119 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
120 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
121 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
122 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
123 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
124 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
125 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
126 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
127 2811994870 Bacillus sp. JB4 Isolate Unclassified
128 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
129 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
130 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
131 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
132 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
133 2818991459 Paenibacillus sp. 597 Isolate Unclassified
134 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
135 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
136 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
137 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
138 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
139 2842682962 Bacillus sp. R-72492 Isolate Unclassified
140 2842882022 Bacillus sp. R-71893 Isolate Unclassified
141 2849139964 Bacillus sp. R-71875 Isolate Unclassified
142 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
143 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
144 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
145 2857581216 Bacillus sp. R-71922 Isolate Unclassified
146 2857586860 Bacillus sp. R-71935 Isolate Unclassified
147 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
148 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
149 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
150 2860837431 Bacillus sp. WR11 Isolate Unclassified
151 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
152 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
153 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
154 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
155 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
156 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
157 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
158 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
159 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
160 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
161 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
162 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
163 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
164 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
165 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
166 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
167 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
168 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
169 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
170 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
171 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
172 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
173 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
174 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
175 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
176 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
177 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
178 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
179 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
180 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
181 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
182 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
183 2919720352 Priestia megaterium 4340 Isolate Unclassified
184 2919726948 Bacillus pumilus 4489 Isolate Unclassified
185 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
186 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
187 2929004312 Priestia megaterium 1104 Isolate Unclassified
188 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
189 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
190 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
191 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
192 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
193 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
194 2938917290 Bacillus sp. CR71 Isolate Unclassified
195 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
196 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
197 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
198 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
199 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
200 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
201 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
202 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
203 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
204 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
205 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
206 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
207 2965761152 Bacillus sp. COPE52 Isolate Unclassified
208 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
209 2969141011 Bacillus velezensis MH25 Isolate Unclassified
210 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
211 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
212 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
213 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
214 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
215 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
216 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
217 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
218 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
219 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
220 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
221 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
222 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
223 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
224 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
225 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
226 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
227 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
228 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
229 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
230 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
231 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
232 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
233 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
234 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
235 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
236 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
237 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
238 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
239 8022653035 Bacillus sp. Rc4 Isolate Unclassified
240 8022792930 Bacillus sp. Xin Isolate Rhizosphere
241 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
242 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
243 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
244 8023438354 Bacillus sp. BH2 Isolate Unclassified
245 8023444577 Bacillus sp. BH32 Isolate Unclassified
246 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
247 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
248 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
249 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
250 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
251 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
252 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
253 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
254 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
255 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
256 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
257 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 40.57
Metatranscriptomes 3.43
Isolates 56

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 13.14
Nodule 0.29
Rhizoplane 6.57
Rhizosphere 38.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002311 3300003187 Bacteria 11637
2 JGI25151J46595_10003575 3300003187 Bacteria 8524
3 JGI25151J46595_10014443 3300003187 Bacteria 3517
4 JGI25151J46595_10033845 3300003187 Bacteria 1961
5 rootH1_10015900 3300003316 Bacteria 9226
6 rootH2_10316293 3300003320 Bacteria 1997
7 rootL2_10052984 3300003322 Bacteria 12875
8 rootH1_10227286 3300003323 Bacteria 3469
9 Ga0006562J51391_1007817 3300003578 Bacteria 3254
10 Ga0006562J51391_1017713 3300003578 Bacteria 1634
11 Ga0055538_1000182 3300003751 Bacteria 38981
12 Ga0055532_1000172 3300003758 Bacteria 54979
13 Ga0055532_1001022 3300003758 Bacteria 8675
14 Ga0055535_1002203 3300003761 Bacteria 7406
15 Ga0055536_1007502 3300003781 Bacteria 4866
16 Ga0105244_10028805 3300009036 Bacteria 2975
17 Ga0105250_10042243 3300009092 Bacteria 1827
18 Ga0105245_10010759 3300009098 Bacteria 7961
19 Ga0114129_10145884 3300009147 Bacteria 3242
20 Ga0105243_10001573 3300009148 Bacteria 19961
21 Ga0105242_10028428 3300009176 Bacteria 4452
22 Ga0105246_10058724 3300011119 Bacteria 2666
23 Ga0209784_100046 3300025224 Bacteria 200009
24 Ga0209784_100118 3300025224 Bacteria 83084
25 Ga0209566_100015 3300025225 Bacteria 457963
26 Ga0209566_100644 3300025225 Bacteria 21095
27 Ga0209566_104233 3300025225 Bacteria 1993
28 Ga0209147_100042 3300025229 Bacteria 301263
29 Ga0209147_100230 3300025229 Bacteria 55320
30 Ga0209147_100301 3300025229 Bacteria 40707
31 Ga0209147_100408 3300025229 Bacteria 29102
32 Ga0209147_101454 3300025229 Bacteria 8530
33 Ga0209437_100848 3300025233 Bacteria 13210
34 Ga0209258_102138 3300025242 Bacteria 5505
35 Ga0209673_1002898 3300025273 Bacteria 10875
36 Ga0209130_1001554 3300025284 Bacteria 14588
37 Ga0209676_1002129 3300025292 Bacteria 15119
38 Ga0209676_1014477 3300025292 Bacteria 2962
39 Ga0209025_1000001 3300025294 Bacteria 1888151
40 Ga0209025_1000258 3300025294 Bacteria 124837
41 Ga0209025_1000578 3300025294 Bacteria 66380
42 Ga0209025_1001353 3300025294 Bacteria 32921
43 Ga0209025_1001477 3300025294 Bacteria 30602
44 Ga0209025_1001651 3300025294 Bacteria 27521
45 Ga0209025_1001693 3300025294 Bacteria 26923
46 Ga0209025_1002155 3300025294 Bacteria 21963
47 Ga0209025_1002735 3300025294 Bacteria 17867
48 Ga0209025_1005241 3300025294 Bacteria 10684
49 Ga0209025_1007566 3300025294 Bacteria 8058
50 Ga0209025_1009209 3300025294 Bacteria 6929
51 Ga0209025_1016397 3300025294 Bacteria 4376
52 Ga0209025_1018973 3300025294 Bacteria 3855
53 Ga0209025_1020400 3300025294 Bacteria 3628
54 Ga0209025_1021576 3300025294 Bacteria 3462
55 Ga0209025_1040096 3300025294 Bacteria 2031
56 Ga0209025_1047743 3300025294 Bacteria 1744
57 Ga0209025_1050223 3300025294 Bacteria 1670
58 Ga0207426_1003441 3300025302 Bacteria 8604
59 Ga0207426_1028479 3300025302 Bacteria 1851
60 Ga0207696_1001789 3300025711 Bacteria 11098
61 Ga0207696_1004270 3300025711 Bacteria 6203
62 Ga0207696_1006782 3300025711 Bacteria 4566
63 Ga0207696_1019541 3300025711 Bacteria 2203
64 Ga0207696_1032688 3300025711 Bacteria 1565
65 Ga0207655_1010079 3300025728 Bacteria 5778
66 Ga0207655_1012286 3300025728 Bacteria 5019
67 Ga0207655_1019449 3300025728 Bacteria 3548
68 Ga0207655_1051267 3300025728 Bacteria 1670
69 Ga0207713_1003991 3300025735 Bacteria 9775
70 Ga0207713_1015277 3300025735 Bacteria 3948
71 Ga0207713_1021262 3300025735 Bacteria 3116
72 Ga0207713_1035463 3300025735 Bacteria 2153
73 Ga0237817_10719 3300030083 Bacteria 2759
74 Ga0307408_100011763 3300031548 Bacteria 5788
75 Ga0395899_0020956 3300037312 Bacteria 4957
76 Ga0395899_0136089 3300037312 Bacteria 1751
77 Ga0237819_00812 3300038705 Bacteria 9896
78 Ga0237819_01779 3300038705 Bacteria 5043
79 Ga0439436_0002477 3300041404 Bacteria 5553
80 Ga0439439_0000285 3300041406 Bacteria 8077
81 Ga0439449_0000446 3300042007 Bacteria 15362
82 Ga0439462_0006866 3300042015 Bacteria 2838
83 Ga0466961_0048105 3300044693 Bacteria 2726
84 Ga0451576_0189726 3300045051 Bacteria 2146
85 Ga0466967_0009126 3300045976 Bacteria 7336
86 Ga0495585_0005303 3300046492 Bacteria 8138
87 Ga0495622_0016423 3300046557 Bacteria 3447
88 Ga0495676_0114506 3300047321 Bacteria 1973
89 Ga0496100_0002198 3300048903 Bacteria 9842
90 Ga0496100_0007066 3300048903 Bacteria 6160
91 Ga0496102_0003727 3300048905 Bacteria 12880
92 Ga0496103_0002797 3300048906 Bacteria 10852
93 Ga0496103_0003670 3300048906 Bacteria 9341
94 Ga0496104_0000392 3300048907 Bacteria 38243
95 Ga0496104_0004210 3300048907 Bacteria 12491
96 Ga0496105_0000459 3300048908 Bacteria 26767
97 Ga0496105_0000552 3300048908 Bacteria 24714
98 Ga0496106_0020299 3300048909 Bacteria 4930
99 Ga0496106_0021360 3300048909 Bacteria 4806
100 Ga0496107_0007340 3300048910 Bacteria 7600
101 Ga0496107_0011544 3300048910 Bacteria 6154
102 Ga0496108_0006635 3300048911 Bacteria 9378
103 Ga0496109_0002270 3300048912 Bacteria 15979
104 Ga0496110_0000513 3300048913 Bacteria 26329
105 Ga0496110_0001502 3300048913 Bacteria 16928
106 Ga0496111_0002408 3300048914 Bacteria 11290
107 Ga0496111_0061423 3300048914 Bacteria 2724
108 Ga0496112_0003180 3300048915 Bacteria 13497
109 Ga0496112_0034572 3300048915 Bacteria 4918
110 Ga0496113_0002031 3300048916 Bacteria 11618
111 Ga0496116_0001519 3300048919 Bacteria 25753
112 Ga0496116_0004911 3300048919 Bacteria 12597
113 Ga0496116_0038340 3300048919 Bacteria 3329
114 Ga0496117_0118223 3300048920 Bacteria 1634
115 Ga0496118_0023741 3300048921 Bacteria 5314
116 Ga0496118_0033718 3300048921 Bacteria 4194
117 Ga0496119_0000122 3300048922 Bacteria 109048
118 Ga0496119_0004301 3300048922 Bacteria 14237
119 Ga0496119_0023126 3300048922 Bacteria 4422
120 Ga0496120_0000045 3300048923 Bacteria 191663
121 Ga0496120_0023740 3300048923 Bacteria 3834
122 Ga0496121_0040103 3300048924 Bacteria 4112
123 Ga0496121_0097267 3300048924 Bacteria 2281
124 Ga0496122_0006151 3300048925 Bacteria 13957
125 Ga0496122_0008965 3300048925 Bacteria 10639
126 Ga0496122_0015608 3300048925 Bacteria 7246
127 Ga0496122_0019994 3300048925 Bacteria 6085
128 Ga0496122_0030817 3300048925 Bacteria 4482
129 Ga0496122_0090226 3300048925 Bacteria 2092
130 Ga0496123_0007009 3300048926 Bacteria 10747
131 Ga0496123_0007708 3300048926 Bacteria 10052
132 Ga0496124_0000805 3300048927 Bacteria 50918
133 Ga0496124_0002697 3300048927 Bacteria 22700
134 Ga0496124_0078242 3300048927 Bacteria 2726
135 Ga0496125_0000492 3300048928 Bacteria 69225
136 Ga0496125_0001374 3300048928 Bacteria 35737
137 Ga0496125_0006855 3300048928 Bacteria 12216
138 Ga0496125_0009126 3300048928 Bacteria 10260
139 Ga0496125_0019493 3300048928 Bacteria 6395
140 Ga0496125_0069526 3300048928 Bacteria 2763
141 Ga0496126_0000608 3300048929 Bacteria 67879
142 Ga0496126_0006887 3300048929 Bacteria 12593
143 Ga0496126_0020350 3300048929 Bacteria 6511
144 Ga0496126_0050624 3300048929 Bacteria 3784
145 Ga0501306_000770 3300049127 Bacteria 2681
146 Ga0501343_000285 3300049132 Bacteria 2798
147 Ga0501305_005250 3300049161 Bacteria 1561
148 Ga0501305_007906 3300049161 Bacteria 1362
149 Ga0501312_003379 3300049528 Bacteria 1805
150 Ga0501315_000510 3300049531 Bacteria 2733
151 Ga0501317_000492 3300049533 Bacteria 2810
152 Ga0501321_001783 3300049537 Bacteria 1779
153 Ga0501323_000484 3300049539 Bacteria 2980
154 Ga0501333_000157 3300049549 Bacteria 2587
155 8007374899 8007371054 Bacteria 4849201
156 2511180004 2510917027 Bacteria 5287437
157 2511700105 2511231119 Bacteria 4019861
158 2512638954 2512564013 Bacteria 6286191
159 2512732471 2512564039 Bacteria 8739048
160 2524186270 2524023129 Bacteria 6762600
161 2545556790 2545555800 Bacteria 4222588
162 2553391766 2551306519 Bacteria 5465154
163 2555467509 2554235283 Bacteria 3683090
164 2563928913 2563366752 Bacteria 4961801
165 2578931040 2576861599 Bacteria 4217202
166 2587738655 2585428059 Bacteria 8696589
167 2595092059 2593339131 Bacteria 5116855
168 2631985324 2630968484 Bacteria 3876276
169 2643738311 2643221543 Bacteria 6628015
170 2644426832 2643221676 Bacteria 8119172
171 2644703913 2643221729 Bacteria 6621700
172 2644708606 2643221730 Bacteria 6523787
173 2644715931 2643221731 Bacteria 5623886
174 2644717959 2643221731 Bacteria 5623886
175 2644724198 2643221732 Bacteria 5756404
176 2644724857 2643221732 Bacteria 5756404
177 2644740683 2643221735 Bacteria 3676263
178 2651532017 2648501850 Bacteria 3975476
179 2672336810 2671180330 Bacteria 5521719
180 2673822203 2671180694 Bacteria 7506943
181 2674419209 2671180844 Bacteria 4164150
182 2685149342 2684622632 Bacteria 5380049
183 2686997335 2684623153 Bacteria 3878815
184 2687498642 2687453109 Bacteria 3860091
185 2695628083 2695420354 Bacteria 3922431
186 2698323837 2695420987 Bacteria 6152737
187 2705993389 2703719227 Bacteria 5631989
188 2717916207 2716884898 Bacteria 3928789
189 2721504722 2718218445 Bacteria 5113413
190 2723604681 2721755693 Bacteria 6126117
191 2730135320 2728369359 Bacteria 5621728
192 2738840699 2738541299 Bacteria 4020721
193 2739156308 2738541358 Bacteria 5932299
194 2739210752 2738543006 Bacteria 5904091
195 2739230442 2738543010 Bacteria 5583595
196 2739271769 2738543017 Bacteria 4271950
197 2745166959 2744054657 Bacteria 5016802
198 2753809873 2751185905 Bacteria 6142767
199 2757568987 2757320391 Bacteria 4746095
200 2777762495 2775507177 Bacteria 4384303
201 2777836208 2775507192 Bacteria 4622234
202 2791212520 2788500588 Bacteria 4584915
203 2793186293 2791355222 Bacteria 5898266
204 2802436939 2802428803 Bacteria 5806948
205 2808869283 2808606364 Bacteria 4465927
206 2812316528 2811994870 Bacteria 3776934
207 2816862731 2816332186 Bacteria 5331395
208 2817480580 2816332295 Bacteria 4352468
209 2817618161 2816332336 Bacteria 5207640
210 2819579510 2818991443 Bacteria 6598732
211 2819626117 2818991451 Bacteria 4697364
212 2819669287 2818991459 Bacteria 8736032
213 2819707119 2818991465 Bacteria 5388835
214 2819709403 2818991465 Bacteria 5388835
215 2819723596 2818991468 Bacteria 3723169
216 2821114389 2821111986 Bacteria 6894338
217 2823528510 2823526263 Bacteria 3765752
218 2831905750 2831905167 Bacteria 3319172
219 2842684347 2842682962 Bacteria 5589973
220 2842882568 2842882022 Bacteria 6158489
221 2842884348 2842882022 Bacteria 6158489
222 2849144313 2849139964 Bacteria 5613304
223 2857453741 2857453340 Bacteria 8090534
224 2857461252 2857460504 Bacteria 5194327
225 2857469961 2857465823 Bacteria 6772595
226 2857582465 2857581216 Bacteria 5522813
227 2857591022 2857586860 Bacteria 4354574
228 2857591702 2857591370 Bacteria 6569758
229 2857604238 2857604169 Bacteria 5111450
230 2857610895 2857609550 Bacteria 3753890
231 2860839957 2860837431 Bacteria 4202080
232 2864737669 2864733723 Bacteria 6770668
233 2864997873 2864997549 Bacteria 5139696
234 2865003632 2865002811 Bacteria 6333767
235 2877770988 2877768649 Bacteria 3957164
236 2880171853 2880169592 Bacteria 3900066
237 2881644256 2881644220 Bacteria 5302661
238 2881646309 2881644220 Bacteria 5302661
239 2885527341 2885526491 Bacteria 7164189
240 2889046533 2889042446 Bacteria 7618936
241 2889050211 2889049205 Bacteria 7524325
242 2889280589 2889276214 Bacteria 5979355
243 2889297245 2889295896 Bacteria 4704906
244 2897112078 2897109615 Bacteria 4009619
245 2898909881 2898907183 Bacteria 4067722
246 2904118235 2904113452 Bacteria 7796941
247 2904163517 2904162308 Bacteria 7086713
248 2904493394 2904490793 Bacteria 7046938
249 2904524623 2904524088 Bacteria 5887454
250 2904526766 2904524088 Bacteria 5887454
251 2904561943 2904560550 Bacteria 4029838
252 2904595478 2904595352 Bacteria 6124848
253 2904606787 2904606771 Bacteria 4684500
254 2904762014 2904755435 Bacteria 7986759
255 2907205520 2907202186 Bacteria 6632024
256 2908668285 2908665501 Bacteria 3678115
257 2915601034 2915597211 Bacteria 6475886
258 2915607284 2915606848 Bacteria 6032732
259 2916973910 2916971899 Bacteria 4250608
260 2919096054 2919093281 Bacteria 3660974
261 2919144642 2919143609 Bacteria 6219228
262 2919146781 2919143609 Bacteria 6219228
263 2919165237 2919160200 Bacteria 6929020
264 2919415296 2919414237 Bacteria 5429133
265 2919429868 2919425241 Bacteria 8055701
266 2919518704 2919517244 Bacteria 5858162
267 2919519833 2919517244 Bacteria 5858162
268 2919720973 2919720352 Bacteria 5986006
269 2919723072 2919720352 Bacteria 5986006
270 2919728228 2919726948 Bacteria 3696050
271 2925331661 2925326138 Bacteria 9652120
272 2928095279 2928093941 Bacteria 5965005
273 2928096402 2928093941 Bacteria 5965005
274 2929006223 2929004312 Bacteria 5678476
275 2929008995 2929004312 Bacteria 5678476
276 2929186177 2929183550 Bacteria 6377511
277 2929208651 2929206907 Bacteria 5918291
278 2929234613 2929233124 Bacteria 5948380
279 2931389981 2931384279 Bacteria 7299545
280 2936343135 2936340661 Bacteria 5139038
281 2936367243 2936361878 Bacteria 5632809
282 2938918790 2938917290 Bacteria 5914775
283 2939593400 2939593269 Bacteria 4798695
284 2939685431 2939679117 Bacteria 6921672
285 2939705233 2939702853 Bacteria 5139229
286 2945991327 2945991243 Bacteria 7008369
287 2946054022 2946053406 Bacteria 6978655
288 2947428159 2947426588 Bacteria 5357194
289 2954773973 2954773129 Bacteria 3741715
290 2956899437 2956897341 Bacteria 5447711
291 2960320694 2960319331 Bacteria 5502575
292 2960324937 2960319331 Bacteria 5502575
293 2960377519 2960375949 Bacteria 5361395
294 2960380766 2960375949 Bacteria 5361395
295 2962293229 2962290636 Bacteria 4072939
296 2964377078 2964375228 Bacteria 4909004
297 2965762651 2965761152 Bacteria 5806513
298 2969139242 2969136845 Bacteria 3923176
299 2969143435 2969141011 Bacteria 4118468
300 2969767206 2969765954 Bacteria 4216713
301 2969773478 2969770375 Bacteria 4271280
302 2971411023 2971410472 Bacteria 8311090
303 2971895634 2971893375 Bacteria 3929648
304 2977256749 2977254563 Bacteria 4828420
305 2979085082 2979083700 Bacteria 5894929
306 2980130451 2980125574 Bacteria 5567337
307 2980189786 2980182181 Bacteria 9454109
308 2980494995 2980492589 Bacteria 4072961
309 2981285724 2981284811 Bacteria 4641497
310 2981290671 2981289755 Bacteria 4641509
311 2981980707 2981980479 Bacteria 4641628
312 2981985585 2981985349 Bacteria 4641497
313 2984530116 2984527788 Bacteria 5288478
314 2984536223 2984532647 Bacteria 5288506
315 2990277623 2990275345 Bacteria 4887158
316 3001268242 3001267043 Bacteria 4823521
317 3001897938 3001892409 Bacteria 6328293
318 3006827246 3006826541 Bacteria 4678913
319 3006828405 3006826541 Bacteria 4678913
320 3006860931 3006858327 Bacteria 4317835
321 3006881464 3006879489 Bacteria 4064221
322 3006972884 3006969106 Bacteria 4739423
323 3006975711 3006973921 Bacteria 4423788
324 3006981619 3006978542 Bacteria 5328100
325 3006989090 3006988479 Bacteria 4767936
326 648170724 648028048 Bacteria 5394884
327 8002323703 8002317523 Bacteria 8051857
328 8022622577 8022621104 Bacteria 5241040
329 8022633688 8022630665 Bacteria 3886130
330 8022654122 8022653035 Bacteria 4035078
331 8022798209 8022792930 Bacteria 5693794
332 8022897298 8022893055 Bacteria 5300455
333 8022898020 8022893055 Bacteria 5300455
334 8022917203 8022914991 Bacteria 5584517
335 8022919036 8022914991 Bacteria 5584517
336 8022949683 8022948649 Bacteria 5366783
337 8023442533 8023438354 Bacteria 5779374
338 8023447871 8023444577 Bacteria 5661597
339 8046998838 8046991243 Bacteria 8497463
340 8051955425 8051952484 Bacteria 3926774
341 8052176861 8052174270 Bacteria 3881265
342 8054281401 8054280661 Bacteria 4232245
343 8055533198 8055531788 Bacteria 5249694
344 8055635681 8055632911 Bacteria 5283357
345 8056536435 8056533031 Bacteria 8964429
346 8057478333 8057473075 Bacteria 5892720
347 8057584166 8057582654 Bacteria 5218944
348 8057635244 8057632132 Bacteria 4726859
349 8057733501 8057733483 Bacteria 6578323
350 8057978955 8057977335 Bacteria 5694872
351 JGI25151J46595_10002311
352 JGI25151J46595_10003575
353 JGI25151J46595_10014443
354 JGI25151J46595_10033845
355 rootH1_10015900
356 rootH2_10316293
357 rootL2_10052984
358 rootH1_10227286
359 Ga0006562J51391_1007817
360 Ga0006562J51391_1017713
361 Ga0055538_1000182
362 Ga0055532_1000172
363 Ga0055532_1001022
364 Ga0055535_1002203
365 Ga0055536_1007502
366 Ga0105244_10028805
367 Ga0105250_10042243
368 Ga0105245_10010759
369 Ga0114129_10145884
370 Ga0105243_10001573
371 Ga0105242_10028428
372 Ga0105246_10058724
373 Ga0209784_100046
374 Ga0209784_100118
375 Ga0209566_100015
376 Ga0209566_100644
377 Ga0209566_104233
378 Ga0209147_100042
379 Ga0209147_100230
380 Ga0209147_100301
381 Ga0209147_100408
382 Ga0209147_101454
383 Ga0209437_100848
384 Ga0209258_102138
385 Ga0209673_1002898
386 Ga0209130_1001554
387 Ga0209676_1002129
388 Ga0209676_1014477
389 Ga0209025_1000001
390 Ga0209025_1000258
391 Ga0209025_1000578
392 Ga0209025_1001353
393 Ga0209025_1001477
394 Ga0209025_1001651
395 Ga0209025_1001693
396 Ga0209025_1002155
397 Ga0209025_1002735
398 Ga0209025_1005241
399 Ga0209025_1007566
400 Ga0209025_1009209
401 Ga0209025_1016397
402 Ga0209025_1018973
403 Ga0209025_1020400
404 Ga0209025_1021576
405 Ga0209025_1040096
406 Ga0209025_1047743
407 Ga0209025_1050223
408 Ga0207426_1003441
409 Ga0207426_1028479
410 Ga0207696_1001789
411 Ga0207696_1004270
412 Ga0207696_1006782
413 Ga0207696_1019541
414 Ga0207696_1032688
415 Ga0207655_1010079
416 Ga0207655_1012286
417 Ga0207655_1019449
418 Ga0207655_1051267
419 Ga0207713_1003991
420 Ga0207713_1015277
421 Ga0207713_1021262
422 Ga0207713_1035463
423 Ga0237817_10719
424 Ga0307408_100011763
425 Ga0395899_0020956
426 Ga0395899_0136089
427 Ga0237819_00812
428 Ga0237819_01779
429 Ga0439436_0002477
430 Ga0439439_0000285
431 Ga0439449_0000446
432 Ga0439462_0006866
433 Ga0466961_0048105
434 Ga0451576_0189726
435 Ga0466967_0009126
436 Ga0495585_0005303
437 Ga0495622_0016423
438 Ga0495676_0114506
439 Ga0496100_0002198
440 Ga0496100_0007066
441 Ga0496102_0003727
442 Ga0496103_0002797
443 Ga0496103_0003670
444 Ga0496104_0000392
445 Ga0496104_0004210
446 Ga0496105_0000459
447 Ga0496105_0000552
448 Ga0496106_0020299
449 Ga0496106_0021360
450 Ga0496107_0007340
451 Ga0496107_0011544
452 Ga0496108_0006635
453 Ga0496109_0002270
454 Ga0496110_0000513
455 Ga0496110_0001502
456 Ga0496111_0002408
457 Ga0496111_0061423
458 Ga0496112_0003180
459 Ga0496112_0034572
460 Ga0496113_0002031
461 Ga0496116_0001519
462 Ga0496116_0004911
463 Ga0496116_0038340
464 Ga0496117_0118223
465 Ga0496118_0023741
466 Ga0496118_0033718
467 Ga0496119_0000122
468 Ga0496119_0004301
469 Ga0496119_0023126
470 Ga0496120_0000045
471 Ga0496120_0023740
472 Ga0496121_0040103
473 Ga0496121_0097267
474 Ga0496122_0006151
475 Ga0496122_0008965
476 Ga0496122_0015608
477 Ga0496122_0019994
478 Ga0496122_0030817
479 Ga0496122_0090226
480 Ga0496123_0007009
481 Ga0496123_0007708
482 Ga0496124_0000805
483 Ga0496124_0002697
484 Ga0496124_0078242
485 Ga0496125_0000492
486 Ga0496125_0001374
487 Ga0496125_0006855
488 Ga0496125_0009126
489 Ga0496125_0019493
490 Ga0496125_0069526
491 Ga0496126_0000608
492 Ga0496126_0006887
493 Ga0496126_0020350
494 Ga0496126_0050624
495 Ga0501306_000770
496 Ga0501343_000285
497 Ga0501305_005250
498 Ga0501305_007906
499 Ga0501312_003379
500 Ga0501315_000510
501 Ga0501317_000492
502 Ga0501321_001783
503 Ga0501323_000484
504 Ga0501333_000157
505 8007374899
506 2511180004
507 2511700105
508 2512638954
509 2512732471
510 2524186270
511 2545556790
512 2553391766
513 2555467509
514 2563928913
515 2578931040
516 2587738655
517 2595092059
518 2631985324
519 2643738311
520 2644426832
521 2644703913
522 2644708606
523 2644715931
524 2644717959
525 2644724198
526 2644724857
527 2644740683
528 2651532017
529 2672336810
530 2673822203
531 2674419209
532 2685149342
533 2686997335
534 2687498642
535 2695628083
536 2698323837
537 2705993389
538 2717916207
539 2721504722
540 2723604681
541 2730135320
542 2738840699
543 2739156308
544 2739210752
545 2739230442
546 2739271769
547 2745166959
548 2753809873
549 2757568987
550 2777762495
551 2777836208
552 2791212520
553 2793186293
554 2802436939
555 2808869283
556 2812316528
557 2816862731
558 2817480580
559 2817618161
560 2819579510
561 2819626117
562 2819669287
563 2819707119
564 2819709403
565 2819723596
566 2821114389
567 2823528510
568 2831905750
569 2842684347
570 2842882568
571 2842884348
572 2849144313
573 2857453741
574 2857461252
575 2857469961
576 2857582465
577 2857591022
578 2857591702
579 2857604238
580 2857610895
581 2860839957
582 2864737669
583 2864997873
584 2865003632
585 2877770988
586 2880171853
587 2881644256
588 2881646309
589 2885527341
590 2889046533
591 2889050211
592 2889280589
593 2889297245
594 2897112078
595 2898909881
596 2904118235
597 2904163517
598 2904493394
599 2904524623
600 2904526766
601 2904561943
602 2904595478
603 2904606787
604 2904762014
605 2907205520
606 2908668285
607 2915601034
608 2915607284
609 2916973910
610 2919096054
611 2919144642
612 2919146781
613 2919165237
614 2919415296
615 2919429868
616 2919518704
617 2919519833
618 2919720973
619 2919723072
620 2919728228
621 2925331661
622 2928095279
623 2928096402
624 2929006223
625 2929008995
626 2929186177
627 2929208651
628 2929234613
629 2931389981
630 2936343135
631 2936367243
632 2938918790
633 2939593400
634 2939685431
635 2939705233
636 2945991327
637 2946054022
638 2947428159
639 2954773973
640 2956899437
641 2960320694
642 2960324937
643 2960377519
644 2960380766
645 2962293229
646 2964377078
647 2965762651
648 2969139242
649 2969143435
650 2969767206
651 2969773478
652 2971411023
653 2971895634
654 2977256749
655 2979085082
656 2980130451
657 2980189786
658 2980494995
659 2981285724
660 2981290671
661 2981980707
662 2981985585
663 2984530116
664 2984536223
665 2990277623
666 3001268242
667 3001897938
668 3006827246
669 3006828405
670 3006860931
671 3006881464
672 3006972884
673 3006975711
674 3006981619
675 3006989090
676 648170724
677 8002323703
678 8022622577
679 8022633688
680 8022654122
681 8022798209
682 8022897298
683 8022898020
684 8022917203
685 8022919036
686 8022949683
687 8023442533
688 8023447871
689 8046998838
690 8051955425
691 8052176861
692 8054281401
693 8055533198
694 8055635681
695 8056536435
696 8057478333
697 8057584166
698 8057635244
699 8057733501
700 8057978955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02784

Orn_Arg_deC_N

Pyridoxal-dependent decarboxylase, pyridoxal binding domain

33

292

0.96

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

28

383

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x7n-assembly1.cif.gz_B crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum 0.9488 7 430
2qgh-assembly1.cif.gz_A-2 crystal structure of diaminopimelate decarboxylase from helicobacter pylori complexed with l-lysine 0.9483 21 429
2p3e-assembly1.cif.gz_A crystal structure of aq1208 from aquifex aeolicus 0.9477 7 429
3c5q-assembly1.cif.gz_A-2 crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine 0.9443 21 429
2p3e-assembly1.cif.gz_B crystal structure of aq1208 from aquifex aeolicus 0.944 7 429
ID Description Score Start End Superfamily
af_Q2FYN4_34_283_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9559 41 293 3.20.20.10
2qghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9377 41 292 3.20.20.10
af_Q2FYN4_34_283_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9372 41 293 3.20.20.10
af_Q2FYN4_284_419_2.40.37.10 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;Lyase, Ornithine Decarboxylase; Chain A, domain 1 0.9322 297 430 2.40.37.10
2o0tA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9266 41 295 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A6B3FN51-F1-model_v4 Diaminopimelate decarboxylase 0.9939 63 141 GO:0008836
GO:0009089
AF-A0A4Q9W2U6-F1-model_v4 Diaminopimelate decarboxylase 0.9792 5 145 GO:0008836
GO:0009089
AF-A0A6G2W080-F1-model_v4 Orn/DAP/Arg decarboxylase 2 N-terminal domain-containing protein 0.9786 4 130 GO:0008836
GO:0009089
AF-A0A6B3HH96-F1-model_v4 Diaminopimelate decarboxylase 0.9756 5 139 GO:0008836
GO:0009089
AF-A0A7X8IVR7-F1-model_v4 Diaminopimelate decarboxylase (DAP decarboxylase) (DAPDC) (EC 4.1.1.20) 0.9755 8 433 GO:0008836
GO:0009089
GO:0030170

Map