F418396

General Info

Members Datasets Scaffolds Average Seq Length
350 241 260 158

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0000212|Ga0496126_0000212_103905_104441
Length 178
Sequence MPAVSVSKNPAGPKAGEGSDMLPYPLLSASLVIMWLALNGFTLGHLILGCIVAVFASWGMASLRPAKPRLRKWYLLPKLVGIVLYDIVRSNIAVASIILGGHRRQFKSGFITVPLDVESPMALAVLAVVVTSTPGTAWLEYNSLNRTVLIHVLDLVDEAEWQTLIKGRYEALLMEIFE

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
4 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
5 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
6 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
7 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
8 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
9 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
10 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
11 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
12 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
13 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
14 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
15 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
16 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
17 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
18 2643221558 Rhizobium sp. Root149 Isolate Unclassified
19 2643221568 Rhizobium sp. Root564 Isolate Unclassified
20 2643221582 Rhizobium sp. Root651 Isolate Unclassified
21 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
22 2643221693 Rhizobium sp. Root491 Isolate Unclassified
23 2643221719 Rhizobium sp. Root274 Isolate Unclassified
24 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
25 2738541293 Rhizobium sp. GV031 Isolate Unclassified
26 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
27 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
28 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
29 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
30 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
31 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
32 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
33 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
34 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
35 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
36 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
37 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
38 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
39 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
40 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
41 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
42 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
43 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
44 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
45 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
46 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
47 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
48 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
49 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
50 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
51 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
52 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
53 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
54 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
55 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
56 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
57 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
58 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
59 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
60 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
61 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
62 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
63 2932401849 Devosia sp. 2618 Isolate Rhizosphere
64 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
65 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
66 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
67 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
68 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
69 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
70 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
71 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
72 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
73 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
74 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
75 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
76 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
77 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
78 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
79 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
80 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
81 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
82 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
83 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
84 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
85 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
86 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
87 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
88 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
89 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
90 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
91 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
92 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
93 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
94 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
100 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
101 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
102 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
105 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
119 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
169 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
172 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
230 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
233 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
234 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
235 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
236 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
237 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
238 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
239 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
240 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
241 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74
Metatranscriptomes 0
Isolates 26

Biome Distribution

Category Percentage (%)
Aerial Root 1.43
Bulb 0
Endosphere 26
Nodule 9.14
Rhizoplane 3.71
Rhizosphere 26.29
Stem 0
Stem Tuber 0
Unclassified 33.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000003 3300002704 Bacteria 279666
2 JGI25156J39149_1000004 3300002705 Bacteria 273027
3 JGI25162J39368_1000570 3300002737 Bacteria 27083
4 JGI25162J39368_1006124 3300002737 Bacteria 2152
5 JGI25154J39366_1000013 3300002738 Bacteria 268260
6 JGI25157J39369_1000004 3300002741 Bacteria 273009
7 JGI25163J39215_1007053 3300002771 Bacteria 642
8 JGI25150J39212_1000155 3300002774 Bacteria 38722
9 JGI25159J45721_1000308 3300002987 Bacteria 22894
10 JGI25151J46595_10000007 3300003187 Bacteria 411751
11 JGI25151J46595_10011697 3300003187 Bacteria 4023
12 JGI25165J46597_1000263 3300003214 Bacteria 68906
13 JGI25165J46597_1001021 3300003214 Bacteria 18446
14 JGI25153J46596_10000569 3300003215 Bacteria 22766
15 JGI25153J46596_10031347 3300003215 Bacteria 1792
16 rootH1_10007216 3300003316 Bacteria 10392
17 rootH2_10026419 3300003320 Bacteria 4589
18 rootH2_10099275 3300003320 Bacteria 3899
19 rootH2_10171268 3300003320 Bacteria 1476
20 rootL2_10002196 3300003322 Bacteria 46229
21 rootL2_10338264 3300003322 Bacteria 2240
22 rootH1_10016790 3300003316 Bacteria 7037
23 rootH1_10016790 3300003323 Bacteria 4803
24 rootH1_10185923 3300003323 Bacteria 1454
25 rootH1_10269314 3300003323 Bacteria 2525
26 JGI25160J50197_1019408 3300003354 Bacteria 2084
27 JGI25161J50226_1000231 3300003374 Bacteria 34155
28 Ga0055526_1002902 3300003771 Bacteria 11291
29 Ga0055524_1004464 3300003775 Bacteria 6460
30 Ga0055528_1002564 3300003790 Bacteria 9624
31 Ga0055530_10027113 3300003791 Bacteria 1569
32 Ga0055540_1014842 3300003792 Bacteria 2300
33 Ga0055531_10033074 3300003794 Bacteria 1674
34 Ga0058692_1000651 3300003856 Bacteria 14332
35 Ga0058692_1003220 3300003856 Bacteria 5127
36 Ga0058692_1029020 3300003856 Bacteria 1062
37 Ga0055543_1000190 3300004625 Bacteria 50170
38 Ga0065165_1006054 3300005262 Bacteria 6496
39 Ga0065704_10132416 3300005289 Bacteria 1613
40 Ga0070668_100009809 3300005347 Bacteria 7095
41 Ga0070663_100326172 3300005455 Unclassified 1236
42 Ga0070665_100005844 3300005548 Bacteria 12621
43 Ga0070665_100205555 3300005548 Bacteria 1970
44 Ga0075365_10008409 3300006038 Bacteria 5856
45 Ga0075365_10115788 3300006038 Bacteria 1845
46 Ga0075368_10034526 3300006042 Bacteria 1971
47 Ga0075368_10038934 3300006042 Bacteria 1862
48 Ga0075363_100232122 3300006048 Bacteria 1059
49 Ga0075364_10016127 3300006051 Bacteria 4644
50 Ga0075364_10142493 3300006051 Bacteria 1613
51 Ga0075367_10442803 3300006178 Bacteria 823
52 Ga0075369_10029183 3300006186 Bacteria 2316
53 Ga0075369_10051697 3300006186 Bacteria 1779
54 Ga0075369_10226173 3300006186 Bacteria 866
55 Ga0075369_10404567 3300006186 Bacteria 644
56 Ga0075366_10226363 3300006195 Bacteria 1139
57 Ga0099826_10000109 3300006948 Bacteria 38139
58 Ga0099826_10092557 3300006948 Bacteria 1845
59 Ga0105244_10244862 3300009036 Bacteria 837
60 Ga0105240_10649075 3300009093 Bacteria 1157
61 Ga0105243_10014434 3300009148 Bacteria 5980
62 Ga0105238_10533790 3300009551 Bacteria 1177
63 Ga0157314_1004049 3300012500 Unclassified 1064
64 Ga0157373_10012386 3300013100 Bacteria 6271
65 Ga0157373_10210739 3300013100 Bacteria 1370
66 Ga0157373_10221544 3300013100 Bacteria 1335
67 Ga0157371_10000004 3300013102 Bacteria 512593
68 Ga0157371_10032139 3300013102 Bacteria 3778
69 Ga0157370_10000185 3300013104 Bacteria 78153
70 Ga0157370_10134690 3300013104 Bacteria 2303
71 Ga0157369_10069466 3300013105 Bacteria 3784
72 Ga0157369_10565494 3300013105 Bacteria 1175
73 Ga0163161_10047981 3300017792 Bacteria 3083
74 Ga0209435_100006 3300025206 Bacteria 542459
75 Ga0209436_100012 3300025208 Bacteria 136927
76 Ga0207427_113986 3300025231 Bacteria 777
77 Ga0209437_100062 3300025233 Bacteria 336900
78 Ga0209437_100104 3300025233 Bacteria 220736
79 Ga0207425_1000018 3300025245 Bacteria 411841
80 Ga0209646_1000015 3300025246 Bacteria 542459
81 Ga0209646_1001639 3300025246 Bacteria 5745
82 Ga0209026_1000039 3300025250 Bacteria 280608
83 Ga0209148_1033094 3300025254 Bacteria 757
84 Ga0209759_1000005 3300025256 Bacteria 542459
85 Ga0209129_1000026 3300025258 Bacteria 411839
86 Ga0209233_1000054 3300025261 Bacteria 439669
87 Ga0209233_1000082 3300025261 Bacteria 336320
88 Ga0209455_1014236 3300025272 Bacteria 1809
89 Ga0209673_1002129 3300025273 Bacteria 14782
90 Ga0209673_1004049 3300025273 Bacteria 8106
91 Ga0209130_1000022 3300025284 Bacteria 361244
92 Ga0209676_1010558 3300025292 Bacteria 3828
93 Ga0209025_1000035 3300025294 Bacteria 411841
94 Ga0209025_1000060 3300025294 Bacteria 305017
95 Ga0209025_1000436 3300025294 Bacteria 82202
96 Ga0209564_1003976 3300025295 Bacteria 9390
97 Ga0209758_1000040 3300025297 Bacteria 411841
98 Ga0209758_1000853 3300025297 Bacteria 42429
99 Ga0209758_1013004 3300025297 Bacteria 4590
100 Ga0209758_1045200 3300025297 Bacteria 1601
101 Ga0209050_1012066 3300025298 Bacteria 4012
102 Ga0209256_1013709 3300025299 Unclassified 2987
103 Ga0209256_1027226 3300025299 Bacteria 1632
104 Ga0209256_1080008 3300025299 Bacteria 716
105 Ga0209256_1109095 3300025299 Unclassified 560
106 Ga0207426_1000005 3300025302 Bacteria 1037188
107 Ga0209051_1001808 3300025303 Bacteria 16953
108 Ga0209051_1037874 3300025303 Bacteria 1762
109 Ga0209257_1089276 3300025304 Bacteria 773
110 Ga0207709_10523343 3300025935 Bacteria 929
111 Ga0207668_10100363 3300025972 Bacteria 2149
112 Ga0209371_1000009 3300027312 Bacteria 963030
113 Ga0209371_1000424 3300027312 Bacteria 43444
114 Ga0209371_1003065 3300027312 Bacteria 8572
115 Ga0209282_1030376 3300027666 Bacteria 3327
116 Ga0209282_1121559 3300027666 Bacteria 1305
117 Ga0209813_10015758 3300027866 Bacteria 2053
118 Ga0209813_10074440 3300027866 Bacteria 1111
119 Ga0268266_10015688 3300028379 Bacteria 6491
120 Ga0268256_1000010 3300030500 Bacteria 963034
121 Ga0268256_1025011 3300030500 Bacteria 1523
122 Ga0316181_1017626 3300030744 Bacteria 3151
123 Ga0307405_10000728 3300031731 Bacteria 12824
124 Ga0307406_10036006 3300031901 Bacteria 3047
125 Ga0307406_10060630 3300031901 Bacteria 2440
126 Ga0307406_10804875 3300031901 Unclassified 793
127 Ga0307412_10019177 3300031911 Bacteria 4135
128 Ga0307409_100963453 3300031995 Unclassified 870
129 Ga0307409_101538195 3300031995 Unclassified 693
130 Ga0307414_10073525 3300032004 Bacteria 2473
131 Ga0307414_10143313 3300032004 Bacteria 1874
132 Ga0439465_0007849 3300041413 Bacteria 3382
133 Ga0451797_0442221 3300041453 Bacteria 613
134 Ga0451807_2018948 3300041486 Bacteria 925
135 Ga0451833_0103945 3300041491 Bacteria 13159
136 Ga0451837_1075150 3300041494 Bacteria 17021
137 Ga0451849_1353073 3300041505 Bacteria 2842
138 Ga0451843_0419974 3300041509 Bacteria 5331
139 Ga0451855_1236972 3300041511 Bacteria 9160
140 Ga0466966_0046143 3300044684 Bacteria 2783
141 Ga0466963_0000823 3300044694 Bacteria 15527
142 Ga0466964_0108454 3300044706 Bacteria 1235
143 Ga0466971_0313189 3300044719 Bacteria 755
144 Ga0466970_0005579 3300044765 Bacteria 6254
145 Ga0466959_0519176 3300045049 Bacteria 804
146 Ga0466958_0069969 3300045836 Bacteria 2147
147 Ga0466967_0208414 3300045976 Bacteria 1853
148 Ga0495638_0023950 3300046460 Bacteria 3986
149 Ga0495607_0342577 3300046501 Bacteria 692
150 Ga0495610_0001287 3300046512 Bacteria 22420
151 Ga0495632_0086965 3300046519 Bacteria 1486
152 Ga0495633_0014485 3300046558 Bacteria 4122
153 Ga0495588_0000622 3300046674 Bacteria 16604
154 Ga0495671_0193722 3300046692 Bacteria 987
155 Ga0495673_0088101 3300047469 Bacteria 1273
156 Ga0495681_0011202 3300047470 Bacteria 5360
157 Ga0495686_0004971 3300047472 Bacteria 10692
158 Ga0496100_0244535 3300048903 Bacteria 1325
159 Ga0496101_0051855 3300048904 Bacteria 2957
160 Ga0496106_0001636 3300048909 Bacteria 16807
161 Ga0496110_0190730 3300048913 Bacteria 1861
162 Ga0496111_0000411 3300048914 Bacteria 21500
163 Ga0496116_0000100 3300048919 Bacteria 194740
164 Ga0496116_0000692 3300048919 Bacteria 43664
165 Ga0496116_0010532 3300048919 Bacteria 7733
166 Ga0496116_0058530 3300048919 Bacteria 2512
167 Ga0496116_0127447 3300048919 Bacteria 1459
168 Ga0496117_0000002 3300048920 Bacteria 2483758
169 Ga0496117_0001643 3300048920 Bacteria 31420
170 Ga0496117_0006361 3300048920 Bacteria 11999
171 Ga0496117_0007393 3300048920 Bacteria 10749
172 Ga0496117_0102539 3300048920 Bacteria 1805
173 Ga0496117_0293155 3300048920 Bacteria 865
174 Ga0496118_0001493 3300048921 Bacteria 34920
175 Ga0496118_0010681 3300048921 Bacteria 9051
176 Ga0496118_0010730 3300048921 Bacteria 9032
177 Ga0496118_0275130 3300048921 Bacteria 940
178 Ga0496119_0007481 3300048922 Bacteria 9821
179 Ga0496119_0016902 3300048922 Bacteria 5521
180 Ga0496119_0026093 3300048922 Bacteria 4061
181 Ga0496119_0108089 3300048922 Bacteria 1549
182 Ga0496119_0116321 3300048922 Bacteria 1476
183 Ga0496120_0000021 3300048923 Bacteria 250966
184 Ga0496120_0112980 3300048923 Bacteria 1416
185 Ga0496121_0000001 3300048924 Bacteria 1830318
186 Ga0496121_0073094 3300048924 Bacteria 2749
187 Ga0496121_0115787 3300048924 Bacteria 2035
188 Ga0496121_0417594 3300048924 Bacteria 874
189 Ga0496121_0485426 3300048924 Bacteria 788
190 Ga0496121_0584078 3300048924 Bacteria 692
191 Ga0496122_0000001 3300048925 Bacteria 1827766
192 Ga0496122_0000494 3300048925 Bacteria 81969
193 Ga0496122_0000889 3300048925 Bacteria 55661
194 Ga0496122_0008413 3300048925 Bacteria 11146
195 Ga0496122_0033228 3300048925 Bacteria 4248
196 Ga0496122_0082785 3300048925 Bacteria 2227
197 Ga0496122_0084360 3300048925 Bacteria 2197
198 Ga0496123_0000001 3300048926 Bacteria 1831497
199 Ga0496123_0000442 3300048926 Bacteria 74540
200 Ga0496123_0003397 3300048926 Bacteria 17930
201 Ga0496123_0006606 3300048926 Bacteria 11200
202 Ga0496123_0046625 3300048926 Bacteria 2937
203 Ga0496123_0076793 3300048926 Bacteria 2054
204 Ga0496123_0226076 3300048926 Bacteria 940
205 Ga0496124_0000023 3300048927 Bacteria 415226
206 Ga0496124_0000063 3300048927 Bacteria 229705
207 Ga0496124_0003101 3300048927 Bacteria 20649
208 Ga0496124_0007381 3300048927 Bacteria 11691
209 Ga0496124_0011544 3300048927 Bacteria 8816
210 Ga0496124_0015675 3300048927 Bacteria 7250
211 Ga0496124_0107253 3300048927 Bacteria 2254
212 Ga0496124_0120110 3300048927 Bacteria 2101
213 Ga0496124_0131192 3300048927 Bacteria 1990
214 Ga0496124_0801074 3300048927 Bacteria 583
215 Ga0496125_0000001 3300048928 Bacteria 1766138
216 Ga0496125_0000422 3300048928 Bacteria 78615
217 Ga0496125_0027161 3300048928 Bacteria 5195
218 Ga0496125_0036150 3300048928 Bacteria 4318
219 Ga0496125_0045452 3300048928 Bacteria 3695
220 Ga0496126_0000094 3300048929 Bacteria 208184
221 Ga0496126_0000212 3300048929 Bacteria 128871
222 Ga0496126_0007849 3300048929 Bacteria 11628
223 Ga0496126_0043148 3300048929 Bacteria 4162
224 Ga0496126_0105881 3300048929 Bacteria 2455
225 Ga0496126_0312818 3300048929 Bacteria 1292
226 Ga0496126_1003291 3300048929 Bacteria 626
227 Ga0501031_0079042 3300049568 Bacteria 2143
228 Ga0501032_0068545 3300049569 Bacteria 2368
229 Ga0501034_0064739 3300049571 Bacteria 3669
230 Ga0501036_0232872 3300049572 Bacteria 1545
231 Ga0501043_0033181 3300049579 Bacteria 4060
232 Ga0501048_0665531 3300049582 Bacteria 748
233 Ga0501227_176812 3300049665 Unclassified 599
234 Ga0501225_0022660 3300049705 Bacteria 1734
235 Ga0501035_0175252 3300049822 Bacteria 1850
236 Ga0501045_0220563 3300049824 Bacteria 1412
237 nmdc:mga03683_101212_c1 3300050489 Bacteria 1266
238 nmdc:mga03n38_15478_c1 3300050490 Bacteria 2947
239 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
240 nmdc:mga00v17_5790_c1 3300050491 Bacteria 6527
241 nmdc:mga0yw44_1426_c2 3300050492 Bacteria 3702
242 nmdc:mga0yw44_262534_c1 3300050492 Bacteria 1151
243 nmdc:mga0yw44_5888_c1 3300050492 Bacteria 5858
244 nmdc:mga0k408_702200_c1 3300050493 Bacteria 593
245 nmdc:mga04h51_18498_c1 3300050495 Bacteria 2053
246 nmdc:mga0sz30_11796_c1 3300050516 Bacteria 1499
247 Ga0500644_0057216 3300053088 Bacteria 1360
248 Ga0500560_000852 3300053107 Bacteria 4737
249 Ga0500560_092307 3300053107 Bacteria 1012
250 Ga0500618_000041 3300053125 Bacteria 111404
251 Ga0500618_005454 3300053125 Bacteria 3864
252 Ga0500573_0000918 3300053140 Bacteria 13410
253 Ga0500573_0003057 3300053140 Bacteria 8575
254 Ga0500616_0000304 3300053153 Bacteria 71131
255 Ga0500633_0000151 3300053160 Bacteria 9308
256 Ga0500634_0000020 3300053161 Bacteria 106250
257 Ga0500634_0016676 3300053161 Bacteria 3922
258 Ga0500634_0076952 3300053161 Bacteria 1730
259 Ga0500636_0000006 3300053177 Bacteria 183899
260 Ga0500636_0129561 3300053177 Bacteria 1407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041491 Ga0451833_0103945 Ga0451833_0103945_11168_11605 145
2 3300041494 Ga0451837_1075150 Ga0451837_1075150_15137_15574 145
3 3300041505 Ga0451849_1353073 Ga0451849_1353073_11_448 145
4 3300041509 Ga0451843_0419974 Ga0451843_0419974_3511_3948 145
5 3300041511 Ga0451855_1236972 Ga0451855_1236972_1037_1474 145
6 3300046512 Ga0495610_0001287 Ga0495610_0001287_1583_2020 145
7 3300046519 Ga0495632_0086965 Ga0495632_0086965_814_1251 145
8 3300047469 Ga0495673_0088101 Ga0495673_0088101_358_795 145
9 3300047472 Ga0495686_0004971 Ga0495686_0004971_6920_7357 145
10 3300048919 Ga0496116_0010532 Ga0496116_0010532_39_476 145
11 3300048920 Ga0496117_0006361 Ga0496117_0006361_6791_7228 145
12 3300048921 Ga0496118_0010730 Ga0496118_0010730_8241_8678 145
13 3300048924 Ga0496121_0417594 Ga0496121_0417594_104_541 145
14 3300048925 Ga0496122_0000889 Ga0496122_0000889_23935_24372 145
15 3300048926 Ga0496123_0003397 Ga0496123_0003397_3141_3578 145
16 3300048927 Ga0496124_0000023 Ga0496124_0000023_276294_276731 145
17 3300049705 Ga0501225_0022660 Ga0501225_0022660_604_1068 152
18 iso_pu_bacteria 2510461069 2510843764 154
19 iso_pu_bacteria 2510917026 2511171175 154
20 iso_pu_bacteria 2582581304 2585258836 154
21 iso_pu_bacteria 2582581316 2585334996 154
22 iso_pu_bacteria 2585427594 2585846138 154
23 iso_pu_bacteria 2599185236 2599717949 154
24 iso_pu_bacteria 2600254933 2600376928 154
25 iso_pu_bacteria 2615840698 2616552888 154
26 iso_pu_bacteria 2617270742 2617381336 154
27 iso_pu_bacteria 2643221558 2643814443 154
28 iso_pu_bacteria 2643221653 2644298280 154
29 iso_pu_bacteria 2643221719 2644659219 154
30 iso_pu_bacteria 2667528174 2671114659 154
31 iso_pu_bacteria 2738541293 2738799871 154
32 iso_pu_bacteria 2775507049 2776911356 154
33 iso_pu_bacteria 2775507266 2778174521 154
34 iso_pu_bacteria 2818991272 2819243308 154
35 iso_pu_bacteria 2818991272 2819245316 154
36 iso_pu_bacteria 2818991448 2819607791 154
37 iso_pu_bacteria 2838029111 2838032595 154
38 iso_pu_bacteria 2842475841 2842479327 154
39 iso_pu_bacteria 2842482326 2842485438 154
40 iso_pu_bacteria 2842502639 2842506514 154
41 iso_pu_bacteria 2854896431 2854900597 154
42 iso_pu_bacteria 2891373044 2891375589 154
43 iso_pu_bacteria 2919171160 2919175504 154
44 iso_pu_bacteria 2919408235 2919413387 154
45 iso_pu_bacteria 2989349275 2989353871 154
46 iso_pu_bacteria 2989776772 2989781525 154
47 iso_pu_bacteria 3003930520 3003935351 154
48 iso_pu_bacteria 3005416602 3005422209 154
49 iso_pu_bacteria 8005246636 8005250170 154
50 iso_pu_bacteria 8005314921 8005321488 154
51 iso_pu_bacteria 8005484373 8005489767 154
52 iso_pu_bacteria 8005645114 8005650637 154
53 iso_pu_bacteria 8005682033 8005683687 154
54 iso_pu_bacteria 8018150411 8018150931 154
55 iso_pu_bacteria 8054558443 8054561588 154
56 iso_pu_bacteria 2585427633 2585995465 155
57 iso_pu_bacteria 2585427634 2586000068 155
58 iso_pu_bacteria 2775507255 2778124871 156
59 iso_pu_bacteria 2989771324 2989773945 156
60 3300041486 Ga0451807_2018948 Ga0451807_2018948_44_532 157
61 iso_pu_bacteria 2932401849 2932403653 157
62 3300002704 JGI25155J39150_1000003 JGI25155J39150_1000003145 158
63 3300002705 JGI25156J39149_1000004 JGI25156J39149_1000004139 158
64 3300002737 JGI25162J39368_1000570 JGI25162J39368_100057011 158
65 3300002737 JGI25162J39368_1006124 JGI25162J39368_10061243 158
66 3300002738 JGI25154J39366_1000013 JGI25154J39366_1000013222 158
67 3300002741 JGI25157J39369_1000004 JGI25157J39369_1000004139 158
68 3300002771 JGI25163J39215_1007053 JGI25163J39215_10070531 158
69 3300002774 JGI25150J39212_1000155 JGI25150J39212_100015513 158
70 3300002987 JGI25159J45721_1000308 JGI25159J45721_10003088 158
71 3300003187 JGI25151J46595_10000007 JGI25151J46595_10000007113 158
72 3300003187 JGI25151J46595_10011697 JGI25151J46595_100116972 158
73 3300003214 JGI25165J46597_1000263 JGI25165J46597_100026353 158
74 3300003214 JGI25165J46597_1001021 JGI25165J46597_100102111 158
75 3300003215 JGI25153J46596_10000569 JGI25153J46596_100005694 158
76 3300003215 JGI25153J46596_10031347 JGI25153J46596_100313472 158
77 3300003316 rootH1_10007216 rootH1_1000721611 158
78 3300003320 rootH2_10026419 rootH2_100264192 158
79 3300003320 rootH2_10099275 rootH2_100992756 158
80 3300003320 rootH2_10171268 rootH2_101712682 158
81 3300003322 rootL2_10002196 rootL2_1000219645 158
82 3300003322 rootL2_10338264 rootL2_103382643 158
83 3300003323 rootH1_10016790 rootH1_100167902 158
84 3300003323 rootH1_10185923 rootH1_101859233 158
85 3300003323 rootH1_10269314 rootH1_102693146 158
86 3300003354 JGI25160J50197_1019408 JGI25160J50197_10194082 158
87 3300003374 JGI25161J50226_1000231 JGI25161J50226_100023128 158
88 3300003771 Ga0055526_1002902 Ga0055526_10029024 158
89 3300003775 Ga0055524_1004464 Ga0055524_10044643 158
90 3300003790 Ga0055528_1002564 Ga0055528_10025644 158
91 3300003791 Ga0055530_10027113 Ga0055530_100271131 158
92 3300003792 Ga0055540_1014842 Ga0055540_10148422 158
93 3300003794 Ga0055531_10033074 Ga0055531_100330742 158
94 3300003856 Ga0058692_1000651 Ga0058692_10006514 158
95 3300003856 Ga0058692_1003220 Ga0058692_10032204 158
96 3300003856 Ga0058692_1029020 Ga0058692_10290203 158
97 3300004625 Ga0055543_1000190 Ga0055543_100019043 158
98 3300005262 Ga0065165_1006054 Ga0065165_10060544 158
99 3300005289 Ga0065704_10132416 Ga0065704_101324163 158
100 3300005347 Ga0070668_100009809 Ga0070668_1000098095 158
101 3300005455 Ga0070663_100326172 Ga0070663_1003261721 158
102 3300005548 Ga0070665_100005844 Ga0070665_1000058444 158
103 3300005548 Ga0070665_100205555 Ga0070665_1002055552 158
104 3300006038 Ga0075365_10008409 Ga0075365_100084097 158
105 3300006038 Ga0075365_10115788 Ga0075365_101157885 158
106 3300006042 Ga0075368_10034526 Ga0075368_100345263 158
107 3300006042 Ga0075368_10038934 Ga0075368_100389344 158
108 3300006048 Ga0075363_100232122 Ga0075363_1002321222 158
109 3300006051 Ga0075364_10016127 Ga0075364_100161273 158
110 3300006051 Ga0075364_10142493 Ga0075364_101424932 158
111 3300006178 Ga0075367_10442803 Ga0075367_104428032 158
112 3300006186 Ga0075369_10029183 Ga0075369_100291834 158
113 3300006186 Ga0075369_10051697 Ga0075369_100516972 158
114 3300006186 Ga0075369_10226173 Ga0075369_102261733 158
115 3300006186 Ga0075369_10404567 Ga0075369_104045671 158
116 3300006195 Ga0075366_10226363 Ga0075366_102263633 158
117 3300006948 Ga0099826_10000109 Ga0099826_1000010916 158
118 3300006948 Ga0099826_10092557 Ga0099826_100925572 158
119 3300009036 Ga0105244_10244862 Ga0105244_102448621 158
120 3300009093 Ga0105240_10649075 Ga0105240_106490752 158
121 3300009148 Ga0105243_10014434 Ga0105243_100144344 158
122 3300009551 Ga0105238_10533790 Ga0105238_105337902 158
123 3300012500 Ga0157314_1004049 Ga0157314_10040493 158
124 3300013100 Ga0157373_10012386 Ga0157373_100123867 158
125 3300013100 Ga0157373_10210739 Ga0157373_102107392 158
126 3300013100 Ga0157373_10221544 Ga0157373_102215443 158
127 3300013102 Ga0157371_10000004 Ga0157371_10000004397 158
128 3300013102 Ga0157371_10032139 Ga0157371_100321392 158
129 3300013104 Ga0157370_10000185 Ga0157370_1000018539 158
130 3300013104 Ga0157370_10134690 Ga0157370_101346904 158
131 3300013105 Ga0157369_10069466 Ga0157369_100694663 158
132 3300013105 Ga0157369_10565494 Ga0157369_105654942 158
133 3300017792 Ga0163161_10047981 Ga0163161_100479815 158
134 3300025206 Ga0209435_100006 Ga0209435_100006138 158
135 3300025208 Ga0209436_100012 Ga0209436_10001246 158
136 3300025231 Ga0207427_113986 Ga0207427_1139862 158
137 3300025233 Ga0209437_100062 Ga0209437_10006212 158
138 3300025233 Ga0209437_100104 Ga0209437_10010435 158
139 3300025245 Ga0207425_1000018 Ga0207425_1000018218 158
140 3300025246 Ga0209646_1000015 Ga0209646_1000015397 158
141 3300025246 Ga0209646_1001639 Ga0209646_10016394 158
142 3300025250 Ga0209026_1000039 Ga0209026_1000039138 158
143 3300025254 Ga0209148_1033094 Ga0209148_10330942 158
144 3300025256 Ga0209759_1000005 Ga0209759_1000005138 158
145 3300025258 Ga0209129_1000026 Ga0209129_1000026111 158
146 3300025261 Ga0209233_1000054 Ga0209233_1000054101 158
147 3300025261 Ga0209233_1000082 Ga0209233_100008212 158
148 3300025272 Ga0209455_1014236 Ga0209455_10142362 158
149 3300025273 Ga0209673_1002129 Ga0209673_10021297 158
150 3300025273 Ga0209673_1004049 Ga0209673_10040497 158
151 3300025284 Ga0209130_1000022 Ga0209130_1000022144 158
152 3300025292 Ga0209676_1010558 Ga0209676_10105584 158
153 3300025294 Ga0209025_1000035 Ga0209025_1000035111 158
154 3300025294 Ga0209025_1000060 Ga0209025_1000060264 158
155 3300025294 Ga0209025_1000436 Ga0209025_100043613 158
156 3300025295 Ga0209564_1003976 Ga0209564_10039767 158
157 3300025297 Ga0209758_1000040 Ga0209758_1000040111 158
158 3300025297 Ga0209758_1000853 Ga0209758_100085313 158
159 3300025297 Ga0209758_1013004 Ga0209758_10130046 158
160 3300025297 Ga0209758_1045200 Ga0209758_10452002 158
161 3300025298 Ga0209050_1012066 Ga0209050_10120664 158
162 3300025299 Ga0209256_1013709 Ga0209256_10137095 158
163 3300025299 Ga0209256_1027226 Ga0209256_10272262 158
164 3300025299 Ga0209256_1080008 Ga0209256_10800082 158
165 3300025299 Ga0209256_1109095 Ga0209256_11090951 158
166 3300025302 Ga0207426_1000005 Ga0207426_1000005101 158
167 3300025303 Ga0209051_1001808 Ga0209051_100180815 158
168 3300025303 Ga0209051_1037874 Ga0209051_10378742 158
169 3300025304 Ga0209257_1089276 Ga0209257_10892762 158
170 3300025935 Ga0207709_10523343 Ga0207709_105233432 158
171 3300025972 Ga0207668_10100363 Ga0207668_101003632 158
172 3300027312 Ga0209371_1000009 Ga0209371_1000009530 158
173 3300027312 Ga0209371_1000424 Ga0209371_100042415 158
174 3300027312 Ga0209371_1003065 Ga0209371_10030654 158
175 3300027666 Ga0209282_1030376 Ga0209282_10303762 158
176 3300027666 Ga0209282_1121559 Ga0209282_11215593 158
177 3300027866 Ga0209813_10015758 Ga0209813_100157583 158
178 3300027866 Ga0209813_10074440 Ga0209813_100744402 158
179 3300028379 Ga0268266_10015688 Ga0268266_100156884 158
180 3300030500 Ga0268256_1000010 Ga0268256_1000010529 158
181 3300030500 Ga0268256_1025011 Ga0268256_10250113 158
182 3300030744 Ga0316181_1017626 Ga0316181_10176267 158
183 3300031731 Ga0307405_10000728 Ga0307405_100007284 158
184 3300031901 Ga0307406_10036006 Ga0307406_100360062 158
185 3300031901 Ga0307406_10060630 Ga0307406_100606302 158
186 3300031901 Ga0307406_10804875 Ga0307406_108048751 158
187 3300031911 Ga0307412_10019177 Ga0307412_100191773 158
188 3300031995 Ga0307409_100963453 Ga0307409_1009634532 158
189 3300031995 Ga0307409_101538195 Ga0307409_1015381952 158
190 3300032004 Ga0307414_10073525 Ga0307414_100735252 158
191 3300032004 Ga0307414_10143313 Ga0307414_101433131 158
192 3300041413 Ga0439465_0007849 Ga0439465_0007849_1740_2216 158
193 3300041453 Ga0451797_0442221 Ga0451797_0442221_11_499 158
194 3300044684 Ga0466966_0046143 Ga0466966_0046143_1858_2334 158
195 3300044694 Ga0466963_0000823 Ga0466963_0000823_2909_3385 158
196 3300044706 Ga0466964_0108454 Ga0466964_0108454_139_615 158
197 3300044719 Ga0466971_0313189 Ga0466971_0313189_245_721 158
198 3300044765 Ga0466970_0005579 Ga0466970_0005579_4123_4599 158
199 3300045049 Ga0466959_0519176 Ga0466959_0519176_225_701 158
200 3300045836 Ga0466958_0069969 Ga0466958_0069969_896_1372 158
201 3300045976 Ga0466967_0208414 Ga0466967_0208414_24_500 158
202 3300046460 Ga0495638_0023950 Ga0495638_0023950_904_1380 158
203 3300046501 Ga0495607_0342577 Ga0495607_0342577_196_672 158
204 3300046558 Ga0495633_0014485 Ga0495633_0014485_539_1027 158
205 3300046674 Ga0495588_0000622 Ga0495588_0000622_4353_4838 158
206 3300046692 Ga0495671_0193722 Ga0495671_0193722_331_819 158
207 3300047470 Ga0495681_0011202 Ga0495681_0011202_1711_2199 158
208 3300048903 Ga0496100_0244535 Ga0496100_0244535_10_486 158
209 3300048904 Ga0496101_0051855 Ga0496101_0051855_851_1327 158
210 3300048909 Ga0496106_0001636 Ga0496106_0001636_10001_10477 158
211 3300048913 Ga0496110_0190730 Ga0496110_0190730_943_1419 158
212 3300048914 Ga0496111_0000411 Ga0496111_0000411_18009_18485 158
213 3300048919 Ga0496116_0000100 Ga0496116_0000100_93537_94025 158
214 3300048919 Ga0496116_0000692 Ga0496116_0000692_6775_7251 158
215 3300048919 Ga0496116_0058530 Ga0496116_0058530_685_1173 158
216 3300048919 Ga0496116_0127447 Ga0496116_0127447_629_1117 158
217 3300048920 Ga0496117_0000002 Ga0496117_0000002_2059464_2059952 158
218 3300048920 Ga0496117_0001643 Ga0496117_0001643_17836_18312 158
219 3300048920 Ga0496117_0007393 Ga0496117_0007393_4708_5184 158
220 3300048920 Ga0496117_0102539 Ga0496117_0102539_1238_1726 158
221 3300048920 Ga0496117_0293155 Ga0496117_0293155_113_589 158
222 3300048921 Ga0496118_0001493 Ga0496118_0001493_27627_28115 158
223 3300048921 Ga0496118_0010681 Ga0496118_0010681_6347_6823 158
224 3300048921 Ga0496118_0275130 Ga0496118_0275130_427_915 158
225 3300048922 Ga0496119_0007481 Ga0496119_0007481_7931_8416 158
226 3300048922 Ga0496119_0016902 Ga0496119_0016902_4719_5195 158
227 3300048922 Ga0496119_0026093 Ga0496119_0026093_3524_4000 158
228 3300048922 Ga0496119_0108089 Ga0496119_0108089_970_1458 158
229 3300048922 Ga0496119_0116321 Ga0496119_0116321_659_1135 158
230 3300048923 Ga0496120_0000021 Ga0496120_0000021_6623_7111 158
231 3300048923 Ga0496120_0112980 Ga0496120_0112980_683_1159 158
232 3300048924 Ga0496121_0000001 Ga0496121_0000001_153275_153763 158
233 3300048924 Ga0496121_0073094 Ga0496121_0073094_45_521 158
234 3300048924 Ga0496121_0115787 Ga0496121_0115787_1072_1557 158
235 3300048924 Ga0496121_0485426 Ga0496121_0485426_281_769 158
236 3300048924 Ga0496121_0584078 Ga0496121_0584078_151_639 158
237 3300048925 Ga0496122_0000001 Ga0496122_0000001_1430254_1430742 158
238 3300048925 Ga0496122_0000494 Ga0496122_0000494_13934_14410 158
239 3300048925 Ga0496122_0008413 Ga0496122_0008413_1391_1879 158
240 3300048925 Ga0496122_0033228 Ga0496122_0033228_179_655 158
241 3300048925 Ga0496122_0082785 Ga0496122_0082785_1183_1659 158
242 3300048925 Ga0496122_0084360 Ga0496122_0084360_66_542 158
243 3300048926 Ga0496123_0000001 Ga0496123_0000001_1433985_1434473 158
244 3300048926 Ga0496123_0000442 Ga0496123_0000442_60131_60607 158
245 3300048926 Ga0496123_0006606 Ga0496123_0006606_9697_10173 158
246 3300048926 Ga0496123_0046625 Ga0496123_0046625_2001_2477 158
247 3300048926 Ga0496123_0076793 Ga0496123_0076793_719_1207 158
248 3300048926 Ga0496123_0226076 Ga0496123_0226076_44_532 158
249 3300048927 Ga0496124_0000063 Ga0496124_0000063_196490_196978 158
250 3300048927 Ga0496124_0003101 Ga0496124_0003101_17666_18142 158
251 3300048927 Ga0496124_0007381 Ga0496124_0007381_409_897 158
252 3300048927 Ga0496124_0011544 Ga0496124_0011544_637_1113 158
253 3300048927 Ga0496124_0015675 Ga0496124_0015675_2543_3031 158
254 3300048927 Ga0496124_0107253 Ga0496124_0107253_1068_1544 158
255 3300048927 Ga0496124_0120110 Ga0496124_0120110_1064_1540 158
256 3300048927 Ga0496124_0131192 Ga0496124_0131192_1470_1946 158
257 3300048927 Ga0496124_0801074 Ga0496124_0801074_10_486 158
258 3300048928 Ga0496125_0000001 Ga0496125_0000001_266720_267208 158
259 3300048928 Ga0496125_0000422 Ga0496125_0000422_68278_68754 158
260 3300048928 Ga0496125_0027161 Ga0496125_0027161_1080_1556 158
261 3300048928 Ga0496125_0036150 Ga0496125_0036150_1209_1694 158
262 3300048928 Ga0496125_0045452 Ga0496125_0045452_1137_1613 158
263 3300048929 Ga0496126_0000094 Ga0496126_0000094_201638_202126 158
264 3300048929 Ga0496126_0000212 Ga0496126_0000212_103905_104441 158
265 3300048929 Ga0496126_0007849 Ga0496126_0007849_6506_6982 158
266 3300048929 Ga0496126_0043148 Ga0496126_0043148_1666_2142 158
267 3300048929 Ga0496126_0105881 Ga0496126_0105881_489_965 158
268 3300048929 Ga0496126_0312818 Ga0496126_0312818_318_806 158
269 3300048929 Ga0496126_1003291 Ga0496126_1003291_37_513 158
270 3300049568 Ga0501031_0079042 Ga0501031_0079042_1169_1645 158
271 3300049569 Ga0501032_0068545 Ga0501032_0068545_861_1337 158
272 3300049571 Ga0501034_0064739 Ga0501034_0064739_1647_2123 158
273 3300049572 Ga0501036_0232872 Ga0501036_0232872_614_1090 158
274 3300049579 Ga0501043_0033181 Ga0501043_0033181_40_516 158
275 3300049582 Ga0501048_0665531 Ga0501048_0665531_107_595 158
276 3300049665 Ga0501227_176812 Ga0501227_176812_64_540 158
277 3300049822 Ga0501035_0175252 Ga0501035_0175252_162_638 158
278 3300049824 Ga0501045_0220563 Ga0501045_0220563_492_968 158
279 3300050489 nmdc:mga03683_101212_c1 nmdc:mga03683_101212_c1_562_1050 158
280 3300050490 nmdc:mga03n38_15478_c1 nmdc:mga03n38_15478_c1_929_1417 158
281 3300050491 nmdc:mga00v17_48_c1 nmdc:mga00v17_48_c1_30971_31459 158
282 3300050491 nmdc:mga00v17_5790_c1 nmdc:mga00v17_5790_c1_4060_4548 158
283 3300050492 nmdc:mga0yw44_1426_c2 nmdc:mga0yw44_1426_c2_535_1023 158
284 3300050492 nmdc:mga0yw44_262534_c1 nmdc:mga0yw44_262534_c1_206_691 158
285 3300050492 nmdc:mga0yw44_5888_c1 nmdc:mga0yw44_5888_c1_1186_1662 158
286 3300050493 nmdc:mga0k408_702200_c1 nmdc:mga0k408_702200_c1_89_577 158
287 3300050495 nmdc:mga04h51_18498_c1 nmdc:mga04h51_18498_c1_701_1189 158
288 3300050516 nmdc:mga0sz30_11796_c1 nmdc:mga0sz30_11796_c1_613_1101 158
289 3300053088 Ga0500644_0057216 Ga0500644_0057216_689_1165 158
290 3300053107 Ga0500560_000852 Ga0500560_000852_928_1413 158
291 3300053107 Ga0500560_092307 Ga0500560_092307_501_986 158
292 3300053125 Ga0500618_000041 Ga0500618_000041_31866_32342 158
293 3300053125 Ga0500618_005454 Ga0500618_005454_1726_2202 158
294 3300053140 Ga0500573_0000918 Ga0500573_0000918_424_900 158
295 3300053140 Ga0500573_0003057 Ga0500573_0003057_4904_5380 158
296 3300053153 Ga0500616_0000304 Ga0500616_0000304_16702_17178 158
297 3300053160 Ga0500633_0000151 Ga0500633_0000151_8620_9096 158
298 3300053161 Ga0500634_0000020 Ga0500634_0000020_65203_65691 158
299 3300053161 Ga0500634_0016676 Ga0500634_0016676_1021_1509 158
300 3300053161 Ga0500634_0076952 Ga0500634_0076952_1131_1619 158
301 3300053177 Ga0500636_0000006 Ga0500636_0000006_117506_117994 158
302 3300053177 Ga0500636_0129561 Ga0500636_0129561_59_547 158
303 iso_pu_bacteria 2537561587 2537876011 158
304 iso_pu_bacteria 2554235003 2554246541 158
305 iso_pu_bacteria 2558860242 2559293716 158
306 iso_pu_bacteria 2599185210 2599606024 158
307 iso_pu_bacteria 2600255279 2601609259 158
308 iso_pu_bacteria 2600255308 2601746034 158
309 iso_pu_bacteria 2643221568 2643855216 158
310 iso_pu_bacteria 2643221582 2643918311 158
311 iso_pu_bacteria 2643221693 2644519317 158
312 iso_pu_bacteria 2808606387 2808986456 158
313 iso_pu_bacteria 2818991439 2819556586 158
314 iso_pu_bacteria 2838675328 2838677314 158
315 iso_pu_bacteria 2838714209 2838716202 158
316 iso_pu_bacteria 2838719591 2838719998 158
317 iso_pu_bacteria 2838724970 2838726954 158
318 iso_pu_bacteria 2841846520 2841846930 158
319 iso_pu_bacteria 2841859092 2841860542 158
320 iso_pu_bacteria 2842124991 2842127041 158
321 iso_pu_bacteria 2842130223 2842132207 158
322 iso_pu_bacteria 2842152218 2842152624 158
323 iso_pu_bacteria 2842170452 2842172447 158
324 iso_pu_bacteria 2842175837 2842176243 158
325 iso_pu_bacteria 2842187318 2842189309 158
326 iso_pu_bacteria 2842211629 2842213623 158
327 iso_pu_bacteria 2842224351 2842224759 158
328 iso_pu_bacteria 2842515876 2842517327 158
329 iso_pu_bacteria 2899792073 2899792624 158
330 iso_pu_bacteria 2899845264 2899846006 158
331 iso_pu_bacteria 2919114240 2919116405 158
332 iso_pu_bacteria 2919166419 2919166787 158
333 iso_pu_bacteria 2926754445 2926757359 158
334 iso_pu_bacteria 2926760298 2926761575 158
335 iso_pu_bacteria 2929138655 2929138720 158
336 iso_pu_bacteria 2933006813 2933007269 158
337 iso_pu_bacteria 2933011516 2933015140 158
338 iso_pu_bacteria 2933594066 2933594474 158
339 iso_pu_bacteria 2978969890 2978973203 158
340 iso_pu_bacteria 2979089926 2979093135 158
341 iso_pu_bacteria 2979095461 2979099478 158
342 iso_pu_bacteria 2979100975 2979105102 158
343 iso_pu_bacteria 2984509177 2984513056 158
344 iso_pu_bacteria 2984518228 2984520579 158
345 iso_pu_bacteria 2984537506 2984539873 158
346 iso_pu_bacteria 2984587000 2984591451 158
347 iso_pu_bacteria 2984601300 2984602080 158
348 iso_pu_bacteria 650716007 650738958 158
349 iso_pu_bacteria 8003570095 8003572590 158
350 iso_pu_bacteria 8054460903 8054461232 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

28

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.8381 87 147
6fon-assembly1.cif.gz_C elongated conformer of the human copper chaperone for sod1 complexed with human sod1 0.816 90 145
6fp6-assembly4.cif.gz_H complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.8133 87 145
6fp6-assembly1.cif.gz_B complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.81 87 149
6fp6-assembly8.cif.gz_P complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.8096 85 149
ID Description Score Start End Superfamily
af_I1JD23_3_71_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8686 87 132 3.30.70.100
af_Q6H7M3_184_260_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8572 90 136 3.30.70.100
af_A0A1D6NFU6_1_73_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8514 89 136 3.30.70.100
af_B6SZL4_173_238_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.845 87 148 3.30.70.100
af_K7KE01_9_82_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8429 89 148 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Q3SMI3-F1-model_v4 Na+/H+ antiporter subunit E 0.9232 72 158 GO:0005886
GO:0008324
AF-A0A7W7V745-F1-model_v4 Multisubunit Na+/H+ antiporter MnhE subunit 0.9161 52 157 GO:0005886
GO:0008324
AF-M4V7H7-F1-model_v4 Uncharacterized protein 0.916 56 158 GO:0005886
GO:0008324
AF-A0A261T650-F1-model_v4 Sodium:proton antiporter 0.9136 51 156 GO:0005886
GO:0008324
AF-A0A3C0HIQ6-F1-model_v4 Sodium:proton antiporter 0.9134 53 157 GO:0005886
GO:0008324

Feature Viewer

pLDDT pTM Quality
84.24 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map