F418376

General Info

Members Datasets Scaffolds Average Seq Length
350 257 700 267

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0102773|Ga0495649_0102773_159_1019
Length 286
Sequence LLWEKKVCKKFKKRRWLGIMSIPVIYVVSDSVGETAELVTKAAITQFNGSGMILKRFPYVEDKEHIDEVISLVKMDKGMIAFTLVKPDMREYIQNAAEKEGIYACDLIGPLMDQIQELTGKVPLCEPGLVRKLDEDYFKKVEAIEFAVKYDDGRDPRGIMKADIVLIGVSRTSKTPLSQYLALKRLKVANVPLVPEVEPPEELYKVPPEKCFGLKISPEKLNNIRRERLISLGLNDQASYANIERIKEELVFFEKVVSRINCPIIDVTNKAVEETANEILNFIHKR

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
23 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
37 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
38 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
46 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
47 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
55 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
56 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
57 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
58 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
59 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
62 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
74 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
95 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
96 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
97 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
98 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
99 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
100 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
101 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
102 2554235283 Bacillus safensis VK Isolate Rhizosphere
103 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
104 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
105 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
106 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
107 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
108 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
109 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
110 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
111 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
112 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
113 2643221729 Bacillus sp. Root11 Isolate Unclassified
114 2643221730 Bacillus sp. Root131 Isolate Unclassified
115 2643221731 Bacillus sp. Root147 Isolate Unclassified
116 2643221732 Bacillus sp. Root239 Isolate Unclassified
117 2643221735 Bacillus sp. Root920 Isolate Unclassified
118 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
119 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
120 2671180694 Paenibacillus sp. A3 Isolate Unclassified
121 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
122 2684622632 Bacillus cereus 905 Isolate Unclassified
123 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
124 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
125 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
126 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
127 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
128 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
129 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
130 2738541295 Bacillus sp. OK085 Isolate Unclassified
131 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
132 2738541358 Bacillus sp. OV752 Isolate Unclassified
133 2738543006 Bacillus sp. OK077 Isolate Unclassified
134 2738543010 Bacillus sp. YR335 Isolate Unclassified
135 2738543017 Bacillus sp. OV186 Isolate Unclassified
136 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
137 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
138 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
139 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
140 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
141 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
142 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
143 2811994870 Bacillus sp. JB4 Isolate Unclassified
144 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
145 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
146 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
147 2818991441 Niallia circulans 3243 Isolate Rhizosphere
148 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
149 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
150 2818991459 Paenibacillus sp. 597 Isolate Unclassified
151 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
152 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
153 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
154 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
155 2842682962 Bacillus sp. R-72492 Isolate Unclassified
156 2842882022 Bacillus sp. R-71893 Isolate Unclassified
157 2849139964 Bacillus sp. R-71875 Isolate Unclassified
158 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
159 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
160 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
161 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
162 2857472729 Cohnella sp. R-74144 Isolate Unclassified
163 2857581216 Bacillus sp. R-71922 Isolate Unclassified
164 2857586860 Bacillus sp. R-71935 Isolate Unclassified
165 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
166 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
167 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
168 2860837431 Bacillus sp. WR11 Isolate Unclassified
169 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
170 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
171 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
172 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
173 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
174 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
175 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
176 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
177 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
178 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
179 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
180 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
181 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
182 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
183 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
184 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
185 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
186 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
187 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
188 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
189 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
190 2919720352 Priestia megaterium 4340 Isolate Unclassified
191 2919726948 Bacillus pumilus 4489 Isolate Unclassified
192 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
193 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
194 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
195 2929004312 Priestia megaterium 1104 Isolate Unclassified
196 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
197 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
198 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
199 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
200 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
201 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
202 2938917290 Bacillus sp. CR71 Isolate Unclassified
203 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
204 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
205 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
206 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
207 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
208 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
209 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
210 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
211 2965761152 Bacillus sp. COPE52 Isolate Unclassified
212 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
213 2969141011 Bacillus velezensis MH25 Isolate Unclassified
214 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
215 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
216 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
217 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
218 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
219 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
220 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
221 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
222 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
223 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
224 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
225 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
226 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
227 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
228 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
229 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
230 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
231 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
232 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
233 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
234 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
235 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
236 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
237 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
238 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
239 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
240 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
241 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
242 8022653035 Bacillus sp. Rc4 Isolate Unclassified
243 8022792930 Bacillus sp. Xin Isolate Rhizosphere
244 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
245 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
246 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
247 8023438354 Bacillus sp. BH2 Isolate Unclassified
248 8023444577 Bacillus sp. BH32 Isolate Unclassified
249 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
250 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
251 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
252 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
253 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
254 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
255 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
256 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
257 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 42.57
Metatranscriptomes 8
Isolates 49.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 0.57
Rhizoplane 7.14
Rhizosphere 47.43
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0102773 3300046694 Bacteria 1518
2 JGI25151J46595_10000006 3300003187 Bacteria 419711
3 JGI25151J46595_10006593 3300003187 Bacteria 5806
4 JGI25151J46595_10008020 3300003187 Bacteria 5119
5 JGI25151J46595_10009449 3300003187 Bacteria 4615
6 JGI25151J46595_10011908 3300003187 Bacteria 3977
7 JGI25151J46595_10014848 3300003187 Bacteria 3456
8 JGI25151J46595_10018886 3300003187 Bacteria 2945
9 JGI25151J46595_10049893 3300003187 Bacteria 1431
10 JGI25151J46595_10057001 3300003187 Bacteria 1277
11 JGI25151J46595_10075917 3300003187 Bacteria 995
12 JGI25151J46595_10089862 3300003187 Bacteria 859
13 rootH1_10000457 3300003316 Bacteria 39363
14 rootH2_10056773 3300003320 Bacteria 5708
15 rootL2_10004995 3300003322 Bacteria 33898
16 Ga0006562J51391_1001146 3300003578 Bacteria 47560
17 Ga0006562J51391_1001176 3300003578 Bacteria 6340
18 Ga0006562J51391_1001442 3300003578 Bacteria 20940
19 Ga0006562J51391_1004050 3300003578 Bacteria 4220
20 Ga0055538_1000233 3300003751 Bacteria 30999
21 Ga0055532_1000046 3300003758 Bacteria 182389
22 Ga0055532_1002155 3300003758 Bacteria 4396
23 Ga0055536_1027134 3300003781 Bacteria 1591
24 Ga0055528_1001481 3300003790 Bacteria 14268
25 Ga0105251_10057237 3300009011 Bacteria 1843
26 Ga0105244_10042031 3300009036 Bacteria 2366
27 Ga0105244_10065846 3300009036 Bacteria 1814
28 Ga0105244_10081969 3300009036 Bacteria 1595
29 Ga0105244_10109846 3300009036 Bacteria 1342
30 Ga0105250_10001260 3300009092 Bacteria 13993
31 Ga0105250_10044980 3300009092 Bacteria 1770
32 Ga0105250_10101796 3300009092 Bacteria 1172
33 Ga0105247_10004353 3300009101 Bacteria 9053
34 Ga0105243_10002181 3300009148 Bacteria 16523
35 Ga0105242_10001993 3300009176 Bacteria 16071
36 Ga0105239_11103572 3300010375 Bacteria 913
37 Ga0105246_10000276 3300011119 Bacteria 26748
38 Ga0105246_10078381 3300011119 Bacteria 2346
39 Ga0157371_10002286 3300013102 Bacteria 18467
40 Ga0157374_10276520 3300013296 Bacteria 1657
41 Ga0157378_10003046 3300013297 Bacteria 14903
42 Ga0157377_10006785 3300014745 Bacteria 5485
43 Ga0209784_100099 3300025224 Bacteria 101738
44 Ga0209566_100022 3300025225 Bacteria 403259
45 Ga0209566_100248 3300025225 Bacteria 51716
46 Ga0209147_100014 3300025229 Bacteria 597841
47 Ga0209147_100068 3300025229 Bacteria 230150
48 Ga0209147_100519 3300025229 Bacteria 22359
49 Ga0209147_100618 3300025229 Bacteria 19323
50 Ga0209147_109705 3300025229 Bacteria 1133
51 Ga0209673_1002814 3300025273 Bacteria 11246
52 Ga0209130_1002012 3300025284 Bacteria 11080
53 Ga0209130_1005420 3300025284 Bacteria 4426
54 Ga0209130_1008340 3300025284 Bacteria 3070
55 Ga0209130_1009149 3300025284 Bacteria 2853
56 Ga0209130_1012990 3300025284 Bacteria 2152
57 Ga0209676_1000783 3300025292 Bacteria 42336
58 Ga0209676_1002921 3300025292 Bacteria 11176
59 Ga0209676_1014882 3300025292 Bacteria 2896
60 Ga0209676_1023851 3300025292 Bacteria 1994
61 Ga0209025_1000001 3300025294 Bacteria 1888151
62 Ga0209025_1000539 3300025294 Bacteria 71638
63 Ga0209025_1001023 3300025294 Bacteria 41159
64 Ga0209025_1003755 3300025294 Bacteria 13922
65 Ga0209025_1004088 3300025294 Bacteria 13010
66 Ga0209025_1004904 3300025294 Bacteria 11258
67 Ga0209025_1005331 3300025294 Bacteria 10551
68 Ga0209025_1008720 3300025294 Bacteria 7230
69 Ga0209025_1015244 3300025294 Bacteria 4652
70 Ga0209025_1015420 3300025294 Bacteria 4606
71 Ga0209025_1020687 3300025294 Bacteria 3582
72 Ga0209025_1021371 3300025294 Bacteria 3489
73 Ga0209025_1033756 3300025294 Bacteria 2356
74 Ga0209025_1037420 3300025294 Bacteria 2153
75 Ga0209025_1050085 3300025294 Bacteria 1673
76 Ga0209025_1067542 3300025294 Bacteria 1291
77 Ga0209025_1077674 3300025294 Bacteria 1143
78 Ga0207426_1043198 3300025302 Bacteria 1386
79 Ga0207696_1001570 3300025711 Bacteria 12152
80 Ga0207696_1013027 3300025711 Bacteria 2916
81 Ga0207696_1013132 3300025711 Bacteria 2901
82 Ga0207655_1021566 3300025728 Bacteria 3265
83 Ga0207655_1101096 3300025728 Bacteria 993
84 Ga0207713_1002283 3300025735 Bacteria 14125
85 Ga0207713_1046513 3300025735 Bacteria 1764
86 Ga0207686_10008660 3300025934 Bacteria 5494
87 Ga0207709_10009372 3300025935 Bacteria 5387
88 Ga0209371_1002323 3300027312 Bacteria 10815
89 Ga0237817_10022 3300030083 Bacteria 62837
90 Ga0237817_10093 3300030083 Bacteria 27814
91 Ga0268256_1002064 3300030500 Bacteria 10815
92 Ga0307408_100007718 3300031548 Bacteria 7117
93 Ga0307408_100007773 3300031548 Bacteria 7085
94 Ga0307408_100079238 3300031548 Bacteria 2450
95 Ga0307405_10382420 3300031731 Bacteria 1096
96 Ga0307409_100349934 3300031995 Bacteria 1394
97 Ga0307416_100129396 3300032002 Bacteria 2269
98 Ga0307416_100277041 3300032002 Bacteria 1651
99 Ga0307416_100441200 3300032002 Bacteria 1352
100 Ga0316583_10000017 3300032133 Bacteria 32029
101 Ga0316583_10022209 3300032133 Bacteria 2273
102 Ga0395898_0214670 3300037466 Bacteria 1835
103 Ga0237819_00614 3300038705 Bacteria 11715
104 Ga0439449_0007880 3300042007 Bacteria 4045
105 Ga0439462_0007544 3300042015 Bacteria 2725
106 Ga0466969_0005019 3300044656 Bacteria 7043
107 Ga0466961_0315629 3300044693 Bacteria 953
108 Ga0466959_0007024 3300045049 Bacteria 7870
109 Ga0451576_0081089 3300045051 Bacteria 3375
110 Ga0466967_0000144 3300045976 Bacteria 27783
111 Ga0495603_0059502 3300046455 Bacteria 2258
112 Ga0495605_0116015 3300046474 Bacteria 1218
113 Ga0495584_0008087 3300046491 Bacteria 5467
114 Ga0495585_0006773 3300046492 Bacteria 7073
115 Ga0495661_0063086 3300046665 Bacteria 2192
116 Ga0495661_0219354 3300046665 Bacteria 986
117 Ga0495649_0113993 3300046694 Bacteria 1432
118 Ga0495683_0005029 3300047323 Bacteria 7408
119 Ga0496100_0000790 3300048903 Bacteria 15074
120 Ga0496100_0158489 3300048903 Bacteria 1621
121 Ga0496101_0038190 3300048904 Bacteria 3409
122 Ga0496101_0149947 3300048904 Bacteria 1783
123 Ga0496102_0019905 3300048905 Bacteria 5918
124 Ga0496102_0159125 3300048905 Bacteria 2124
125 Ga0496103_0012475 3300048906 Bacteria 5039
126 Ga0496104_0001771 3300048907 Bacteria 18674
127 Ga0496105_0000412 3300048908 Bacteria 28052
128 Ga0496106_0000567 3300048909 Bacteria 26325
129 Ga0496107_0000227 3300048910 Bacteria 29794
130 Ga0496108_0002371 3300048911 Bacteria 15087
131 Ga0496109_0001823 3300048912 Bacteria 17696
132 Ga0496110_0018130 3300048913 Bacteria 5896
133 Ga0496110_0033997 3300048913 Bacteria 4412
134 Ga0496110_0069531 3300048913 Bacteria 3118
135 Ga0496111_0000205 3300048914 Bacteria 27749
136 Ga0496112_0005112 3300048915 Bacteria 11271
137 Ga0496112_0066480 3300048915 Bacteria 3557
138 Ga0496113_0079813 3300048916 Bacteria 2505
139 Ga0496113_0230230 3300048916 Bacteria 1478
140 Ga0496113_0364945 3300048916 Bacteria 1159
141 Ga0496116_0015025 3300048919 Bacteria 6140
142 Ga0496116_0036628 3300048919 Bacteria 3430
143 Ga0496119_0001436 3300048922 Bacteria 28717
144 Ga0496122_0003585 3300048925 Bacteria 20260
145 Ga0496122_0094227 3300048925 Unclassified 2028
146 Ga0496123_0075946 3300048926 Bacteria 2071
147 Ga0496125_0001194 3300048928 Bacteria 39236
148 Ga0496125_0010715 3300048928 Bacteria 9239
149 Ga0496125_0032992 3300048928 Bacteria 4589
150 Ga0496125_0121287 3300048928 Bacteria 1864
151 Ga0496126_0008542 3300048929 Bacteria 11039
152 Ga0501341_00478 3300049131 Bacteria 1693
153 Ga0501305_003814 3300049161 Bacteria 1734
154 Ga0501305_015465 3300049161 Bacteria 1078
155 Ga0501305_021999 3300049161 Bacteria 946
156 Ga0501315_000399 3300049531 Bacteria 2941
157 Ga0501316_002695 3300049532 Bacteria 1666
158 Ga0501317_000077 3300049533 Bacteria 4820
159 Ga0501317_000213 3300049533 Bacteria 3564
160 Ga0501317_005331 3300049533 Bacteria 1373
161 Ga0501317_016901 3300049533 Bacteria 951
162 Ga0501318_000051 3300049534 Bacteria 4702
163 Ga0501320_014976 3300049536 Bacteria 843
164 Ga0501321_000045 3300049537 Bacteria 5432
165 Ga0501321_010839 3300049537 Bacteria 1007
166 Ga0501326_00770 3300049542 Bacteria 1352
167 Ga0501332_00094 3300049548 Bacteria 2774
168 Ga0501334_01047 3300049550 Bacteria 1455
169 Ga0501335_000021 3300049551 Bacteria 6525
170 Ga0501335_000130 3300049551 Bacteria 3723
171 Ga0501335_000348 3300049551 Bacteria 2819
172 Ga0501335_007889 3300049551 Bacteria 991
173 Ga0501335_009116 3300049551 Bacteria 942
174 Ga0501337_000035 3300049553 Bacteria 4711
175 Ga0501338_00197 3300049554 Bacteria 2386
176 Ga0501072_0404931 3300049588 Bacteria 1082
177 Ga0501198_011151 3300049649 Bacteria 1337
178 2511176569 2510917027 Bacteria 5287437
179 2511700314 2511231119 Bacteria 4019861
180 2512640472 2512564013 Bacteria 6286191
181 2512735005 2512564039 Bacteria 8739048
182 2540607457 2540341094 Bacteria 4061186
183 2545556996 2545555800 Bacteria 4222588
184 2553393333 2551306519 Bacteria 5465154
185 2555467704 2554235283 Bacteria 3683090
186 2573041239 2571042588 Bacteria 5045676
187 2578335590 2576861424 Bacteria 5270569
188 2578931252 2576861599 Bacteria 4217202
189 2587737767 2585428059 Bacteria 8696589
190 2595089484 2593339131 Bacteria 5116855
191 2595316421 2593339198 Bacteria 7267884
192 2600198517 2599185353 Bacteria 2219443
193 2600401228 2600254943 Bacteria 2613887
194 2621273823 2619619294 Bacteria 5575484
195 2644423147 2643221676 Bacteria 8119172
196 2644708071 2643221729 Bacteria 6621700
197 2644714800 2643221730 Bacteria 6523787
198 2644715771 2643221731 Bacteria 5623886
199 2644727493 2643221732 Bacteria 5756404
200 2644740869 2643221735 Bacteria 3676263
201 2651531808 2648501850 Bacteria 3975476
202 2672337012 2671180330 Bacteria 5521719
203 2673823179 2671180694 Bacteria 7506943
204 2674418874 2671180844 Bacteria 4164150
205 2685152269 2684622632 Bacteria 5380049
206 2686997526 2684623153 Bacteria 3878815
207 2687498833 2687453109 Bacteria 3860091
208 2695628292 2695420354 Bacteria 3922431
209 2698320892 2695420987 Bacteria 6152737
210 2705996209 2703719227 Bacteria 5631989
211 2717916005 2716884898 Bacteria 3928789
212 2721507428 2718218445 Bacteria 5113413
213 2738813901 2738541295 Bacteria 5730091
214 2738816157 2738541295 Bacteria 5730091
215 2738839238 2738541299 Bacteria 4020721
216 2739154530 2738541358 Bacteria 5932299
217 2739208098 2738543006 Bacteria 5904091
218 2739230120 2738543010 Bacteria 5583595
219 2739270419 2738543017 Bacteria 4271950
220 2745169494 2744054657 Bacteria 5016802
221 2757567937 2757320391 Bacteria 4746095
222 2777761054 2775507177 Bacteria 4384303
223 2777839328 2775507192 Bacteria 4622234
224 2791214373 2788500588 Bacteria 4584915
225 2808869477 2808606364 Bacteria 4465927
226 2809055857 2808606399 Bacteria 4021018
227 2812316721 2811994870 Bacteria 3776934
228 2816862564 2816332186 Bacteria 5331395
229 2817480812 2816332295 Bacteria 4352468
230 2817617774 2816332336 Bacteria 5207640
231 2819569303 2818991441 Bacteria 5062707
232 2819571541 2818991441 Bacteria 5062707
233 2819583188 2818991443 Bacteria 6598732
234 2819628549 2818991451 Bacteria 4697364
235 2819669380 2818991459 Bacteria 8736032
236 2819670571 2818991459 Bacteria 8736032
237 2819709242 2818991465 Bacteria 5388835
238 2819723781 2818991468 Bacteria 3723169
239 2823528703 2823526263 Bacteria 3765752
240 2831906791 2831905167 Bacteria 3319172
241 2842684519 2842682962 Bacteria 5589973
242 2842884512 2842882022 Bacteria 6158489
243 2849142542 2849139964 Bacteria 5613304
244 2852675337 2852673933 Bacteria 3347676
245 2857459322 2857453340 Bacteria 8090534
246 2857462865 2857460504 Bacteria 5194327
247 2857469154 2857465823 Bacteria 6772595
248 2857478744 2857472729 Bacteria 6568124
249 2857585706 2857581216 Bacteria 5522813
250 2857590616 2857586860 Bacteria 4354574
251 2857596192 2857591370 Bacteria 6569758
252 2857606334 2857604169 Bacteria 5111450
253 2857610770 2857609550 Bacteria 3753890
254 2860840150 2860837431 Bacteria 4202080
255 2864999989 2864997549 Bacteria 5139696
256 2877771198 2877768649 Bacteria 3957164
257 2880172062 2880169592 Bacteria 3900066
258 2881640526 2881636855 Bacteria 5205297
259 2881644414 2881644220 Bacteria 5302661
260 2889296092 2889295896 Bacteria 4704906
261 2897112275 2897109615 Bacteria 4009619
262 2898909007 2898907183 Bacteria 4067722
263 2904524458 2904524088 Bacteria 5887454
264 2904562152 2904560550 Bacteria 4029838
265 2904607806 2904606771 Bacteria 4684500
266 2904760047 2904755435 Bacteria 7986759
267 2908668095 2908665501 Bacteria 3678115
268 2915600681 2915597211 Bacteria 6475886
269 2915607890 2915606848 Bacteria 6032732
270 2916973762 2916971899 Bacteria 4250608
271 2919095863 2919093281 Bacteria 3660974
272 2919146965 2919143609 Bacteria 6219228
273 2919417171 2919414237 Bacteria 5429133
274 2919419261 2919414237 Bacteria 5429133
275 2919427112 2919425241 Bacteria 8055701
276 2919429775 2919425241 Bacteria 8055701
277 2919518869 2919517244 Bacteria 5858162
278 2919723236 2919720352 Bacteria 5986006
279 2919728417 2919726948 Bacteria 3696050
280 2925330115 2925326138 Bacteria 9652120
281 2928096237 2928093941 Bacteria 5965005
282 2928513972 2928510474 Bacteria 4815308
283 2929006392 2929004312 Bacteria 5678476
284 2929185817 2929183550 Bacteria 6377511
285 2929210638 2929206907 Bacteria 5918291
286 2929237970 2929233124 Bacteria 5948380
287 2929298715 2929297113 Bacteria 3141306
288 2936341214 2936340661 Bacteria 5139038
289 2936366810 2936361878 Bacteria 5632809
290 2936367403 2936361878 Bacteria 5632809
291 2938922159 2938917290 Bacteria 5914775
292 2939594859 2939593269 Bacteria 4798695
293 2947431055 2947426588 Bacteria 5357194
294 2954773778 2954773129 Bacteria 3741715
295 2956902084 2956897341 Bacteria 5447711
296 2960319857 2960319331 Bacteria 5502575
297 2960380932 2960375949 Bacteria 5361395
298 2962293428 2962290636 Bacteria 4072939
299 2964378249 2964375228 Bacteria 4909004
300 2965765572 2965761152 Bacteria 5806513
301 2969139436 2969136845 Bacteria 3923176
302 2969143645 2969141011 Bacteria 4118468
303 2969767405 2969765954 Bacteria 4216713
304 2969773282 2969770375 Bacteria 4271280
305 2971417336 2971410472 Bacteria 8311090
306 2971514982 2971511577 Bacteria 5404012
307 2971895844 2971893375 Bacteria 3929648
308 2977256562 2977254563 Bacteria 4828420
309 2977257185 2977254563 Bacteria 4828420
310 2979087958 2979083700 Bacteria 5894929
311 2980125857 2980125574 Bacteria 5567337
312 2980181088 2980176882 Bacteria 5397533
313 2980495191 2980492589 Bacteria 4072961
314 2981287835 2981284811 Bacteria 4641497
315 2981292453 2981289755 Bacteria 4641509
316 2981983454 2981980479 Bacteria 4641628
317 2981988509 2981985349 Bacteria 4641497
318 2990277431 2990275345 Bacteria 4887158
319 2990278080 2990275345 Bacteria 4887158
320 3001268420 3001267043 Bacteria 4823521
321 3001273892 3001272096 Bacteria 4729684
322 3001897756 3001892409 Bacteria 6328293
323 3001898690 3001892409 Bacteria 6328293
324 3006861171 3006858327 Bacteria 4317835
325 3006881656 3006879489 Bacteria 4064221
326 3006972221 3006969106 Bacteria 4739423
327 3006975962 3006973921 Bacteria 4423788
328 3006979969 3006978542 Bacteria 5328100
329 3006981865 3006978542 Bacteria 5328100
330 3006984523 3006984091 Bacteria 4207523
331 3006988941 3006988479 Bacteria 4767936
332 8002321850 8002317523 Bacteria 8051857
333 8022624201 8022621104 Bacteria 5241040
334 8022631939 8022630665 Bacteria 3886130
335 8022654317 8022653035 Bacteria 4035078
336 8022796894 8022792930 Bacteria 5693794
337 8022898186 8022893055 Bacteria 5300455
338 8022917365 8022914991 Bacteria 5584517
339 8022949866 8022948649 Bacteria 5366783
340 8023443117 8023438354 Bacteria 5779374
341 8023445164 8023444577 Bacteria 5661597
342 8046999146 8046991243 Bacteria 8497463
343 8051955229 8051952484 Bacteria 3926774
344 8052176121 8052174270 Bacteria 3881265
345 8054281160 8054280661 Bacteria 4232245
346 8054804784 8054795415 Bacteria 9785225
347 8055535382 8055531788 Bacteria 5249694
348 8056540042 8056533031 Bacteria 8964429
349 8057586730 8057582654 Bacteria 5218944
350 8057635467 8057632132 Bacteria 4726859
351 Ga0495649_0102773
352 JGI25151J46595_10000006
353 JGI25151J46595_10006593
354 JGI25151J46595_10008020
355 JGI25151J46595_10009449
356 JGI25151J46595_10011908
357 JGI25151J46595_10014848
358 JGI25151J46595_10018886
359 JGI25151J46595_10049893
360 JGI25151J46595_10057001
361 JGI25151J46595_10075917
362 JGI25151J46595_10089862
363 rootH1_10000457
364 rootH2_10056773
365 rootL2_10004995
366 Ga0006562J51391_1001146
367 Ga0006562J51391_1001176
368 Ga0006562J51391_1001442
369 Ga0006562J51391_1004050
370 Ga0055538_1000233
371 Ga0055532_1000046
372 Ga0055532_1002155
373 Ga0055536_1027134
374 Ga0055528_1001481
375 Ga0105251_10057237
376 Ga0105244_10042031
377 Ga0105244_10065846
378 Ga0105244_10081969
379 Ga0105244_10109846
380 Ga0105250_10001260
381 Ga0105250_10044980
382 Ga0105250_10101796
383 Ga0105247_10004353
384 Ga0105243_10002181
385 Ga0105242_10001993
386 Ga0105239_11103572
387 Ga0105246_10000276
388 Ga0105246_10078381
389 Ga0157371_10002286
390 Ga0157374_10276520
391 Ga0157378_10003046
392 Ga0157377_10006785
393 Ga0209784_100099
394 Ga0209566_100022
395 Ga0209566_100248
396 Ga0209147_100014
397 Ga0209147_100068
398 Ga0209147_100519
399 Ga0209147_100618
400 Ga0209147_109705
401 Ga0209673_1002814
402 Ga0209130_1002012
403 Ga0209130_1005420
404 Ga0209130_1008340
405 Ga0209130_1009149
406 Ga0209130_1012990
407 Ga0209676_1000783
408 Ga0209676_1002921
409 Ga0209676_1014882
410 Ga0209676_1023851
411 Ga0209025_1000001
412 Ga0209025_1000539
413 Ga0209025_1001023
414 Ga0209025_1003755
415 Ga0209025_1004088
416 Ga0209025_1004904
417 Ga0209025_1005331
418 Ga0209025_1008720
419 Ga0209025_1015244
420 Ga0209025_1015420
421 Ga0209025_1020687
422 Ga0209025_1021371
423 Ga0209025_1033756
424 Ga0209025_1037420
425 Ga0209025_1050085
426 Ga0209025_1067542
427 Ga0209025_1077674
428 Ga0207426_1043198
429 Ga0207696_1001570
430 Ga0207696_1013027
431 Ga0207696_1013132
432 Ga0207655_1021566
433 Ga0207655_1101096
434 Ga0207713_1002283
435 Ga0207713_1046513
436 Ga0207686_10008660
437 Ga0207709_10009372
438 Ga0209371_1002323
439 Ga0237817_10022
440 Ga0237817_10093
441 Ga0268256_1002064
442 Ga0307408_100007718
443 Ga0307408_100007773
444 Ga0307408_100079238
445 Ga0307405_10382420
446 Ga0307409_100349934
447 Ga0307416_100129396
448 Ga0307416_100277041
449 Ga0307416_100441200
450 Ga0316583_10000017
451 Ga0316583_10022209
452 Ga0395898_0214670
453 Ga0237819_00614
454 Ga0439449_0007880
455 Ga0439462_0007544
456 Ga0466969_0005019
457 Ga0466961_0315629
458 Ga0466959_0007024
459 Ga0451576_0081089
460 Ga0466967_0000144
461 Ga0495603_0059502
462 Ga0495605_0116015
463 Ga0495584_0008087
464 Ga0495585_0006773
465 Ga0495661_0063086
466 Ga0495661_0219354
467 Ga0495649_0113993
468 Ga0495683_0005029
469 Ga0496100_0000790
470 Ga0496100_0158489
471 Ga0496101_0038190
472 Ga0496101_0149947
473 Ga0496102_0019905
474 Ga0496102_0159125
475 Ga0496103_0012475
476 Ga0496104_0001771
477 Ga0496105_0000412
478 Ga0496106_0000567
479 Ga0496107_0000227
480 Ga0496108_0002371
481 Ga0496109_0001823
482 Ga0496110_0018130
483 Ga0496110_0033997
484 Ga0496110_0069531
485 Ga0496111_0000205
486 Ga0496112_0005112
487 Ga0496112_0066480
488 Ga0496113_0079813
489 Ga0496113_0230230
490 Ga0496113_0364945
491 Ga0496116_0015025
492 Ga0496116_0036628
493 Ga0496119_0001436
494 Ga0496122_0003585
495 Ga0496122_0094227
496 Ga0496123_0075946
497 Ga0496125_0001194
498 Ga0496125_0010715
499 Ga0496125_0032992
500 Ga0496125_0121287
501 Ga0496126_0008542
502 Ga0501341_00478
503 Ga0501305_003814
504 Ga0501305_015465
505 Ga0501305_021999
506 Ga0501315_000399
507 Ga0501316_002695
508 Ga0501317_000077
509 Ga0501317_000213
510 Ga0501317_005331
511 Ga0501317_016901
512 Ga0501318_000051
513 Ga0501320_014976
514 Ga0501321_000045
515 Ga0501321_010839
516 Ga0501326_00770
517 Ga0501332_00094
518 Ga0501334_01047
519 Ga0501335_000021
520 Ga0501335_000130
521 Ga0501335_000348
522 Ga0501335_007889
523 Ga0501335_009116
524 Ga0501337_000035
525 Ga0501338_00197
526 Ga0501072_0404931
527 Ga0501198_011151
528 2511176569
529 2511700314
530 2512640472
531 2512735005
532 2540607457
533 2545556996
534 2553393333
535 2555467704
536 2573041239
537 2578335590
538 2578931252
539 2587737767
540 2595089484
541 2595316421
542 2600198517
543 2600401228
544 2621273823
545 2644423147
546 2644708071
547 2644714800
548 2644715771
549 2644727493
550 2644740869
551 2651531808
552 2672337012
553 2673823179
554 2674418874
555 2685152269
556 2686997526
557 2687498833
558 2695628292
559 2698320892
560 2705996209
561 2717916005
562 2721507428
563 2738813901
564 2738816157
565 2738839238
566 2739154530
567 2739208098
568 2739230120
569 2739270419
570 2745169494
571 2757567937
572 2777761054
573 2777839328
574 2791214373
575 2808869477
576 2809055857
577 2812316721
578 2816862564
579 2817480812
580 2817617774
581 2819569303
582 2819571541
583 2819583188
584 2819628549
585 2819669380
586 2819670571
587 2819709242
588 2819723781
589 2823528703
590 2831906791
591 2842684519
592 2842884512
593 2849142542
594 2852675337
595 2857459322
596 2857462865
597 2857469154
598 2857478744
599 2857585706
600 2857590616
601 2857596192
602 2857606334
603 2857610770
604 2860840150
605 2864999989
606 2877771198
607 2880172062
608 2881640526
609 2881644414
610 2889296092
611 2897112275
612 2898909007
613 2904524458
614 2904562152
615 2904607806
616 2904760047
617 2908668095
618 2915600681
619 2915607890
620 2916973762
621 2919095863
622 2919146965
623 2919417171
624 2919419261
625 2919427112
626 2919429775
627 2919518869
628 2919723236
629 2919728417
630 2925330115
631 2928096237
632 2928513972
633 2929006392
634 2929185817
635 2929210638
636 2929237970
637 2929298715
638 2936341214
639 2936366810
640 2936367403
641 2938922159
642 2939594859
643 2947431055
644 2954773778
645 2956902084
646 2960319857
647 2960380932
648 2962293428
649 2964378249
650 2965765572
651 2969139436
652 2969143645
653 2969767405
654 2969773282
655 2971417336
656 2971514982
657 2971895844
658 2977256562
659 2977257185
660 2979087958
661 2980125857
662 2980181088
663 2980495191
664 2981287835
665 2981292453
666 2981983454
667 2981988509
668 2990277431
669 2990278080
670 3001268420
671 3001273892
672 3001897756
673 3001898690
674 3006861171
675 3006881656
676 3006972221
677 3006975962
678 3006979969
679 3006981865
680 3006984523
681 3006988941
682 8002321850
683 8022624201
684 8022631939
685 8022654317
686 8022796894
687 8022898186
688 8022917365
689 8022949866
690 8023443117
691 8023445164
692 8046999146
693 8051955229
694 8052176121
695 8054281160
696 8054804784
697 8055535382
698 8056540042
699 8057586730
700 8057635467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03618

Kinase-PPPase

Kinase/pyrophosphorylase

25

280

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pbj-assembly1.cif.gz_A mutant r1722w of the dihydroorotase domain of human cad protein bound to the substrate carbamoyl aspartate 0.6745 38 88
8pbh-assembly1.cif.gz_A mutant r1617q of the dihydroorotase domain of human cad protein bound to the substrate carbamoyl aspartate 0.6729 38 88
3gri-assembly1.cif.gz_A the crystal structure of a dihydroorotase from staphylococcus aureus 0.6647 38 88
7yor-assembly1.cif.gz_B recj2 and dcmp complex from methanocaldococcus jannaschii 0.6534 4 88
7owk-assembly1.cif.gz_C odinarchaeota adenylate kinase (odinak) in complex with dttp 0.6123 148 268
ID Description Score Start End Superfamily
4ep1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.6651 4 88 3.40.50.1370
4m88A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6563 4 85 3.40.50.2300
6hl7B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.6506 4 90 3.40.50.1370
af_A0A5K1K910_58_191_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.6506 1 88 3.40.50.1370
1gq3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.646 1 88 3.40.50.1370
ID Description Score Start End GO Terms
AF-E1NNZ4-F1-model_v4 deleted 0.9934 115 199
AF-A0A7Z7YSP8-F1-model_v4 Phosphoenolpyruvate synthase regulatory protein 0.9868 171 270 GO:0004674
GO:0005524
AF-A0A3D0MRX8-F1-model_v4 Phosphoenolpyruvate synthase regulatory protein 0.9812 121 268 GO:0004674
GO:0005524
AF-A0A3D1JBM7-F1-model_v4 Phosphoenolpyruvate synthase regulatory protein 0.9808 166 268 GO:0004674
GO:0005524
AF-A0A645HR73-F1-model_v4 Putative pyruvate, phosphate dikinase regulatory protein (EC 2.7.11.32) 0.9803 144 271 GO:0004674
GO:0005524

Map