F418340

General Info

Members Datasets Scaffolds Average Seq Length
350 183 700 300

Family's Representative Sequence

Representative Sequence 3300041460|Ga0451802_2127065|Ga0451802_2127065_369_1265
Length 298
Sequence MTKIGVIAHRDKTLGGGLGELRDLLEGAGFTTPPWYEVSKSKHSPDGLRKMIDDGVDRVLVWGGDGMVRRSIDTIVGDGLDHVSLGILPAGTANLLAKNLDIPIDLEGAVDIALHGEARAIDVGRMNGEHFAVMAGAGVDAMMIKDADDNQLKEKLGRVGYVRASIRSTKMEPVKVRIDLDGREWFSGKATCVLMGNVGTILGGVKAFQNASPTDGRLDIGVVQAKSRSDWLRVAARGVTGRVEKSPFVDMASAETIKIELKKKTVWEVDGGDQTPAKKFKIRCIPGAIRICQPSGAE

Samples

Sample ID Description Type Environment
1 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 3.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.86
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 8.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451802_2127065 3300041460 Unclassified 1429
2 Ga0070668_100157593 3300005347 Bacteria 1840
3 Ga0070709_10009010 3300005434 Bacteria 5497
4 Ga0070709_10200717 3300005434 Bacteria 1412
5 Ga0070714_100000919 3300005435 Bacteria 20877
6 Ga0070714_100011196 3300005435 Bacteria 7111
7 Ga0070714_100113932 3300005435 Bacteria 2398
8 Ga0070714_100135512 3300005435 Bacteria 2205
9 Ga0070714_100175607 3300005435 Bacteria 1946
10 Ga0070713_100005712 3300005436 Bacteria 8542
11 Ga0070713_100034643 3300005436 Bacteria 4059
12 Ga0070713_100086616 3300005436 Bacteria 2686
13 Ga0070710_10009168 3300005437 Bacteria 4837
14 Ga0070710_10010315 3300005437 Bacteria 4586
15 Ga0070710_10028057 3300005437 Bacteria 3008
16 Ga0070710_10032348 3300005437 Bacteria 2833
17 Ga0070710_10032844 3300005437 Bacteria 2814
18 Ga0070710_10079979 3300005437 Bacteria 1906
19 Ga0070710_10185418 3300005437 Bacteria 1305
20 Ga0070711_100011736 3300005439 Bacteria 5447
21 Ga0070694_100001556 3300005444 Bacteria 13488
22 Ga0070708_100001469 3300005445 Bacteria 17991
23 Ga0070708_100033337 3300005445 Bacteria 4474
24 Ga0070708_100055326 3300005445 Bacteria 3528
25 Ga0070708_100199796 3300005445 Bacteria 1871
26 Ga0070708_100268040 3300005445 Bacteria 1606
27 Ga0070706_100009702 3300005467 Bacteria 8947
28 Ga0070706_100010257 3300005467 Bacteria 8704
29 Ga0070706_100014121 3300005467 Bacteria 7379
30 Ga0070706_100093447 3300005467 Bacteria 2791
31 Ga0070707_100001693 3300005468 Bacteria 21273
32 Ga0070707_100291504 3300005468 Unclassified 1586
33 Ga0070698_100000693 3300005471 Bacteria 35981
34 Ga0070698_100001088 3300005471 Bacteria 29878
35 Ga0070698_100027109 3300005471 Bacteria 5958
36 Ga0070698_100115442 3300005471 Bacteria 2649
37 Ga0070699_100000332 3300005518 Bacteria 45840
38 Ga0070699_100026056 3300005518 Bacteria 5043
39 Ga0070699_100078594 3300005518 Bacteria 2874
40 Ga0070699_100230720 3300005518 Bacteria 1650
41 Ga0070697_100041338 3300005536 Bacteria 3731
42 Ga0068861_100012516 3300005719 Bacteria 5918
43 Ga0068863_100709335 3300005841 Bacteria 1000
44 Ga0068858_100071020 3300005842 Bacteria 3228
45 Ga0081540_1000262 3300005983 Bacteria 55336
46 Ga0081540_1001999 3300005983 Bacteria 17010
47 Ga0070717_10001234 3300006028 Bacteria 17388
48 Ga0070717_10048955 3300006028 Bacteria 3468
49 Ga0070717_10082677 3300006028 Bacteria 2699
50 Ga0070717_10334245 3300006028 Bacteria 1352
51 Ga0075432_10001926 3300006058 Bacteria 6882
52 Ga0070716_100004968 3300006173 Bacteria 6403
53 Ga0070716_100012416 3300006173 Bacteria 4318
54 Ga0070716_100024443 3300006173 Bacteria 3215
55 Ga0070716_100027633 3300006173 Bacteria 3050
56 Ga0070712_100016737 3300006175 Bacteria 4740
57 Ga0070712_100052784 3300006175 Bacteria 2836
58 Ga0070712_100060617 3300006175 Bacteria 2669
59 Ga0070712_100076068 3300006175 Bacteria 2416
60 Ga0070712_100102448 3300006175 Bacteria 2120
61 Ga0097621_100156230 3300006237 Bacteria 1958
62 Ga0075428_100053321 3300006844 Bacteria 4431
63 Ga0075430_100040242 3300006846 Bacteria 3957
64 Ga0075431_100060966 3300006847 Bacteria 3893
65 Ga0075431_100286242 3300006847 Bacteria 1668
66 Ga0075433_10067845 3300006852 Bacteria 3130
67 Ga0075434_100011060 3300006871 Bacteria 8490
68 Ga0075429_100177534 3300006880 Bacteria 1866
69 Ga0075436_100104574 3300006914 Bacteria 1974
70 Ga0075436_100158352 3300006914 Bacteria 1596
71 Ga0075435_100015325 3300007076 Bacteria 5760
72 Ga0105240_10578579 3300009093 Bacteria 1239
73 Ga0105245_10591864 3300009098 Bacteria 1135
74 Ga0105245_10594387 3300009098 Bacteria 1133
75 Ga0114129_10011638 3300009147 Bacteria 12524
76 Ga0114129_10162230 3300009147 Bacteria 3052
77 Ga0105243_10021380 3300009148 Bacteria 4910
78 Ga0105237_10245325 3300009545 Bacteria 1793
79 Ga0105238_10340132 3300009551 Bacteria 1488
80 Ga0105249_10244865 3300009553 Bacteria 1774
81 Ga0105249_10373827 3300009553 Bacteria 1449
82 Ga0105239_10602741 3300010375 Bacteria 1253
83 Ga0157370_10295510 3300013104 Bacteria 1496
84 Ga0157369_10416762 3300013105 Bacteria 1392
85 Ga0157369_10701934 3300013105 Bacteria 1042
86 Ga0157374_10258313 3300013296 Bacteria 1715
87 Ga0163162_10241288 3300013306 Bacteria 1938
88 Ga0157372_10271097 3300013307 Bacteria 1972
89 Ga0157375_10547012 3300013308 Bacteria 1320
90 Ga0163163_10023806 3300014325 Bacteria 5819
91 Ga0163163_10119532 3300014325 Bacteria 2668
92 Ga0157377_10009718 3300014745 Bacteria 4733
93 Ga0157377_10042528 3300014745 Bacteria 2523
94 Ga0157377_10130498 3300014745 Bacteria 1534
95 Ga0163161_10298499 3300017792 Bacteria 1268
96 Ga0197907_10034890 3300020069 Bacteria 2307
97 Ga0197907_10853030 3300020069 Bacteria 1476
98 Ga0206349_1774012 3300020075 Unclassified 1618
99 Ga0206351_10351159 3300020077 Bacteria 1718
100 Ga0206351_10505476 3300020077 Bacteria 1573
101 Ga0206351_10974677 3300020077 Bacteria 1835
102 Ga0206350_11329816 3300020080 Unclassified 944
103 Ga0206354_10775288 3300020081 Unclassified 1175
104 Ga0224712_10024790 3300022467 Bacteria 2100
105 Ga0224712_10037081 3300022467 Bacteria 1812
106 Ga0207692_10008853 3300025898 Bacteria 4183
107 Ga0207692_10071200 3300025898 Bacteria 1833
108 Ga0207647_10048588 3300025904 Bacteria 2634
109 Ga0207685_10032447 3300025905 Unclassified 1879
110 Ga0207699_10009282 3300025906 Bacteria 4890
111 Ga0207699_10009684 3300025906 Bacteria 4808
112 Ga0207699_10021059 3300025906 Bacteria 3506
113 Ga0207699_10069855 3300025906 Bacteria 2143
114 Ga0207699_10151903 3300025906 Bacteria 1533
115 Ga0207684_10000893 3300025910 Bacteria 33923
116 Ga0207684_10089733 3300025910 Bacteria 2619
117 Ga0207684_10148037 3300025910 Bacteria 2020
118 Ga0207693_10019026 3300025915 Bacteria 5467
119 Ga0207693_10039872 3300025915 Bacteria 3699
120 Ga0207693_10068404 3300025915 Bacteria 2780
121 Ga0207693_10087356 3300025915 Bacteria 2443
122 Ga0207693_10222193 3300025915 Bacteria 1484
123 Ga0207693_10473166 3300025915 Bacteria 979
124 Ga0207663_10008438 3300025916 Bacteria 5384
125 Ga0207646_10000507 3300025922 Bacteria 52135
126 Ga0207646_10027443 3300025922 Bacteria 5192
127 Ga0207646_10299640 3300025922 Bacteria 1452
128 Ga0207700_10003873 3300025928 Bacteria 8744
129 Ga0207700_10015093 3300025928 Bacteria 5082
130 Ga0207700_10016669 3300025928 Bacteria 4887
131 Ga0207700_10040727 3300025928 Bacteria 3393
132 Ga0207700_10046558 3300025928 Bacteria 3208
133 Ga0207700_10150395 3300025928 Unclassified 1923
134 Ga0207700_10156016 3300025928 Bacteria 1891
135 Ga0207664_10007610 3300025929 Bacteria 7514
136 Ga0207664_10011313 3300025929 Bacteria 6332
137 Ga0207664_10011941 3300025929 Bacteria 6201
138 Ga0207664_10036761 3300025929 Bacteria 3785
139 Ga0207664_10054965 3300025929 Bacteria 3157
140 Ga0207664_10064164 3300025929 Bacteria 2936
141 Ga0207664_10118933 3300025929 Bacteria 2208
142 Ga0207664_10175865 3300025929 Unclassified 1835
143 Ga0207664_10240810 3300025929 Unclassified 1575
144 Ga0207664_10338781 3300025929 Bacteria 1329
145 Ga0207644_10008567 3300025931 Bacteria 6691
146 Ga0207709_10018042 3300025935 Bacteria 3947
147 Ga0207665_10002773 3300025939 Bacteria 11742
148 Ga0207665_10026138 3300025939 Bacteria 3853
149 Ga0207711_10556178 3300025941 Bacteria 1070
150 Ga0207667_10398882 3300025949 Bacteria 1401
151 Ga0207712_10018399 3300025961 Unclassified 4550
152 Ga0207712_10028377 3300025961 Bacteria 3743
153 Ga0207677_10283945 3300026023 Bacteria 1360
154 Ga0207702_10495007 3300026078 Unclassified 1191
155 Ga0207641_10172051 3300026088 Bacteria 1978
156 Ga0207674_10131380 3300026116 Bacteria 2467
157 Ga0207675_100005380 3300026118 Bacteria 12282
158 Ga0207675_100060152 3300026118 Bacteria 3546
159 Ga0207428_10008228 3300027907 Bacteria 9430
160 Ga0207428_10096568 3300027907 Bacteria 2288
161 Ga0265337_1002307 3300028556 Bacteria 8859
162 Ga0265326_10000983 3300028558 Bacteria 10279
163 Ga0265319_1003912 3300028563 Bacteria 7575
164 Ga0265334_10002472 3300028573 Bacteria 8656
165 Ga0265318_10020516 3300028577 Bacteria 2666
166 Ga0265322_10003289 3300028654 Bacteria 4901
167 Ga0265336_10009492 3300028666 Bacteria 3362
168 Ga0265338_10000683 3300028800 Bacteria 58337
169 Ga0265338_10000745 3300028800 Bacteria 55424
170 Ga0265324_10002266 3300029957 Bacteria 10026
171 Ga0265332_10004612 3300031238 Bacteria 6447
172 Ga0265320_10009340 3300031240 Bacteria 5922
173 Ga0265340_10007920 3300031247 Bacteria 5760
174 Ga0265340_10024841 3300031247 Bacteria 3039
175 Ga0265339_10197915 3300031249 Unclassified 993
176 Ga0265316_10030867 3300031344 Bacteria 4387
177 Ga0265316_10128097 3300031344 Bacteria 1913
178 Ga0265313_10018317 3300031595 Bacteria 3936
179 Ga0307508_10204739 3300031616 Unclassified 1574
180 Ga0265314_10240052 3300031711 Bacteria 1046
181 Ga0265342_10012690 3300031712 Bacteria 5697
182 Ga0316212_1007677 3300033547 Bacteria 1557
183 Ga0373926_0000259 3300035083 Bacteria 12749
184 Ga0373926_0001034 3300035083 Bacteria 8152
185 Ga0373934_0004311 3300035086 Bacteria 5252
186 Ga0373944_0002205 3300035089 Bacteria 4951
187 Ga0373944_0004955 3300035089 Bacteria 3490
188 Ga0373923_0000889 3300035111 Bacteria 7964
189 Ga0373923_0030904 3300035111 Bacteria 2156
190 Ga0373936_0000091 3300035113 Bacteria 32642
191 Ga0373936_0003567 3300035113 Bacteria 5857
192 Ga0373936_0038829 3300035113 Bacteria 1904
193 Ga0373945_0000207 3300035116 Bacteria 16012
194 Ga0373945_0000301 3300035116 Bacteria 14081
195 Ga0373953_0026705 3300035117 Bacteria 2213
196 Ga0373956_0054641 3300035119 Bacteria 1799
197 Ga0373956_0125383 3300035119 Unclassified 1201
198 Ga0373943_0000596 3300035170 Bacteria 15696
199 Ga0373943_0002371 3300035170 Bacteria 8547
200 Ga0373946_0000354 3300035171 Bacteria 14870
201 Ga0373946_0000734 3300035171 Bacteria 11125
202 Ga0373955_0004673 3300035172 Bacteria 6079
203 Ga0373924_0005408 3300035410 Bacteria 4520
204 Ga0373924_0023544 3300035410 Bacteria 2418
205 Ga0373935_0000149 3300035692 Bacteria 32036
206 Ga0373935_0000521 3300035692 Bacteria 20042
207 Ga0373927_0000310 3300035695 Bacteria 38316
208 Ga0373927_0006938 3300035695 Bacteria 7691
209 Ga0373933_0154771 3300035724 Unclassified 1453
210 Ga0373947_0004252 3300035725 Bacteria 8401
211 Ga0373947_0011192 3300035725 Bacteria 5150
212 Ga0373937_0016299 3300036401 Bacteria 6596
213 Ga0265778_001964 3300036457 Bacteria 1933
214 Ga0372808_003179 3300036459 Bacteria 1986
215 Ga0373925_0000031 3300037068 Bacteria 145734
216 Ga0373925_0004571 3300037068 Bacteria 10456
217 Ga0373925_0020911 3300037068 Bacteria 4768
218 Ga0373925_0041410 3300037068 Bacteria 3414
219 Ga0436365_0730238 3300039437 Bacteria 1124
220 Ga0466963_0020422 3300044694 Bacteria 4165
221 Ga0466967_0020493 3300045976 Bacteria 5347
222 Ga0495592_0002994 3300046454 Bacteria 12030
223 Ga0495603_0020605 3300046455 Bacteria 3994
224 Ga0495603_0109210 3300046455 Bacteria 1614
225 Ga0495603_0358885 3300046455 Bacteria 836
226 Ga0495629_0016338 3300046459 Bacteria 5326
227 Ga0495641_0005589 3300046461 Bacteria 8418
228 Ga0495651_0011305 3300046462 Bacteria 6859
229 Ga0495651_0035537 3300046462 Bacteria 3878
230 Ga0495651_0041979 3300046462 Bacteria 3552
231 Ga0495651_0099820 3300046462 Bacteria 2164
232 Ga0495651_0199598 3300046462 Bacteria 1401
233 Ga0495653_0001962 3300046463 Bacteria 16194
234 Ga0495653_0016916 3300046463 Bacteria 5931
235 Ga0495653_0050479 3300046463 Bacteria 3199
236 Ga0495580_0006765 3300046472 Bacteria 9297
237 Ga0495582_0022995 3300046473 Bacteria 3409
238 Ga0495582_0032327 3300046473 Bacteria 2878
239 Ga0495639_0000814 3300046475 Bacteria 14314
240 Ga0495662_0000648 3300046476 Bacteria 16310
241 Ga0495662_0030846 3300046476 Bacteria 2588
242 Ga0495662_0111046 3300046476 Bacteria 1344
243 Ga0495664_0000362 3300046477 Bacteria 22001
244 Ga0495664_0074009 3300046477 Unclassified 2037
245 Ga0495664_0103595 3300046477 Unclassified 1715
246 Ga0495594_0007327 3300046499 Bacteria 5674
247 Ga0495608_0033386 3300046511 Bacteria 3478
248 Ga0495618_0066593 3300046514 Unclassified 2289
249 Ga0495628_0021607 3300046516 Bacteria 5291
250 Ga0495630_0001459 3300046517 Bacteria 16378
251 Ga0495630_0082722 3300046517 Bacteria 2423
252 Ga0495630_0325608 3300046517 Bacteria 1175
253 Ga0495652_0002628 3300046529 Bacteria 18339
254 Ga0495652_0008351 3300046529 Bacteria 9456
255 Ga0495652_0140876 3300046529 Unclassified 1896
256 Ga0495665_0002325 3300046531 Bacteria 10267
257 Ga0495665_0017605 3300046531 Bacteria 3843
258 Ga0495640_0006176 3300046533 Bacteria 9494
259 Ga0495640_0016099 3300046533 Bacteria 5602
260 Ga0495586_0013851 3300046535 Bacteria 4279
261 Ga0495587_0023698 3300046536 Bacteria 3770
262 Ga0495645_0005197 3300046543 Bacteria 8916
263 Ga0495645_0072639 3300046543 Bacteria 2479
264 Ga0495667_0017403 3300046559 Bacteria 4853
265 Ga0495667_0029667 3300046559 Bacteria 3681
266 Ga0495667_0092556 3300046559 Unclassified 1957
267 Ga0495656_0048788 3300046615 Unclassified 1801
268 Ga0495634_0001382 3300046642 Bacteria 21842
269 Ga0495634_0042944 3300046642 Bacteria 3065
270 Ga0495635_0003178 3300046663 Bacteria 11321
271 Ga0495635_0076277 3300046663 Bacteria 2297
272 Ga0495635_0095804 3300046663 Bacteria 2029
273 Ga0495635_0125532 3300046663 Unclassified 1750
274 Ga0495657_0005910 3300046675 Bacteria 9617
275 Ga0495657_0061791 3300046675 Bacteria 2477
276 Ga0495657_0086318 3300046675 Bacteria 2022
277 Ga0495599_0015443 3300046678 Bacteria 4739
278 Ga0495599_0023132 3300046678 Bacteria 3883
279 Ga0495599_0074767 3300046678 Bacteria 2115
280 Ga0495599_0135701 3300046678 Bacteria 1527
281 Ga0495623_0007108 3300046679 Bacteria 7272
282 Ga0495646_0003000 3300046680 Bacteria 10469
283 Ga0495646_0039154 3300046680 Bacteria 2924
284 Ga0495647_0018829 3300046681 Unclassified 2464
285 Ga0495658_0015414 3300046683 Bacteria 3920
286 Ga0495613_0005733 3300046689 Bacteria 9303
287 Ga0495624_0001775 3300046690 Bacteria 16499
288 Ga0495624_0003378 3300046690 Bacteria 11845
289 Ga0495624_0077784 3300046690 Unclassified 2058
290 Ga0495600_0002473 3300046809 Bacteria 10604
291 Ga0495581_0000289 3300047315 Bacteria 24439
292 Ga0495604_0013244 3300047317 Bacteria 6567
293 Ga0495604_0270003 3300047317 Unclassified 1153
294 Ga0495674_0002939 3300047319 Bacteria 16582
295 Ga0495674_0012566 3300047319 Bacteria 7977
296 Ga0495674_0043063 3300047319 Bacteria 4021
297 Ga0495676_0024666 3300047321 Bacteria 5201
298 Ga0495676_0034580 3300047321 Bacteria 4238
299 Ga0495680_0001291 3300047322 Bacteria 27318
300 Ga0495680_0035441 3300047322 Bacteria 4019
301 Ga0495680_0140765 3300047322 Unclassified 1765
302 Ga0495680_0172525 3300047322 Bacteria 1565
303 Ga0495680_0182081 3300047322 Bacteria 1516
304 Ga0495684_0003233 3300047471 Bacteria 12788
305 Ga0495684_0010290 3300047471 Bacteria 7234
306 Ga0495684_0019896 3300047471 Bacteria 5173
307 Ga0495684_0035914 3300047471 Bacteria 3800
308 Ga0495593_0000263 3300047673 Bacteria 28479
309 Ga0495602_0017120 3300048088 Bacteria 7271
310 Ga0495602_0082394 3300048088 Unclassified 2700
311 Ga0495602_0128326 3300048088 Bacteria 2027
312 Ga0495614_0004860 3300048089 Bacteria 6067
313 Ga0496102_0088228 3300048905 Bacteria 2867
314 Ga0496102_0092909 3300048905 Bacteria 2795
315 Ga0496104_0001708 3300048907 Bacteria 18959
316 Ga0496105_0007265 3300048908 Bacteria 8557
317 Ga0496109_0092580 3300048912 Bacteria 2796
318 Ga0496109_0204567 3300048912 Bacteria 1856
319 Ga0496109_0208731 3300048912 Bacteria 1837
320 Ga0496110_0015141 3300048913 Bacteria 6412
321 Ga0496110_0029214 3300048913 Bacteria 4742
322 Ga0496111_0176001 3300048914 Bacteria 1590
323 Ga0496112_0035900 3300048915 Bacteria 4831
324 Ga0496114_0023109 3300048917 Bacteria 5069
325 Ga0496114_0314351 3300048917 Bacteria 1384
326 Ga0496114_0482308 3300048917 Unclassified 1097
327 Ga0496115_0008061 3300048918 Bacteria 7778
328 Ga0496115_0265454 3300048918 Bacteria 1411
329 nmdc:mga05p37_133434_c1 3300050507 Bacteria 3046
330 nmdc:mga05p37_226586_c1 3300050507 Unclassified 2254
331 nmdc:mga05p37_30940_c1 3300050507 Bacteria 6535
332 nmdc:mga0qj67_6492_c1 3300050509 Bacteria 8595
333 nmdc:mga06r32_434648_c1 3300050510 Bacteria 1293
334 nmdc:mga08y16_27877_c1 3300050511 Bacteria 5955
335 nmdc:mga0n895_113962_c1 3300050512 Bacteria 2722
336 nmdc:mga0rr50_138449_c1 3300050513 Bacteria 1956
337 nmdc:mga0rr50_30043_c1 3300050513 Bacteria 3842
338 nmdc:mga08x19_176255_c1 3300050514 Bacteria 1458
339 nmdc:mga08x19_18077_c1 3300050514 Bacteria 4320
340 nmdc:mga08x19_346650_c1 3300050514 Bacteria 1036
341 nmdc:mga08x19_521391_c1 3300050514 Bacteria 840
342 nmdc:mga0a205_60473_c1 3300050515 Bacteria 3659
343 Ga0495601_0018185 3300053077 Bacteria 4274
344 Ga0495601_0069883 3300053077 Unclassified 2240
345 Ga0495601_0267524 3300053077 Unclassified 1115
346 Ga0495612_0013705 3300053078 Bacteria 3265
347 Ga0495595_0009996 3300053084 Bacteria 3934
348 Ga0495619_0035956 3300053085 Bacteria 3223
349 Ga0495619_0036509 3300053085 Bacteria 3201
350 Ga0495619_0044569 3300053085 Bacteria 2912
351 Ga0451802_2127065
352 Ga0070668_100157593
353 Ga0070709_10009010
354 Ga0070709_10200717
355 Ga0070714_100000919
356 Ga0070714_100011196
357 Ga0070714_100113932
358 Ga0070714_100135512
359 Ga0070714_100175607
360 Ga0070713_100005712
361 Ga0070713_100034643
362 Ga0070713_100086616
363 Ga0070710_10009168
364 Ga0070710_10010315
365 Ga0070710_10028057
366 Ga0070710_10032348
367 Ga0070710_10032844
368 Ga0070710_10079979
369 Ga0070710_10185418
370 Ga0070711_100011736
371 Ga0070694_100001556
372 Ga0070708_100001469
373 Ga0070708_100033337
374 Ga0070708_100055326
375 Ga0070708_100199796
376 Ga0070708_100268040
377 Ga0070706_100009702
378 Ga0070706_100010257
379 Ga0070706_100014121
380 Ga0070706_100093447
381 Ga0070707_100001693
382 Ga0070707_100291504
383 Ga0070698_100000693
384 Ga0070698_100001088
385 Ga0070698_100027109
386 Ga0070698_100115442
387 Ga0070699_100000332
388 Ga0070699_100026056
389 Ga0070699_100078594
390 Ga0070699_100230720
391 Ga0070697_100041338
392 Ga0068861_100012516
393 Ga0068863_100709335
394 Ga0068858_100071020
395 Ga0081540_1000262
396 Ga0081540_1001999
397 Ga0070717_10001234
398 Ga0070717_10048955
399 Ga0070717_10082677
400 Ga0070717_10334245
401 Ga0075432_10001926
402 Ga0070716_100004968
403 Ga0070716_100012416
404 Ga0070716_100024443
405 Ga0070716_100027633
406 Ga0070712_100016737
407 Ga0070712_100052784
408 Ga0070712_100060617
409 Ga0070712_100076068
410 Ga0070712_100102448
411 Ga0097621_100156230
412 Ga0075428_100053321
413 Ga0075430_100040242
414 Ga0075431_100060966
415 Ga0075431_100286242
416 Ga0075433_10067845
417 Ga0075434_100011060
418 Ga0075429_100177534
419 Ga0075436_100104574
420 Ga0075436_100158352
421 Ga0075435_100015325
422 Ga0105240_10578579
423 Ga0105245_10591864
424 Ga0105245_10594387
425 Ga0114129_10011638
426 Ga0114129_10162230
427 Ga0105243_10021380
428 Ga0105237_10245325
429 Ga0105238_10340132
430 Ga0105249_10244865
431 Ga0105249_10373827
432 Ga0105239_10602741
433 Ga0157370_10295510
434 Ga0157369_10416762
435 Ga0157369_10701934
436 Ga0157374_10258313
437 Ga0163162_10241288
438 Ga0157372_10271097
439 Ga0157375_10547012
440 Ga0163163_10023806
441 Ga0163163_10119532
442 Ga0157377_10009718
443 Ga0157377_10042528
444 Ga0157377_10130498
445 Ga0163161_10298499
446 Ga0197907_10034890
447 Ga0197907_10853030
448 Ga0206349_1774012
449 Ga0206351_10351159
450 Ga0206351_10505476
451 Ga0206351_10974677
452 Ga0206350_11329816
453 Ga0206354_10775288
454 Ga0224712_10024790
455 Ga0224712_10037081
456 Ga0207692_10008853
457 Ga0207692_10071200
458 Ga0207647_10048588
459 Ga0207685_10032447
460 Ga0207699_10009282
461 Ga0207699_10009684
462 Ga0207699_10021059
463 Ga0207699_10069855
464 Ga0207699_10151903
465 Ga0207684_10000893
466 Ga0207684_10089733
467 Ga0207684_10148037
468 Ga0207693_10019026
469 Ga0207693_10039872
470 Ga0207693_10068404
471 Ga0207693_10087356
472 Ga0207693_10222193
473 Ga0207693_10473166
474 Ga0207663_10008438
475 Ga0207646_10000507
476 Ga0207646_10027443
477 Ga0207646_10299640
478 Ga0207700_10003873
479 Ga0207700_10015093
480 Ga0207700_10016669
481 Ga0207700_10040727
482 Ga0207700_10046558
483 Ga0207700_10150395
484 Ga0207700_10156016
485 Ga0207664_10007610
486 Ga0207664_10011313
487 Ga0207664_10011941
488 Ga0207664_10036761
489 Ga0207664_10054965
490 Ga0207664_10064164
491 Ga0207664_10118933
492 Ga0207664_10175865
493 Ga0207664_10240810
494 Ga0207664_10338781
495 Ga0207644_10008567
496 Ga0207709_10018042
497 Ga0207665_10002773
498 Ga0207665_10026138
499 Ga0207711_10556178
500 Ga0207667_10398882
501 Ga0207712_10018399
502 Ga0207712_10028377
503 Ga0207677_10283945
504 Ga0207702_10495007
505 Ga0207641_10172051
506 Ga0207674_10131380
507 Ga0207675_100005380
508 Ga0207675_100060152
509 Ga0207428_10008228
510 Ga0207428_10096568
511 Ga0265337_1002307
512 Ga0265326_10000983
513 Ga0265319_1003912
514 Ga0265334_10002472
515 Ga0265318_10020516
516 Ga0265322_10003289
517 Ga0265336_10009492
518 Ga0265338_10000683
519 Ga0265338_10000745
520 Ga0265324_10002266
521 Ga0265332_10004612
522 Ga0265320_10009340
523 Ga0265340_10007920
524 Ga0265340_10024841
525 Ga0265339_10197915
526 Ga0265316_10030867
527 Ga0265316_10128097
528 Ga0265313_10018317
529 Ga0307508_10204739
530 Ga0265314_10240052
531 Ga0265342_10012690
532 Ga0316212_1007677
533 Ga0373926_0000259
534 Ga0373926_0001034
535 Ga0373934_0004311
536 Ga0373944_0002205
537 Ga0373944_0004955
538 Ga0373923_0000889
539 Ga0373923_0030904
540 Ga0373936_0000091
541 Ga0373936_0003567
542 Ga0373936_0038829
543 Ga0373945_0000207
544 Ga0373945_0000301
545 Ga0373953_0026705
546 Ga0373956_0054641
547 Ga0373956_0125383
548 Ga0373943_0000596
549 Ga0373943_0002371
550 Ga0373946_0000354
551 Ga0373946_0000734
552 Ga0373955_0004673
553 Ga0373924_0005408
554 Ga0373924_0023544
555 Ga0373935_0000149
556 Ga0373935_0000521
557 Ga0373927_0000310
558 Ga0373927_0006938
559 Ga0373933_0154771
560 Ga0373947_0004252
561 Ga0373947_0011192
562 Ga0373937_0016299
563 Ga0265778_001964
564 Ga0372808_003179
565 Ga0373925_0000031
566 Ga0373925_0004571
567 Ga0373925_0020911
568 Ga0373925_0041410
569 Ga0436365_0730238
570 Ga0466963_0020422
571 Ga0466967_0020493
572 Ga0495592_0002994
573 Ga0495603_0020605
574 Ga0495603_0109210
575 Ga0495603_0358885
576 Ga0495629_0016338
577 Ga0495641_0005589
578 Ga0495651_0011305
579 Ga0495651_0035537
580 Ga0495651_0041979
581 Ga0495651_0099820
582 Ga0495651_0199598
583 Ga0495653_0001962
584 Ga0495653_0016916
585 Ga0495653_0050479
586 Ga0495580_0006765
587 Ga0495582_0022995
588 Ga0495582_0032327
589 Ga0495639_0000814
590 Ga0495662_0000648
591 Ga0495662_0030846
592 Ga0495662_0111046
593 Ga0495664_0000362
594 Ga0495664_0074009
595 Ga0495664_0103595
596 Ga0495594_0007327
597 Ga0495608_0033386
598 Ga0495618_0066593
599 Ga0495628_0021607
600 Ga0495630_0001459
601 Ga0495630_0082722
602 Ga0495630_0325608
603 Ga0495652_0002628
604 Ga0495652_0008351
605 Ga0495652_0140876
606 Ga0495665_0002325
607 Ga0495665_0017605
608 Ga0495640_0006176
609 Ga0495640_0016099
610 Ga0495586_0013851
611 Ga0495587_0023698
612 Ga0495645_0005197
613 Ga0495645_0072639
614 Ga0495667_0017403
615 Ga0495667_0029667
616 Ga0495667_0092556
617 Ga0495656_0048788
618 Ga0495634_0001382
619 Ga0495634_0042944
620 Ga0495635_0003178
621 Ga0495635_0076277
622 Ga0495635_0095804
623 Ga0495635_0125532
624 Ga0495657_0005910
625 Ga0495657_0061791
626 Ga0495657_0086318
627 Ga0495599_0015443
628 Ga0495599_0023132
629 Ga0495599_0074767
630 Ga0495599_0135701
631 Ga0495623_0007108
632 Ga0495646_0003000
633 Ga0495646_0039154
634 Ga0495647_0018829
635 Ga0495658_0015414
636 Ga0495613_0005733
637 Ga0495624_0001775
638 Ga0495624_0003378
639 Ga0495624_0077784
640 Ga0495600_0002473
641 Ga0495581_0000289
642 Ga0495604_0013244
643 Ga0495604_0270003
644 Ga0495674_0002939
645 Ga0495674_0012566
646 Ga0495674_0043063
647 Ga0495676_0024666
648 Ga0495676_0034580
649 Ga0495680_0001291
650 Ga0495680_0035441
651 Ga0495680_0140765
652 Ga0495680_0172525
653 Ga0495680_0182081
654 Ga0495684_0003233
655 Ga0495684_0010290
656 Ga0495684_0019896
657 Ga0495684_0035914
658 Ga0495593_0000263
659 Ga0495602_0017120
660 Ga0495602_0082394
661 Ga0495602_0128326
662 Ga0495614_0004860
663 Ga0496102_0088228
664 Ga0496102_0092909
665 Ga0496104_0001708
666 Ga0496105_0007265
667 Ga0496109_0092580
668 Ga0496109_0204567
669 Ga0496109_0208731
670 Ga0496110_0015141
671 Ga0496110_0029214
672 Ga0496111_0176001
673 Ga0496112_0035900
674 Ga0496114_0023109
675 Ga0496114_0314351
676 Ga0496114_0482308
677 Ga0496115_0008061
678 Ga0496115_0265454
679 nmdc:mga05p37_133434_c1
680 nmdc:mga05p37_226586_c1
681 nmdc:mga05p37_30940_c1
682 nmdc:mga0qj67_6492_c1
683 nmdc:mga06r32_434648_c1
684 nmdc:mga08y16_27877_c1
685 nmdc:mga0n895_113962_c1
686 nmdc:mga0rr50_138449_c1
687 nmdc:mga0rr50_30043_c1
688 nmdc:mga08x19_176255_c1
689 nmdc:mga08x19_18077_c1
690 nmdc:mga08x19_346650_c1
691 nmdc:mga08x19_521391_c1
692 nmdc:mga0a205_60473_c1
693 Ga0495601_0018185
694 Ga0495601_0069883
695 Ga0495601_0267524
696 Ga0495612_0013705
697 Ga0495595_0009996
698 Ga0495619_0035956
699 Ga0495619_0036509
700 Ga0495619_0044569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

133

293

0.9

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

12

126

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8801 1 290
2p1r-assembly2.cif.gz_D crystal structure of salmonella typhimurium yegs, a putative lipid kinase homologous to eukaryotic sphingosine and diacylglycerol kinases. 0.8659 2 290
2p1r-assembly2.cif.gz_B crystal structure of salmonella typhimurium yegs, a putative lipid kinase homologous to eukaryotic sphingosine and diacylglycerol kinases. 0.8619 3 290
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8546 1 290
2bon-assembly2.cif.gz_B structure of an escherichia coli lipid kinase (yegs) 0.8534 4 290
ID Description Score Start End Superfamily
2jgrA02 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8746 162 282 2.60.200.40
2qvlA02 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8727 168 276 2.60.200.40
2p1rA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8522 2 116 3.40.50.10330
af_A4I203_661_926_2.60.200.40 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8332 182 279 2.60.200.40
af_P9WP29_9_143_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8329 1 114 3.40.50.10330
ID Description Score Start End GO Terms
AF-W7VI28-F1-model_v4 deleted 0.9435 4 290
AF-A0A2G1C5B1-F1-model_v4 deleted 0.9193 3 290
AF-A0A4Q3SNT8-F1-model_v4 deleted 0.9176 38 289
AF-A0A1G6GG18-F1-model_v4 Diacylglycerol kinase family enzyme 0.9173 2 290 GO:0005524
GO:0016020
GO:0016301
AF-A0A3N1ZVL3-F1-model_v4 YegS/Rv2252/BmrU family lipid kinase 0.9163 2 290 GO:0008610
GO:0016020
GO:0016301
GO:0016787
GO:1901137

Map