F418259
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 253 | 286 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300025900|Ga0207710_10035924|Ga0207710_100359244 |
| Length | 174 |
| Sequence | MQNRNIRRMIGLPILDKMFDEQGSLRMYANILVSTDGSDVAKKGVQHGIALAKALNAKVTVITVTEPVPVFFYGFGHSSGWIPAQEDFDAVCEEFAGKVLDGARVTADQIGLSAELLHVQNAHPATAIIETAKSRGCDLIVMATHGRRGLRKLFMGSQTSEVLVNGSVPVLVVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 2 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 3 | 2791355199 | |||
| 4 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 5 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 6 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 7 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 8 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 9 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 10 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 11 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 12 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 13 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 14 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 15 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 16 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 17 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 18 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 19 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 20 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 21 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 22 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 23 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 24 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 25 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 26 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 27 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 28 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 29 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 30 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 31 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 32 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 33 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 34 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 35 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 36 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 37 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 38 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 39 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 40 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 41 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 42 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 43 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 44 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 45 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 46 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 47 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 48 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 49 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 50 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 51 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 52 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 53 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 54 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 56 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 57 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 58 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 59 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 60 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 66 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 67 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 108 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 109 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 168 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 227 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 228 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 229 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 230 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 231 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 238 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 240 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 241 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 242 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 243 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 244 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 247 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 248 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 249 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 250 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 251 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 252 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 253 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.95 |
| Metatranscriptomes | 0 |
| Isolates | 18.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.14 |
| Nodule | 15.71 |
| Rhizoplane | 13.71 |
| Rhizosphere | 50.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10040927 | 3300002244 | Bacteria | 826 |
| 2 | JGI25406J46586_10076416 | 3300003203 | Bacteria | 1037 |
| 3 | JGI25153J46596_10000525 | 3300003215 | Bacteria | 24072 |
| 4 | JGI25153J46596_10000709 | 3300003215 | Bacteria | 20357 |
| 5 | rootH1_10150693 | 3300003316 | Bacteria | 1167 |
| 6 | rootH2_10119237 | 3300003320 | Bacteria | 2779 |
| 7 | rootL2_10053366 | 3300003322 | Bacteria | 2467 |
| 8 | JGI25160J50197_1000671 | 3300003354 | Bacteria | 19035 |
| 9 | Ga0055526_1070432 | 3300003771 | Bacteria | 711 |
| 10 | Ga0055531_10008243 | 3300003794 | Bacteria | 5541 |
| 11 | Ga0065165_1015087 | 3300005262 | Bacteria | 2963 |
| 12 | Ga0070683_100996311 | 3300005329 | Bacteria | 804 |
| 13 | Ga0070690_100710608 | 3300005330 | Bacteria | 773 |
| 14 | Ga0068869_100068186 | 3300005334 | Bacteria | 2627 |
| 15 | Ga0068868_100925569 | 3300005338 | Bacteria | 794 |
| 16 | Ga0070668_100157374 | 3300005347 | Bacteria | 1841 |
| 17 | Ga0070674_100080828 | 3300005356 | Bacteria | 2321 |
| 18 | Ga0070673_100524722 | 3300005364 | Bacteria | 1074 |
| 19 | Ga0070667_100438891 | 3300005367 | Bacteria | 1192 |
| 20 | Ga0070709_10035355 | 3300005434 | Bacteria | 3036 |
| 21 | Ga0070713_100004209 | 3300005436 | Bacteria | 9607 |
| 22 | Ga0070713_100531723 | 3300005436 | Bacteria | 1112 |
| 23 | Ga0070710_10005820 | 3300005437 | Bacteria | 5880 |
| 24 | Ga0070711_100003431 | 3300005439 | Bacteria | 9233 |
| 25 | Ga0070705_100142035 | 3300005440 | Bacteria | 1581 |
| 26 | Ga0070700_100158990 | 3300005441 | Bacteria | 1553 |
| 27 | Ga0070663_100036182 | 3300005455 | Bacteria | 3429 |
| 28 | Ga0070678_100309885 | 3300005456 | Bacteria | 1344 |
| 29 | Ga0070662_100046446 | 3300005457 | Bacteria | 3120 |
| 30 | Ga0070662_100436783 | 3300005457 | Bacteria | 1085 |
| 31 | Ga0070681_10818090 | 3300005458 | Bacteria | 849 |
| 32 | Ga0070685_10185725 | 3300005466 | Bacteria | 1341 |
| 33 | Ga0070679_100371960 | 3300005530 | Bacteria | 1376 |
| 34 | Ga0070684_100013030 | 3300005535 | Bacteria | 6690 |
| 35 | Ga0070684_100186065 | 3300005535 | Bacteria | 1889 |
| 36 | Ga0070684_100400887 | 3300005535 | Bacteria | 1265 |
| 37 | Ga0068853_100958217 | 3300005539 | Bacteria | 823 |
| 38 | Ga0070665_100069717 | 3300005548 | Bacteria | 3524 |
| 39 | Ga0070665_101151968 | 3300005548 | Bacteria | 786 |
| 40 | Ga0068855_100267817 | 3300005563 | Bacteria | 1901 |
| 41 | Ga0068855_100655734 | 3300005563 | Bacteria | 1127 |
| 42 | Ga0068856_100272323 | 3300005614 | Bacteria | 1709 |
| 43 | Ga0068856_100568412 | 3300005614 | Bacteria | 1155 |
| 44 | Ga0070702_100642081 | 3300005615 | Bacteria | 802 |
| 45 | Ga0068852_100141978 | 3300005616 | Bacteria | 2224 |
| 46 | Ga0068852_100245230 | 3300005616 | Bacteria | 1714 |
| 47 | Ga0068852_100338101 | 3300005616 | Bacteria | 1467 |
| 48 | Ga0068864_100238058 | 3300005618 | Bacteria | 1686 |
| 49 | Ga0068866_10891858 | 3300005718 | Bacteria | 625 |
| 50 | Ga0068861_100090626 | 3300005719 | Bacteria | 2412 |
| 51 | Ga0068861_100936991 | 3300005719 | Bacteria | 823 |
| 52 | Ga0068863_100658687 | 3300005841 | Bacteria | 1039 |
| 53 | Ga0068863_100761486 | 3300005841 | Bacteria | 964 |
| 54 | Ga0068858_102217483 | 3300005842 | Bacteria | 543 |
| 55 | Ga0068860_101241597 | 3300005843 | Bacteria | 766 |
| 56 | Ga0081455_10002785 | 3300005937 | Bacteria | 20594 |
| 57 | Ga0081455_10007307 | 3300005937 | Bacteria | 11653 |
| 58 | Ga0081455_10023987 | 3300005937 | Bacteria | 5661 |
| 59 | Ga0081455_10310090 | 3300005937 | Bacteria | 1128 |
| 60 | Ga0081540_1060376 | 3300005983 | Bacteria | 1814 |
| 61 | Ga0081540_1174300 | 3300005983 | Bacteria | 814 |
| 62 | Ga0081539_10001607 | 3300005985 | Bacteria | 37194 |
| 63 | Ga0070717_10066097 | 3300006028 | Bacteria | 3007 |
| 64 | Ga0070717_10884662 | 3300006028 | Bacteria | 813 |
| 65 | Ga0075365_10005221 | 3300006038 | Bacteria | 6984 |
| 66 | Ga0075365_10067119 | 3300006038 | Bacteria | 2408 |
| 67 | Ga0075365_10235085 | 3300006038 | Bacteria | 1287 |
| 68 | Ga0070715_10213066 | 3300006163 | Bacteria | 988 |
| 69 | Ga0075367_10118829 | 3300006178 | Bacteria | 1628 |
| 70 | Ga0075367_10439418 | 3300006178 | Bacteria | 826 |
| 71 | Ga0075367_10589759 | 3300006178 | Bacteria | 706 |
| 72 | Ga0097621_100053491 | 3300006237 | Bacteria | 3291 |
| 73 | Ga0075370_10073223 | 3300006353 | Bacteria | 1961 |
| 74 | Ga0068871_100063957 | 3300006358 | Bacteria | 3010 |
| 75 | Ga0068871_100124039 | 3300006358 | Bacteria | 2184 |
| 76 | Ga0068871_100708501 | 3300006358 | Bacteria | 923 |
| 77 | Ga0068865_101300237 | 3300006881 | Bacteria | 647 |
| 78 | Ga0099824_1029471 | 3300006942 | Bacteria | 2335 |
| 79 | Ga0099822_1003710 | 3300006943 | Bacteria | 19679 |
| 80 | Ga0105251_10447251 | 3300009011 | Bacteria | 599 |
| 81 | Ga0105240_10030110 | 3300009093 | Bacteria | 7059 |
| 82 | Ga0105247_10102883 | 3300009101 | Bacteria | 1828 |
| 83 | Ga0105247_10312791 | 3300009101 | Bacteria | 1093 |
| 84 | Ga0105243_10665428 | 3300009148 | Bacteria | 1011 |
| 85 | Ga0105241_11459521 | 3300009174 | Bacteria | 657 |
| 86 | Ga0105242_10413784 | 3300009176 | Bacteria | 1261 |
| 87 | Ga0105242_11877231 | 3300009176 | Bacteria | 639 |
| 88 | Ga0105248_10680337 | 3300009177 | Bacteria | 1161 |
| 89 | Ga0105237_10063193 | 3300009545 | Bacteria | 3700 |
| 90 | Ga0105237_10099477 | 3300009545 | Bacteria | 2900 |
| 91 | Ga0105237_10128176 | 3300009545 | Bacteria | 2532 |
| 92 | Ga0105238_10773849 | 3300009551 | Bacteria | 974 |
| 93 | Ga0105239_10146839 | 3300010375 | Bacteria | 2631 |
| 94 | Ga0105239_10177496 | 3300010375 | Bacteria | 2383 |
| 95 | Ga0105239_11529892 | 3300010375 | Bacteria | 771 |
| 96 | Ga0105246_10004377 | 3300011119 | Bacteria | 8594 |
| 97 | Ga0105246_10056500 | 3300011119 | Bacteria | 2713 |
| 98 | Ga0157371_11078257 | 3300013102 | Bacteria | 615 |
| 99 | Ga0157370_10093087 | 3300013104 | Bacteria | 2828 |
| 100 | Ga0157369_10026947 | 3300013105 | Bacteria | 6374 |
| 101 | Ga0163162_10155737 | 3300013306 | Bacteria | 2405 |
| 102 | Ga0157372_10047361 | 3300013307 | Bacteria | 4777 |
| 103 | Ga0157375_10435709 | 3300013308 | Bacteria | 1477 |
| 104 | Ga0163163_10011648 | 3300014325 | Bacteria | 7988 |
| 105 | Ga0163163_10022927 | 3300014325 | Bacteria | 5919 |
| 106 | Ga0163163_10183089 | 3300014325 | Bacteria | 2142 |
| 107 | Ga0157380_10198972 | 3300014326 | Bacteria | 1776 |
| 108 | Ga0182008_10150749 | 3300014497 | Bacteria | 1166 |
| 109 | Ga0157379_10078048 | 3300014968 | Bacteria | 2966 |
| 110 | Ga0157379_10562999 | 3300014968 | Bacteria | 1061 |
| 111 | Ga0157376_10555969 | 3300014969 | Bacteria | 1136 |
| 112 | Ga0157376_11454269 | 3300014969 | Bacteria | 718 |
| 113 | Ga0163161_10176807 | 3300017792 | Bacteria | 1634 |
| 114 | Ga0163161_10258928 | 3300017792 | Bacteria | 1358 |
| 115 | Ga0209233_1064778 | 3300025261 | Bacteria | 694 |
| 116 | Ga0209564_1006350 | 3300025295 | Bacteria | 6413 |
| 117 | Ga0209564_1027715 | 3300025295 | Bacteria | 1832 |
| 118 | Ga0209758_1000117 | 3300025297 | Bacteria | 198325 |
| 119 | Ga0209758_1001957 | 3300025297 | Bacteria | 22263 |
| 120 | Ga0209758_1005617 | 3300025297 | Bacteria | 9525 |
| 121 | Ga0209256_1002709 | 3300025299 | Bacteria | 13817 |
| 122 | Ga0207426_1000213 | 3300025302 | Bacteria | 137311 |
| 123 | Ga0207426_1007812 | 3300025302 | Bacteria | 4423 |
| 124 | Ga0207426_1013299 | 3300025302 | Bacteria | 3054 |
| 125 | Ga0209051_1075834 | 3300025303 | Bacteria | 991 |
| 126 | Ga0209257_1001342 | 3300025304 | Bacteria | 29838 |
| 127 | Ga0209257_1065304 | 3300025304 | Bacteria | 976 |
| 128 | Ga0207697_10475593 | 3300025315 | Bacteria | 553 |
| 129 | Ga0207692_10008854 | 3300025898 | Bacteria | 4183 |
| 130 | Ga0207642_10733121 | 3300025899 | Bacteria | 625 |
| 131 | Ga0207710_10035924 | 3300025900 | Bacteria | 2182 |
| 132 | Ga0207688_10272021 | 3300025901 | Bacteria | 1031 |
| 133 | Ga0207680_10131665 | 3300025903 | Bacteria | 1649 |
| 134 | Ga0207647_10158310 | 3300025904 | Bacteria | 1322 |
| 135 | Ga0207647_10171374 | 3300025904 | Bacteria | 1263 |
| 136 | Ga0207699_10126485 | 3300025906 | Bacteria | 1660 |
| 137 | Ga0207695_10022857 | 3300025913 | Bacteria | 7083 |
| 138 | Ga0207671_10043998 | 3300025914 | Bacteria | 3301 |
| 139 | Ga0207671_10626257 | 3300025914 | Bacteria | 857 |
| 140 | Ga0207663_10024152 | 3300025916 | Bacteria | 3498 |
| 141 | Ga0207662_10269363 | 3300025918 | Bacteria | 1123 |
| 142 | Ga0207646_10651313 | 3300025922 | Bacteria | 944 |
| 143 | Ga0207650_11328492 | 3300025925 | Bacteria | 612 |
| 144 | Ga0207700_10002857 | 3300025928 | Bacteria | 9942 |
| 145 | Ga0207700_10467424 | 3300025928 | Bacteria | 1113 |
| 146 | Ga0207664_10095673 | 3300025929 | Bacteria | 2444 |
| 147 | Ga0207706_10464853 | 3300025933 | Bacteria | 1094 |
| 148 | Ga0207661_10036379 | 3300025944 | Bacteria | 3842 |
| 149 | Ga0207679_10186710 | 3300025945 | Bacteria | 1720 |
| 150 | Ga0207679_10562390 | 3300025945 | Bacteria | 1024 |
| 151 | Ga0207712_10028198 | 3300025961 | Bacteria | 3753 |
| 152 | Ga0207668_10064334 | 3300025972 | Bacteria | 2591 |
| 153 | Ga0207677_10377250 | 3300026023 | Bacteria | 1196 |
| 154 | Ga0207703_10043625 | 3300026035 | Bacteria | 3600 |
| 155 | Ga0207678_10016379 | 3300026067 | Bacteria | 6508 |
| 156 | Ga0207676_10118105 | 3300026095 | Bacteria | 2232 |
| 157 | Ga0207676_10266966 | 3300026095 | Bacteria | 1548 |
| 158 | Ga0207676_10537931 | 3300026095 | Bacteria | 1114 |
| 159 | Ga0207675_100252114 | 3300026118 | Bacteria | 1708 |
| 160 | Ga0207683_10442149 | 3300026121 | Bacteria | 1198 |
| 161 | Ga0207698_10209459 | 3300026142 | Bacteria | 1753 |
| 162 | Ga0207698_11347909 | 3300026142 | Bacteria | 728 |
| 163 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 164 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 165 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 166 | Ga0268266_10418038 | 3300028379 | Bacteria | 1270 |
| 167 | Ga0268264_10170719 | 3300028381 | Bacteria | 1967 |
| 168 | Ga0268264_10797834 | 3300028381 | Bacteria | 943 |
| 169 | Ga0373955_0679487 | 3300035172 | Bacteria | 632 |
| 170 | Ga0373927_0225554 | 3300035695 | Bacteria | 1231 |
| 171 | Ga0373927_0295244 | 3300035695 | Bacteria | 1066 |
| 172 | Ga0395900_0195654 | 3300037418 | Bacteria | 2049 |
| 173 | Ga0395900_0348021 | 3300037418 | Bacteria | 1456 |
| 174 | Ga0395898_0243518 | 3300037466 | Bacteria | 1715 |
| 175 | Ga0395905_0258642 | 3300037471 | Bacteria | 1625 |
| 176 | Ga0395905_0892684 | 3300037471 | Bacteria | 792 |
| 177 | Ga0436364_1559429 | 3300037853 | Bacteria | 849 |
| 178 | Ga0395901_0050301 | 3300038443 | Bacteria | 4331 |
| 179 | Ga0395901_0111347 | 3300038443 | Bacteria | 2875 |
| 180 | Ga0451791_1821125 | 3300041451 | Bacteria | 1293 |
| 181 | Ga0451807_1817701 | 3300041486 | Bacteria | 1227 |
| 182 | Ga0451853_0343720 | 3300041512 | Bacteria | 1405 |
| 183 | Ga0466963_0104864 | 3300044694 | Bacteria | 1937 |
| 184 | Ga0466971_0207611 | 3300044719 | Bacteria | 926 |
| 185 | Ga0466967_0755404 | 3300045976 | Bacteria | 964 |
| 186 | Ga0495617_059859 | 3300046452 | Bacteria | 1261 |
| 187 | Ga0495629_0007804 | 3300046459 | Bacteria | 7876 |
| 188 | Ga0495605_0029094 | 3300046474 | Bacteria | 2847 |
| 189 | Ga0495584_0174127 | 3300046491 | Bacteria | 1094 |
| 190 | Ga0495585_0158207 | 3300046492 | Bacteria | 1177 |
| 191 | Ga0495596_0020716 | 3300046500 | Bacteria | 2690 |
| 192 | Ga0495606_0296511 | 3300046507 | Bacteria | 878 |
| 193 | Ga0495631_0168810 | 3300046518 | Bacteria | 938 |
| 194 | Ga0495643_0152606 | 3300046522 | Bacteria | 1143 |
| 195 | Ga0495652_0205263 | 3300046529 | Bacteria | 1492 |
| 196 | Ga0495640_0806276 | 3300046533 | Bacteria | 559 |
| 197 | Ga0495622_0009257 | 3300046557 | Bacteria | 4559 |
| 198 | Ga0495661_0244329 | 3300046665 | Bacteria | 919 |
| 199 | Ga0495657_0051707 | 3300046675 | Bacteria | 2758 |
| 200 | Ga0495658_0353492 | 3300046683 | Bacteria | 934 |
| 201 | Ga0495589_0369541 | 3300046794 | Bacteria | 660 |
| 202 | Ga0495636_0579876 | 3300047318 | Bacteria | 547 |
| 203 | Ga0495676_0133456 | 3300047321 | Bacteria | 1789 |
| 204 | Ga0495673_0082212 | 3300047469 | Bacteria | 1332 |
| 205 | Ga0495673_0086187 | 3300047469 | Bacteria | 1291 |
| 206 | Ga0495684_0275163 | 3300047471 | Bacteria | 1217 |
| 207 | Ga0495686_0136128 | 3300047472 | Bacteria | 1453 |
| 208 | Ga0495686_0576922 | 3300047472 | Bacteria | 585 |
| 209 | Ga0495593_0185577 | 3300047673 | Bacteria | 1047 |
| 210 | Ga0495614_0167520 | 3300048089 | Bacteria | 985 |
| 211 | Ga0496100_0069238 | 3300048903 | Bacteria | 2349 |
| 212 | Ga0496101_0146490 | 3300048904 | Bacteria | 1803 |
| 213 | Ga0496101_0438338 | 3300048904 | Bacteria | 1030 |
| 214 | Ga0496102_0069974 | 3300048905 | Bacteria | 3221 |
| 215 | Ga0496102_0123720 | 3300048905 | Bacteria | 2417 |
| 216 | Ga0496102_0305867 | 3300048905 | Bacteria | 1498 |
| 217 | Ga0496102_0344157 | 3300048905 | Bacteria | 1404 |
| 218 | Ga0496103_0081921 | 3300048906 | Bacteria | 2030 |
| 219 | Ga0496103_0127093 | 3300048906 | Bacteria | 1626 |
| 220 | Ga0496104_0021222 | 3300048907 | Bacteria | 5959 |
| 221 | Ga0496104_0040287 | 3300048907 | Bacteria | 4378 |
| 222 | Ga0496104_0172091 | 3300048907 | Bacteria | 2076 |
| 223 | Ga0496105_0026563 | 3300048908 | Bacteria | 4725 |
| 224 | Ga0496105_0036549 | 3300048908 | Bacteria | 4046 |
| 225 | Ga0496105_0100551 | 3300048908 | Bacteria | 2388 |
| 226 | Ga0496105_0829511 | 3300048908 | Bacteria | 701 |
| 227 | Ga0496105_0839704 | 3300048908 | Bacteria | 696 |
| 228 | Ga0496106_0084762 | 3300048909 | Bacteria | 2438 |
| 229 | Ga0496106_0090164 | 3300048909 | Bacteria | 2366 |
| 230 | Ga0496106_0229640 | 3300048909 | Bacteria | 1481 |
| 231 | Ga0496106_0885879 | 3300048909 | Bacteria | 705 |
| 232 | Ga0496107_0103643 | 3300048910 | Bacteria | 2087 |
| 233 | Ga0496107_0263379 | 3300048910 | Bacteria | 1283 |
| 234 | Ga0496107_0306100 | 3300048910 | Bacteria | 1183 |
| 235 | Ga0496108_0012497 | 3300048911 | Bacteria | 6913 |
| 236 | Ga0496108_0143491 | 3300048911 | Bacteria | 2057 |
| 237 | Ga0496108_0443732 | 3300048911 | Bacteria | 1134 |
| 238 | Ga0496108_0444089 | 3300048911 | Bacteria | 1133 |
| 239 | Ga0496109_0014187 | 3300048912 | Bacteria | 6929 |
| 240 | Ga0496109_0068495 | 3300048912 | Bacteria | 3253 |
| 241 | Ga0496109_0262672 | 3300048912 | Bacteria | 1626 |
| 242 | Ga0496110_0319776 | 3300048913 | Bacteria | 1413 |
| 243 | Ga0496111_0087836 | 3300048914 | Bacteria | 2276 |
| 244 | Ga0496111_0138765 | 3300048914 | Bacteria | 1801 |
| 245 | Ga0496111_0299462 | 3300048914 | Bacteria | 1192 |
| 246 | Ga0496112_0021296 | 3300048915 | Bacteria | 6163 |
| 247 | Ga0496112_0109379 | 3300048915 | Bacteria | 2734 |
| 248 | Ga0496113_0165180 | 3300048916 | Bacteria | 1751 |
| 249 | Ga0496114_0118526 | 3300048917 | Bacteria | 2274 |
| 250 | Ga0496114_0209226 | 3300048917 | Bacteria | 1710 |
| 251 | Ga0496114_0737559 | 3300048917 | Bacteria | 862 |
| 252 | Ga0496115_0034820 | 3300048918 | Bacteria | 3980 |
| 253 | Ga0496115_0118228 | 3300048918 | Bacteria | 2180 |
| 254 | Ga0496115_0154545 | 3300048918 | Bacteria | 1895 |
| 255 | Ga0496115_0348099 | 3300048918 | Bacteria | 1209 |
| 256 | Ga0496115_0884619 | 3300048918 | Bacteria | 690 |
| 257 | Ga0496116_0026015 | 3300048919 | Bacteria | 4289 |
| 258 | Ga0496117_0139886 | 3300048920 | Bacteria | 1452 |
| 259 | Ga0496119_0021318 | 3300048922 | Bacteria | 4687 |
| 260 | Ga0496119_0148203 | 3300048922 | Bacteria | 1260 |
| 261 | Ga0496120_0038254 | 3300048923 | Bacteria | 2840 |
| 262 | Ga0496121_0006909 | 3300048924 | Bacteria | 13842 |
| 263 | Ga0496121_0435212 | 3300048924 | Bacteria | 849 |
| 264 | Ga0496125_0018653 | 3300048928 | Bacteria | 6583 |
| 265 | Ga0496125_0068102 | 3300048928 | Bacteria | 2802 |
| 266 | Ga0496126_0038471 | 3300048929 | Bacteria | 4451 |
| 267 | Ga0496126_0109693 | 3300048929 | Bacteria | 2405 |
| 268 | Ga0495682_0106562 | 3300049460 | Bacteria | 1005 |
| 269 | Ga0501046_0156631 | 3300049580 | Bacteria | 1715 |
| 270 | Ga0501047_0577412 | 3300049581 | Bacteria | 947 |
| 271 | Ga0501070_0052420 | 3300049586 | Bacteria | 3386 |
| 272 | Ga0501079_0900266 | 3300049741 | Bacteria | 697 |
| 273 | Ga0501044_1355162 | 3300049823 | Bacteria | 577 |
| 274 | nmdc:mga03683_248840_c1 | 3300050489 | Bacteria | 825 |
| 275 | nmdc:mga03683_512078_c1 | 3300050489 | Bacteria | 582 |
| 276 | nmdc:mga0yw44_10605_c1 | 3300050492 | Bacteria | 4716 |
| 277 | nmdc:mga0yw44_143602_c1 | 3300050492 | Bacteria | 1552 |
| 278 | nmdc:mga0yw44_89951_c1 | 3300050492 | Bacteria | 1938 |
| 279 | nmdc:mga0k408_197587_c1 | 3300050493 | Bacteria | 1200 |
| 280 | nmdc:mga0sz30_34825_c1 | 3300050516 | Bacteria | 2099 |
| 281 | Ga0500569_001126 | 3300053109 | Bacteria | 4915 |
| 282 | Ga0500655_124895 | 3300053133 | Bacteria | 547 |
| 283 | Ga0500616_0124056 | 3300053153 | Bacteria | 1229 |
| 284 | Ga0500636_0300464 | 3300053177 | Bacteria | 791 |
| 285 | Ga0500649_100182 | 3300053722 | Bacteria | 1145 |
| 286 | Ga0500609_003170 | 3300053731 | Bacteria | 2327 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0156631 | Ga0501046_0156631_46_432 | 128 |
| 2 | 3300049741 | Ga0501079_0900266 | Ga0501079_0900266_271_657 | 128 |
| 3 | 3300049823 | Ga0501044_1355162 | Ga0501044_1355162_62_448 | 128 |
| 4 | 3300048929 | Ga0496126_0109693 | Ga0496126_0109693_37_489 | 132 |
| 5 | iso_pu_bacteria | 2791355199 | 2793078849 | 145 |
| 6 | 3300035172 | Ga0373955_0679487 | Ga0373955_0679487_121_564 | 146 |
| 7 | iso_pu_bacteria | 2513237141 | 2513891546 | 146 |
| 8 | iso_pu_bacteria | 2528768022 | 2528849230 | 146 |
| 9 | iso_pu_bacteria | 2824600985 | 2824607677 | 146 |
| 10 | iso_pu_bacteria | 2824609381 | 2824616831 | 146 |
| 11 | iso_pu_bacteria | 2824653114 | 2824658918 | 146 |
| 12 | iso_pu_bacteria | 2857509624 | 2857512618 | 146 |
| 13 | iso_pu_bacteria | 2881364244 | 2881366084 | 146 |
| 14 | iso_pu_bacteria | 2885374607 | 2885375219 | 146 |
| 15 | iso_pu_bacteria | 2885383462 | 2885392991 | 146 |
| 16 | iso_pu_bacteria | 2885409591 | 2885410588 | 146 |
| 17 | iso_pu_bacteria | 2888419890 | 2888421484 | 146 |
| 18 | iso_pu_bacteria | 2929615660 | 2929619331 | 146 |
| 19 | iso_pu_bacteria | 2929624759 | 2929628199 | 146 |
| 20 | iso_pu_bacteria | 2932794094 | 2932800776 | 146 |
| 21 | iso_pu_bacteria | 2932801729 | 2932803394 | 146 |
| 22 | iso_pu_bacteria | 2933577622 | 2933581252 | 146 |
| 23 | iso_pu_bacteria | 2935883170 | 2935886466 | 146 |
| 24 | iso_pu_bacteria | 2935883170 | 2935888608 | 146 |
| 25 | iso_pu_bacteria | 2935959822 | 2935964511 | 146 |
| 26 | iso_pu_bacteria | 8055742211 | 8055749411 | 146 |
| 27 | 3300005842 | Ga0068858_102217483 | Ga0068858_1022174831 | 147 |
| 28 | 3300014969 | Ga0157376_11454269 | Ga0157376_114542691 | 147 |
| 29 | 3300046533 | Ga0495640_0806276 | Ga0495640_0806276_11_454 | 147 |
| 30 | 3300005937 | Ga0081455_10002785 | Ga0081455_1000278513 | 149 |
| 31 | iso_pu_bacteria | 2528768022 | 2528855874 | 149 |
| 32 | iso_pu_bacteria | 2824661429 | 2824665900 | 149 |
| 33 | iso_pu_bacteria | 2879099564 | 2879106281 | 149 |
| 34 | iso_pu_bacteria | 2929624759 | 2929631751 | 149 |
| 35 | iso_pu_bacteria | 2932784394 | 2932790258 | 149 |
| 36 | iso_pu_bacteria | 2932809354 | 2932815837 | 149 |
| 37 | iso_pu_bacteria | 2932818245 | 2932824725 | 149 |
| 38 | iso_pu_bacteria | 2932828146 | 2932833284 | 149 |
| 39 | iso_pu_bacteria | 2933577622 | 2933583540 | 149 |
| 40 | iso_pu_bacteria | 2935616580 | 2935621442 | 149 |
| 41 | iso_pu_bacteria | 2935638405 | 2935644791 | 149 |
| 42 | iso_pu_bacteria | 2935665750 | 2935672395 | 149 |
| 43 | iso_pu_bacteria | 2935675223 | 2935682837 | 149 |
| 44 | iso_pu_bacteria | 2935684952 | 2935693258 | 149 |
| 45 | iso_pu_bacteria | 2935694250 | 2935702145 | 149 |
| 46 | iso_pu_bacteria | 2935703347 | 2935710934 | 149 |
| 47 | iso_pu_bacteria | 2935713505 | 2935720953 | 149 |
| 48 | iso_pu_bacteria | 2935722832 | 2935730560 | 149 |
| 49 | iso_pu_bacteria | 2935732158 | 2935740675 | 149 |
| 50 | iso_pu_bacteria | 2935741537 | 2935749851 | 149 |
| 51 | iso_pu_bacteria | 2935750917 | 2935759329 | 149 |
| 52 | iso_pu_bacteria | 2935760218 | 2935767222 | 149 |
| 53 | iso_pu_bacteria | 2935801545 | 2935808884 | 149 |
| 54 | iso_pu_bacteria | 2935810662 | 2935817681 | 149 |
| 55 | iso_pu_bacteria | 2935827899 | 2935834041 | 149 |
| 56 | iso_pu_bacteria | 2935837841 | 2935845468 | 149 |
| 57 | iso_pu_bacteria | 2935855204 | 2935859365 | 149 |
| 58 | iso_pu_bacteria | 2935864058 | 2935869992 | 149 |
| 59 | iso_pu_bacteria | 2935873716 | 2935880954 | 149 |
| 60 | iso_pu_bacteria | 2935992306 | 2935998272 | 149 |
| 61 | iso_pu_bacteria | 2936002035 | 2936009173 | 149 |
| 62 | iso_pu_bacteria | 2936037263 | 2936044418 | 149 |
| 63 | iso_pu_bacteria | 2940556831 | 2940565145 | 149 |
| 64 | iso_pu_bacteria | 2941538514 | 2941542928 | 149 |
| 65 | iso_pu_bacteria | 3005506211 | 3005507712 | 149 |
| 66 | iso_pu_bacteria | 3005710791 | 3005715923 | 149 |
| 67 | iso_pu_bacteria | 8006984368 | 8006992781 | 149 |
| 68 | iso_pu_bacteria | 8016511872 | 8016519821 | 149 |
| 69 | iso_pu_bacteria | 8017057580 | 8017065719 | 149 |
| 70 | iso_pu_bacteria | 8019576017 | 8019585149 | 149 |
| 71 | iso_pu_bacteria | 8019586578 | 8019593119 | 149 |
| 72 | iso_pu_bacteria | 8019608314 | 8019610033 | 149 |
| 73 | iso_pu_bacteria | 8055742211 | 8055744362 | 149 |
| 74 | 3300003203 | JGI25406J46586_10076416 | JGI25406J46586_100764162 | 150 |
| 75 | 3300005329 | Ga0070683_100996311 | Ga0070683_1009963111 | 150 |
| 76 | 3300005434 | Ga0070709_10035355 | Ga0070709_100353552 | 150 |
| 77 | 3300005436 | Ga0070713_100004209 | Ga0070713_1000042094 | 150 |
| 78 | 3300005436 | Ga0070713_100531723 | Ga0070713_1005317232 | 150 |
| 79 | 3300005437 | Ga0070710_10005820 | Ga0070710_100058207 | 150 |
| 80 | 3300005439 | Ga0070711_100003431 | Ga0070711_1000034314 | 150 |
| 81 | 3300005440 | Ga0070705_100142035 | Ga0070705_1001420352 | 150 |
| 82 | 3300005458 | Ga0070681_10818090 | Ga0070681_108180901 | 150 |
| 83 | 3300005466 | Ga0070685_10185725 | Ga0070685_101857252 | 150 |
| 84 | 3300005530 | Ga0070679_100371960 | Ga0070679_1003719601 | 150 |
| 85 | 3300005535 | Ga0070684_100013030 | Ga0070684_1000130305 | 150 |
| 86 | 3300005535 | Ga0070684_100186065 | Ga0070684_1001860653 | 150 |
| 87 | 3300005539 | Ga0068853_100958217 | Ga0068853_1009582171 | 150 |
| 88 | 3300005548 | Ga0070665_100069717 | Ga0070665_1000697172 | 150 |
| 89 | 3300005614 | Ga0068856_100272323 | Ga0068856_1002723233 | 150 |
| 90 | 3300005614 | Ga0068856_100568412 | Ga0068856_1005684122 | 150 |
| 91 | 3300005616 | Ga0068852_100141978 | Ga0068852_1001419783 | 150 |
| 92 | 3300005616 | Ga0068852_100245230 | Ga0068852_1002452303 | 150 |
| 93 | 3300005937 | Ga0081455_10007307 | Ga0081455_100073071 | 150 |
| 94 | 3300005937 | Ga0081455_10023987 | Ga0081455_100239872 | 150 |
| 95 | 3300005937 | Ga0081455_10310090 | Ga0081455_103100903 | 150 |
| 96 | 3300005983 | Ga0081540_1060376 | Ga0081540_10603764 | 150 |
| 97 | 3300005985 | Ga0081539_10001607 | Ga0081539_1000160714 | 150 |
| 98 | 3300006028 | Ga0070717_10066097 | Ga0070717_100660972 | 150 |
| 99 | 3300006028 | Ga0070717_10884662 | Ga0070717_108846622 | 150 |
| 100 | 3300006038 | Ga0075365_10005221 | Ga0075365_100052216 | 150 |
| 101 | 3300006038 | Ga0075365_10235085 | Ga0075365_102350851 | 150 |
| 102 | 3300006163 | Ga0070715_10213066 | Ga0070715_102130662 | 150 |
| 103 | 3300006178 | Ga0075367_10589759 | Ga0075367_105897592 | 150 |
| 104 | 3300006237 | Ga0097621_100053491 | Ga0097621_1000534915 | 150 |
| 105 | 3300006358 | Ga0068871_100063957 | Ga0068871_1000639575 | 150 |
| 106 | 3300006942 | Ga0099824_1029471 | Ga0099824_10294716 | 150 |
| 107 | 3300006943 | Ga0099822_1003710 | Ga0099822_100371028 | 150 |
| 108 | 3300009174 | Ga0105241_11459521 | Ga0105241_114595211 | 150 |
| 109 | 3300009176 | Ga0105242_11877231 | Ga0105242_118772312 | 150 |
| 110 | 3300009545 | Ga0105237_10063193 | Ga0105237_100631934 | 150 |
| 111 | 3300009545 | Ga0105237_10099477 | Ga0105237_100994771 | 150 |
| 112 | 3300011119 | Ga0105246_10004377 | Ga0105246_100043774 | 150 |
| 113 | 3300013102 | Ga0157371_11078257 | Ga0157371_110782571 | 150 |
| 114 | 3300013104 | Ga0157370_10093087 | Ga0157370_100930873 | 150 |
| 115 | 3300013105 | Ga0157369_10026947 | Ga0157369_100269474 | 150 |
| 116 | 3300013307 | Ga0157372_10047361 | Ga0157372_100473614 | 150 |
| 117 | 3300014325 | Ga0163163_10011648 | Ga0163163_100116487 | 150 |
| 118 | 3300014325 | Ga0163163_10022927 | Ga0163163_100229276 | 150 |
| 119 | 3300014968 | Ga0157379_10078048 | Ga0157379_100780484 | 150 |
| 120 | 3300017792 | Ga0163161_10258928 | Ga0163161_102589282 | 150 |
| 121 | 3300025261 | Ga0209233_1064778 | Ga0209233_10647781 | 150 |
| 122 | 3300025302 | Ga0207426_1013299 | Ga0207426_10132992 | 150 |
| 123 | 3300025315 | Ga0207697_10475593 | Ga0207697_104755931 | 150 |
| 124 | 3300025898 | Ga0207692_10008854 | Ga0207692_100088543 | 150 |
| 125 | 3300025904 | Ga0207647_10158310 | Ga0207647_101583102 | 150 |
| 126 | 3300025906 | Ga0207699_10126485 | Ga0207699_101264852 | 150 |
| 127 | 3300025913 | Ga0207695_10022857 | Ga0207695_100228578 | 150 |
| 128 | 3300025914 | Ga0207671_10043998 | Ga0207671_100439985 | 150 |
| 129 | 3300025914 | Ga0207671_10626257 | Ga0207671_106262571 | 150 |
| 130 | 3300025916 | Ga0207663_10024152 | Ga0207663_100241524 | 150 |
| 131 | 3300025922 | Ga0207646_10651313 | Ga0207646_106513132 | 150 |
| 132 | 3300025925 | Ga0207650_11328492 | Ga0207650_113284921 | 150 |
| 133 | 3300025928 | Ga0207700_10002857 | Ga0207700_100028574 | 150 |
| 134 | 3300025928 | Ga0207700_10467424 | Ga0207700_104674242 | 150 |
| 135 | 3300025929 | Ga0207664_10095673 | Ga0207664_100956732 | 150 |
| 136 | 3300025944 | Ga0207661_10036379 | Ga0207661_100363792 | 150 |
| 137 | 3300026095 | Ga0207676_10266966 | Ga0207676_102669662 | 150 |
| 138 | 3300026142 | Ga0207698_10209459 | Ga0207698_102094594 | 150 |
| 139 | 3300026142 | Ga0207698_11347909 | Ga0207698_113479091 | 150 |
| 140 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003229 | 150 |
| 141 | 3300027361 | Ga0209489_100003 | Ga0209489_100003280 | 150 |
| 142 | 3300027363 | Ga0209700_100003 | Ga0209700_100003280 | 150 |
| 143 | 3300028379 | Ga0268266_10418038 | Ga0268266_104180382 | 150 |
| 144 | 3300035695 | Ga0373927_0225554 | Ga0373927_0225554_142_594 | 150 |
| 145 | 3300037418 | Ga0395900_0195654 | Ga0395900_0195654_208_660 | 150 |
| 146 | 3300037418 | Ga0395900_0348021 | Ga0395900_0348021_639_1091 | 150 |
| 147 | 3300037466 | Ga0395898_0243518 | Ga0395898_0243518_232_684 | 150 |
| 148 | 3300037471 | Ga0395905_0258642 | Ga0395905_0258642_219_671 | 150 |
| 149 | 3300037471 | Ga0395905_0892684 | Ga0395905_0892684_24_476 | 150 |
| 150 | 3300037853 | Ga0436364_1559429 | Ga0436364_1559429_85_537 | 150 |
| 151 | 3300038443 | Ga0395901_0050301 | Ga0395901_0050301_3241_3693 | 150 |
| 152 | 3300038443 | Ga0395901_0111347 | Ga0395901_0111347_1936_2388 | 150 |
| 153 | 3300041451 | Ga0451791_1821125 | Ga0451791_1821125_430_882 | 150 |
| 154 | 3300041486 | Ga0451807_1817701 | Ga0451807_1817701_551_1003 | 150 |
| 155 | 3300041512 | Ga0451853_0343720 | Ga0451853_0343720_749_1201 | 150 |
| 156 | 3300044694 | Ga0466963_0104864 | Ga0466963_0104864_593_1045 | 150 |
| 157 | 3300044719 | Ga0466971_0207611 | Ga0466971_0207611_315_767 | 150 |
| 158 | 3300045976 | Ga0466967_0755404 | Ga0466967_0755404_21_473 | 150 |
| 159 | 3300046507 | Ga0495606_0296511 | Ga0495606_0296511_293_745 | 150 |
| 160 | 3300046518 | Ga0495631_0168810 | Ga0495631_0168810_367_819 | 150 |
| 161 | 3300046683 | Ga0495658_0353492 | Ga0495658_0353492_78_530 | 150 |
| 162 | 3300048905 | Ga0496102_0123720 | Ga0496102_0123720_1316_1768 | 150 |
| 163 | 3300048905 | Ga0496102_0344157 | Ga0496102_0344157_477_929 | 150 |
| 164 | 3300048908 | Ga0496105_0100551 | Ga0496105_0100551_12_464 | 150 |
| 165 | 3300048908 | Ga0496105_0839704 | Ga0496105_0839704_44_499 | 150 |
| 166 | 3300048909 | Ga0496106_0090164 | Ga0496106_0090164_299_751 | 150 |
| 167 | 3300048909 | Ga0496106_0885879 | Ga0496106_0885879_77_529 | 150 |
| 168 | 3300048910 | Ga0496107_0306100 | Ga0496107_0306100_32_484 | 150 |
| 169 | 3300048911 | Ga0496108_0443732 | Ga0496108_0443732_476_928 | 150 |
| 170 | 3300048911 | Ga0496108_0444089 | Ga0496108_0444089_633_1085 | 150 |
| 171 | 3300048912 | Ga0496109_0068495 | Ga0496109_0068495_674_1126 | 150 |
| 172 | 3300048914 | Ga0496111_0299462 | Ga0496111_0299462_211_663 | 150 |
| 173 | 3300048917 | Ga0496114_0737559 | Ga0496114_0737559_340_792 | 150 |
| 174 | 3300048918 | Ga0496115_0154545 | Ga0496115_0154545_1344_1796 | 150 |
| 175 | 3300048918 | Ga0496115_0348099 | Ga0496115_0348099_213_665 | 150 |
| 176 | 3300048918 | Ga0496115_0884619 | Ga0496115_0884619_77_529 | 150 |
| 177 | 3300049581 | Ga0501047_0577412 | Ga0501047_0577412_252_704 | 150 |
| 178 | 3300049586 | Ga0501070_0052420 | Ga0501070_0052420_986_1438 | 150 |
| 179 | 3300050492 | nmdc:mga0yw44_10605_c1 | nmdc:mga0yw44_10605_c1_4048_4500 | 150 |
| 180 | 3300050492 | nmdc:mga0yw44_143602_c1 | nmdc:mga0yw44_143602_c1_739_1191 | 150 |
| 181 | 3300048908 | Ga0496105_0829511 | Ga0496105_0829511_147_608 | 151 |
| 182 | 3300005457 | Ga0070662_100046446 | Ga0070662_1000464464 | 152 |
| 183 | 3300025918 | Ga0207662_10269363 | Ga0207662_102693633 | 152 |
| 184 | 3300047318 | Ga0495636_0579876 | Ga0495636_0579876_63_521 | 152 |
| 185 | 3300003215 | JGI25153J46596_10000525 | JGI25153J46596_1000052524 | 153 |
| 186 | 3300003215 | JGI25153J46596_10000709 | JGI25153J46596_1000070913 | 153 |
| 187 | 3300003316 | rootH1_10150693 | rootH1_101506932 | 153 |
| 188 | 3300003320 | rootH2_10119237 | rootH2_101192374 | 153 |
| 189 | 3300003322 | rootL2_10053366 | rootL2_100533662 | 153 |
| 190 | 3300003354 | JGI25160J50197_1000671 | JGI25160J50197_100067117 | 153 |
| 191 | 3300003771 | Ga0055526_1070432 | Ga0055526_10704321 | 153 |
| 192 | 3300003794 | Ga0055531_10008243 | Ga0055531_100082436 | 153 |
| 193 | 3300005262 | Ga0065165_1015087 | Ga0065165_10150872 | 153 |
| 194 | 3300005330 | Ga0070690_100710608 | Ga0070690_1007106081 | 153 |
| 195 | 3300005334 | Ga0068869_100068186 | Ga0068869_1000681864 | 153 |
| 196 | 3300005338 | Ga0068868_100925569 | Ga0068868_1009255691 | 153 |
| 197 | 3300005347 | Ga0070668_100157374 | Ga0070668_1001573743 | 153 |
| 198 | 3300005356 | Ga0070674_100080828 | Ga0070674_1000808283 | 153 |
| 199 | 3300005364 | Ga0070673_100524722 | Ga0070673_1005247222 | 153 |
| 200 | 3300005367 | Ga0070667_100438891 | Ga0070667_1004388911 | 153 |
| 201 | 3300005441 | Ga0070700_100158990 | Ga0070700_1001589903 | 153 |
| 202 | 3300005455 | Ga0070663_100036182 | Ga0070663_1000361823 | 153 |
| 203 | 3300005456 | Ga0070678_100309885 | Ga0070678_1003098853 | 153 |
| 204 | 3300005457 | Ga0070662_100436783 | Ga0070662_1004367833 | 153 |
| 205 | 3300005535 | Ga0070684_100400887 | Ga0070684_1004008872 | 153 |
| 206 | 3300005563 | Ga0068855_100267817 | Ga0068855_1002678172 | 153 |
| 207 | 3300005563 | Ga0068855_100655734 | Ga0068855_1006557343 | 153 |
| 208 | 3300005615 | Ga0070702_100642081 | Ga0070702_1006420811 | 153 |
| 209 | 3300005616 | Ga0068852_100338101 | Ga0068852_1003381012 | 153 |
| 210 | 3300005618 | Ga0068864_100238058 | Ga0068864_1002380583 | 153 |
| 211 | 3300005718 | Ga0068866_10891858 | Ga0068866_108918581 | 153 |
| 212 | 3300005719 | Ga0068861_100090626 | Ga0068861_1000906265 | 153 |
| 213 | 3300005719 | Ga0068861_100936991 | Ga0068861_1009369912 | 153 |
| 214 | 3300005841 | Ga0068863_100658687 | Ga0068863_1006586872 | 153 |
| 215 | 3300005843 | Ga0068860_101241597 | Ga0068860_1012415971 | 153 |
| 216 | 3300006038 | Ga0075365_10067119 | Ga0075365_100671193 | 153 |
| 217 | 3300006178 | Ga0075367_10118829 | Ga0075367_101188292 | 153 |
| 218 | 3300006178 | Ga0075367_10439418 | Ga0075367_104394182 | 153 |
| 219 | 3300006353 | Ga0075370_10073223 | Ga0075370_100732232 | 153 |
| 220 | 3300006358 | Ga0068871_100124039 | Ga0068871_1001240393 | 153 |
| 221 | 3300006881 | Ga0068865_101300237 | Ga0068865_1013002372 | 153 |
| 222 | 3300009011 | Ga0105251_10447251 | Ga0105251_104472511 | 153 |
| 223 | 3300009101 | Ga0105247_10102883 | Ga0105247_101028833 | 153 |
| 224 | 3300009101 | Ga0105247_10312791 | Ga0105247_103127912 | 153 |
| 225 | 3300009148 | Ga0105243_10665428 | Ga0105243_106654281 | 153 |
| 226 | 3300009176 | Ga0105242_10413784 | Ga0105242_104137842 | 153 |
| 227 | 3300009177 | Ga0105248_10680337 | Ga0105248_106803371 | 153 |
| 228 | 3300009545 | Ga0105237_10128176 | Ga0105237_101281763 | 153 |
| 229 | 3300009551 | Ga0105238_10773849 | Ga0105238_107738491 | 153 |
| 230 | 3300010375 | Ga0105239_10146839 | Ga0105239_101468393 | 153 |
| 231 | 3300010375 | Ga0105239_10177496 | Ga0105239_101774963 | 153 |
| 232 | 3300010375 | Ga0105239_11529892 | Ga0105239_115298921 | 153 |
| 233 | 3300011119 | Ga0105246_10056500 | Ga0105246_100565003 | 153 |
| 234 | 3300013306 | Ga0163162_10155737 | Ga0163162_101557373 | 153 |
| 235 | 3300013308 | Ga0157375_10435709 | Ga0157375_104357092 | 153 |
| 236 | 3300014325 | Ga0163163_10183089 | Ga0163163_101830893 | 153 |
| 237 | 3300014326 | Ga0157380_10198972 | Ga0157380_101989722 | 153 |
| 238 | 3300014497 | Ga0182008_10150749 | Ga0182008_101507491 | 153 |
| 239 | 3300014968 | Ga0157379_10562999 | Ga0157379_105629992 | 153 |
| 240 | 3300014969 | Ga0157376_10555969 | Ga0157376_105559691 | 153 |
| 241 | 3300017792 | Ga0163161_10176807 | Ga0163161_101768072 | 153 |
| 242 | 3300025295 | Ga0209564_1006350 | Ga0209564_10063507 | 153 |
| 243 | 3300025295 | Ga0209564_1027715 | Ga0209564_10277152 | 153 |
| 244 | 3300025297 | Ga0209758_1000117 | Ga0209758_1000117113 | 153 |
| 245 | 3300025297 | Ga0209758_1001957 | Ga0209758_10019574 | 153 |
| 246 | 3300025297 | Ga0209758_1005617 | Ga0209758_10056178 | 153 |
| 247 | 3300025299 | Ga0209256_1002709 | Ga0209256_100270914 | 153 |
| 248 | 3300025302 | Ga0207426_1000213 | Ga0207426_100021335 | 153 |
| 249 | 3300025302 | Ga0207426_1007812 | Ga0207426_10078128 | 153 |
| 250 | 3300025303 | Ga0209051_1075834 | Ga0209051_10758342 | 153 |
| 251 | 3300025304 | Ga0209257_1001342 | Ga0209257_10013427 | 153 |
| 252 | 3300025304 | Ga0209257_1065304 | Ga0209257_10653042 | 153 |
| 253 | 3300025899 | Ga0207642_10733121 | Ga0207642_107331211 | 153 |
| 254 | 3300025903 | Ga0207680_10131665 | Ga0207680_101316653 | 153 |
| 255 | 3300025904 | Ga0207647_10171374 | Ga0207647_101713743 | 153 |
| 256 | 3300025933 | Ga0207706_10464853 | Ga0207706_104648531 | 153 |
| 257 | 3300025945 | Ga0207679_10186710 | Ga0207679_101867101 | 153 |
| 258 | 3300025961 | Ga0207712_10028198 | Ga0207712_100281983 | 153 |
| 259 | 3300025972 | Ga0207668_10064334 | Ga0207668_100643341 | 153 |
| 260 | 3300026023 | Ga0207677_10377250 | Ga0207677_103772502 | 153 |
| 261 | 3300026035 | Ga0207703_10043625 | Ga0207703_100436255 | 153 |
| 262 | 3300026067 | Ga0207678_10016379 | Ga0207678_100163793 | 153 |
| 263 | 3300026095 | Ga0207676_10118105 | Ga0207676_101181053 | 153 |
| 264 | 3300026118 | Ga0207675_100252114 | Ga0207675_1002521142 | 153 |
| 265 | 3300026121 | Ga0207683_10442149 | Ga0207683_104421493 | 153 |
| 266 | 3300028381 | Ga0268264_10170719 | Ga0268264_101707194 | 153 |
| 267 | 3300028381 | Ga0268264_10797834 | Ga0268264_107978342 | 153 |
| 268 | 3300035695 | Ga0373927_0295244 | Ga0373927_0295244_214_675 | 153 |
| 269 | 3300046452 | Ga0495617_059859 | Ga0495617_059859_71_532 | 153 |
| 270 | 3300046459 | Ga0495629_0007804 | Ga0495629_0007804_3692_4153 | 153 |
| 271 | 3300046474 | Ga0495605_0029094 | Ga0495605_0029094_1856_2317 | 153 |
| 272 | 3300046491 | Ga0495584_0174127 | Ga0495584_0174127_56_517 | 153 |
| 273 | 3300046492 | Ga0495585_0158207 | Ga0495585_0158207_359_820 | 153 |
| 274 | 3300046500 | Ga0495596_0020716 | Ga0495596_0020716_1122_1583 | 153 |
| 275 | 3300046522 | Ga0495643_0152606 | Ga0495643_0152606_602_1063 | 153 |
| 276 | 3300046529 | Ga0495652_0205263 | Ga0495652_0205263_563_1024 | 153 |
| 277 | 3300046557 | Ga0495622_0009257 | Ga0495622_0009257_1137_1598 | 153 |
| 278 | 3300046665 | Ga0495661_0244329 | Ga0495661_0244329_293_754 | 153 |
| 279 | 3300046675 | Ga0495657_0051707 | Ga0495657_0051707_1081_1542 | 153 |
| 280 | 3300046794 | Ga0495589_0369541 | Ga0495589_0369541_157_618 | 153 |
| 281 | 3300047321 | Ga0495676_0133456 | Ga0495676_0133456_437_898 | 153 |
| 282 | 3300047469 | Ga0495673_0082212 | Ga0495673_0082212_530_991 | 153 |
| 283 | 3300047469 | Ga0495673_0086187 | Ga0495673_0086187_52_513 | 153 |
| 284 | 3300047471 | Ga0495684_0275163 | Ga0495684_0275163_627_1088 | 153 |
| 285 | 3300047472 | Ga0495686_0136128 | Ga0495686_0136128_868_1329 | 153 |
| 286 | 3300047472 | Ga0495686_0576922 | Ga0495686_0576922_53_514 | 153 |
| 287 | 3300047673 | Ga0495593_0185577 | Ga0495593_0185577_112_573 | 153 |
| 288 | 3300048089 | Ga0495614_0167520 | Ga0495614_0167520_255_716 | 153 |
| 289 | 3300048903 | Ga0496100_0069238 | Ga0496100_0069238_570_1031 | 153 |
| 290 | 3300048904 | Ga0496101_0146490 | Ga0496101_0146490_650_1111 | 153 |
| 291 | 3300048904 | Ga0496101_0438338 | Ga0496101_0438338_87_548 | 153 |
| 292 | 3300048905 | Ga0496102_0069974 | Ga0496102_0069974_712_1173 | 153 |
| 293 | 3300048905 | Ga0496102_0305867 | Ga0496102_0305867_540_1001 | 153 |
| 294 | 3300048906 | Ga0496103_0081921 | Ga0496103_0081921_870_1331 | 153 |
| 295 | 3300048906 | Ga0496103_0127093 | Ga0496103_0127093_158_619 | 153 |
| 296 | 3300048907 | Ga0496104_0021222 | Ga0496104_0021222_2182_2643 | 153 |
| 297 | 3300048907 | Ga0496104_0040287 | Ga0496104_0040287_2939_3400 | 153 |
| 298 | 3300048907 | Ga0496104_0172091 | Ga0496104_0172091_500_961 | 153 |
| 299 | 3300048908 | Ga0496105_0026563 | Ga0496105_0026563_3279_3740 | 153 |
| 300 | 3300048908 | Ga0496105_0036549 | Ga0496105_0036549_2543_3004 | 153 |
| 301 | 3300048909 | Ga0496106_0084762 | Ga0496106_0084762_678_1139 | 153 |
| 302 | 3300048909 | Ga0496106_0229640 | Ga0496106_0229640_278_739 | 153 |
| 303 | 3300048910 | Ga0496107_0103643 | Ga0496107_0103643_434_895 | 153 |
| 304 | 3300048910 | Ga0496107_0263379 | Ga0496107_0263379_651_1112 | 153 |
| 305 | 3300048911 | Ga0496108_0012497 | Ga0496108_0012497_5347_5808 | 153 |
| 306 | 3300048911 | Ga0496108_0143491 | Ga0496108_0143491_1199_1660 | 153 |
| 307 | 3300048912 | Ga0496109_0014187 | Ga0496109_0014187_5546_6007 | 153 |
| 308 | 3300048912 | Ga0496109_0262672 | Ga0496109_0262672_652_1113 | 153 |
| 309 | 3300048913 | Ga0496110_0319776 | Ga0496110_0319776_257_718 | 153 |
| 310 | 3300048914 | Ga0496111_0087836 | Ga0496111_0087836_1327_1788 | 153 |
| 311 | 3300048914 | Ga0496111_0138765 | Ga0496111_0138765_636_1097 | 153 |
| 312 | 3300048915 | Ga0496112_0021296 | Ga0496112_0021296_696_1157 | 153 |
| 313 | 3300048915 | Ga0496112_0109379 | Ga0496112_0109379_1764_2225 | 153 |
| 314 | 3300048916 | Ga0496113_0165180 | Ga0496113_0165180_368_829 | 153 |
| 315 | 3300048917 | Ga0496114_0118526 | Ga0496114_0118526_1276_1737 | 153 |
| 316 | 3300048917 | Ga0496114_0209226 | Ga0496114_0209226_863_1324 | 153 |
| 317 | 3300048918 | Ga0496115_0034820 | Ga0496115_0034820_2255_2716 | 153 |
| 318 | 3300048918 | Ga0496115_0118228 | Ga0496115_0118228_692_1153 | 153 |
| 319 | 3300048919 | Ga0496116_0026015 | Ga0496116_0026015_809_1270 | 153 |
| 320 | 3300048920 | Ga0496117_0139886 | Ga0496117_0139886_308_769 | 153 |
| 321 | 3300048922 | Ga0496119_0021318 | Ga0496119_0021318_3079_3540 | 153 |
| 322 | 3300048922 | Ga0496119_0148203 | Ga0496119_0148203_327_788 | 153 |
| 323 | 3300048923 | Ga0496120_0038254 | Ga0496120_0038254_841_1302 | 153 |
| 324 | 3300048924 | Ga0496121_0006909 | Ga0496121_0006909_9635_10096 | 153 |
| 325 | 3300048924 | Ga0496121_0435212 | Ga0496121_0435212_139_600 | 153 |
| 326 | 3300048928 | Ga0496125_0018653 | Ga0496125_0018653_5231_5695 | 153 |
| 327 | 3300048928 | Ga0496125_0068102 | Ga0496125_0068102_1236_1697 | 153 |
| 328 | 3300048929 | Ga0496126_0038471 | Ga0496126_0038471_532_993 | 153 |
| 329 | 3300049460 | Ga0495682_0106562 | Ga0495682_0106562_406_867 | 153 |
| 330 | 3300050489 | nmdc:mga03683_248840_c1 | nmdc:mga03683_248840_c1_157_618 | 153 |
| 331 | 3300050492 | nmdc:mga0yw44_89951_c1 | nmdc:mga0yw44_89951_c1_243_707 | 153 |
| 332 | 3300050516 | nmdc:mga0sz30_34825_c1 | nmdc:mga0sz30_34825_c1_35_499 | 153 |
| 333 | 3300053109 | Ga0500569_001126 | Ga0500569_001126_2111_2578 | 153 |
| 334 | 3300053133 | Ga0500655_124895 | Ga0500655_124895_23_490 | 153 |
| 335 | 3300053153 | Ga0500616_0124056 | Ga0500616_0124056_396_857 | 153 |
| 336 | 3300053177 | Ga0500636_0300464 | Ga0500636_0300464_16_477 | 153 |
| 337 | 3300053722 | Ga0500649_100182 | Ga0500649_100182_168_629 | 153 |
| 338 | 3300053731 | Ga0500609_003170 | Ga0500609_003170_1318_1785 | 153 |
| 339 | 3300025900 | Ga0207710_10035924 | Ga0207710_100359244 | 156 |
| 340 | 3300005983 | Ga0081540_1174300 | Ga0081540_11743001 | 159 |
| 341 | 3300009093 | Ga0105240_10030110 | Ga0105240_100301104 | 159 |
| 342 | 3300050489 | nmdc:mga03683_512078_c1 | nmdc:mga03683_512078_c1_32_526 | 159 |
| 343 | 3300050493 | nmdc:mga0k408_197587_c1 | nmdc:mga0k408_197587_c1_118_612 | 159 |
| 344 | 3300002244 | JGI24742J22300_10040927 | JGI24742J22300_100409272 | 162 |
| 345 | 3300005548 | Ga0070665_101151968 | Ga0070665_1011519682 | 162 |
| 346 | 3300005841 | Ga0068863_100761486 | Ga0068863_1007614861 | 162 |
| 347 | 3300006358 | Ga0068871_100708501 | Ga0068871_1007085012 | 162 |
| 348 | 3300025901 | Ga0207688_10272021 | Ga0207688_102720211 | 162 |
| 349 | 3300025945 | Ga0207679_10562390 | Ga0207679_105623902 | 162 |
| 350 | 3300026095 | Ga0207676_10537931 | Ga0207676_105379312 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wny-assembly1.cif.gz_A-2 | crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei | 0.907 | 10 | 159 |
| 3ab7-assembly2.cif.gz_A | crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 | 0.8928 | 12 | 161 |
| 4wny-assembly1.cif.gz_A-2 | crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei | 0.8747 | 10 | 159 |
| 5ahw-assembly2.cif.gz_D | crystal structure of universal stress protein msmeg_3811 in complex with camp | 0.8534 | 11 | 161 |
| 5ahw-assembly3.cif.gz_E | crystal structure of universal stress protein msmeg_3811 in complex with camp | 0.8469 | 11 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wnyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.907 | 10 | 159 | 3.40.50.620 |
| af_Q57951_25_170_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8864 | 10 | 162 | 3.40.50.620 |
| 4wnyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8747 | 10 | 159 | 3.40.50.620 |
| af_Q57951_25_170_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8694 | 10 | 162 | 3.40.50.620 |
| af_Q8GZ84_25_155_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.832 | 12 | 127 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A503WAM9-F1-model_v4 | Universal stress protein | 0.9061 | 10 | 158 |
|
| AF-A0A0R3LSF3-F1-model_v4 | Universal stress protein | 0.8954 | 10 | 157 |
GO:0005737
|
| AF-A0A503WAM9-F1-model_v4 | Universal stress protein | 0.8947 | 10 | 158 |
|
| AF-A0A1I3PA70-F1-model_v4 | Nucleotide-binding universal stress protein, UspA family | 0.8932 | 35 | 158 |
|
| AF-A0A3P3G160-F1-model_v4 | Universal stress protein | 0.8903 | 10 | 133 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar