F418259

General Info

Members Datasets Scaffolds Average Seq Length
350 253 286 151

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10035924|Ga0207710_100359244
Length 174
Sequence MQNRNIRRMIGLPILDKMFDEQGSLRMYANILVSTDGSDVAKKGVQHGIALAKALNAKVTVITVTEPVPVFFYGFGHSSGWIPAQEDFDAVCEEFAGKVLDGARVTADQIGLSAELLHVQNAHPATAIIETAKSRGCDLIVMATHGRRGLRKLFMGSQTSEVLVNGSVPVLVVP

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
3 2791355199
4 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
5 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
6 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
7 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
8 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
9 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
10 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
11 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
12 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
13 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
14 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
15 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
16 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
17 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
18 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
19 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
20 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
21 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
22 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
23 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
24 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
25 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
26 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
27 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
28 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
29 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
30 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
31 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
32 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
33 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
34 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
35 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
36 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
37 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
38 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
39 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
40 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
41 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
42 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
43 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
44 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
45 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
46 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
47 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
48 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
49 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
50 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
51 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
52 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
53 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
54 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
108 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
168 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
169 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
242 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
246 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
247 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
248 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
249 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
250 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
251 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
252 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
253 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.95
Metatranscriptomes 0
Isolates 18.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.14
Nodule 15.71
Rhizoplane 13.71
Rhizosphere 50.86
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10040927 3300002244 Bacteria 826
2 JGI25406J46586_10076416 3300003203 Bacteria 1037
3 JGI25153J46596_10000525 3300003215 Bacteria 24072
4 JGI25153J46596_10000709 3300003215 Bacteria 20357
5 rootH1_10150693 3300003316 Bacteria 1167
6 rootH2_10119237 3300003320 Bacteria 2779
7 rootL2_10053366 3300003322 Bacteria 2467
8 JGI25160J50197_1000671 3300003354 Bacteria 19035
9 Ga0055526_1070432 3300003771 Bacteria 711
10 Ga0055531_10008243 3300003794 Bacteria 5541
11 Ga0065165_1015087 3300005262 Bacteria 2963
12 Ga0070683_100996311 3300005329 Bacteria 804
13 Ga0070690_100710608 3300005330 Bacteria 773
14 Ga0068869_100068186 3300005334 Bacteria 2627
15 Ga0068868_100925569 3300005338 Bacteria 794
16 Ga0070668_100157374 3300005347 Bacteria 1841
17 Ga0070674_100080828 3300005356 Bacteria 2321
18 Ga0070673_100524722 3300005364 Bacteria 1074
19 Ga0070667_100438891 3300005367 Bacteria 1192
20 Ga0070709_10035355 3300005434 Bacteria 3036
21 Ga0070713_100004209 3300005436 Bacteria 9607
22 Ga0070713_100531723 3300005436 Bacteria 1112
23 Ga0070710_10005820 3300005437 Bacteria 5880
24 Ga0070711_100003431 3300005439 Bacteria 9233
25 Ga0070705_100142035 3300005440 Bacteria 1581
26 Ga0070700_100158990 3300005441 Bacteria 1553
27 Ga0070663_100036182 3300005455 Bacteria 3429
28 Ga0070678_100309885 3300005456 Bacteria 1344
29 Ga0070662_100046446 3300005457 Bacteria 3120
30 Ga0070662_100436783 3300005457 Bacteria 1085
31 Ga0070681_10818090 3300005458 Bacteria 849
32 Ga0070685_10185725 3300005466 Bacteria 1341
33 Ga0070679_100371960 3300005530 Bacteria 1376
34 Ga0070684_100013030 3300005535 Bacteria 6690
35 Ga0070684_100186065 3300005535 Bacteria 1889
36 Ga0070684_100400887 3300005535 Bacteria 1265
37 Ga0068853_100958217 3300005539 Bacteria 823
38 Ga0070665_100069717 3300005548 Bacteria 3524
39 Ga0070665_101151968 3300005548 Bacteria 786
40 Ga0068855_100267817 3300005563 Bacteria 1901
41 Ga0068855_100655734 3300005563 Bacteria 1127
42 Ga0068856_100272323 3300005614 Bacteria 1709
43 Ga0068856_100568412 3300005614 Bacteria 1155
44 Ga0070702_100642081 3300005615 Bacteria 802
45 Ga0068852_100141978 3300005616 Bacteria 2224
46 Ga0068852_100245230 3300005616 Bacteria 1714
47 Ga0068852_100338101 3300005616 Bacteria 1467
48 Ga0068864_100238058 3300005618 Bacteria 1686
49 Ga0068866_10891858 3300005718 Bacteria 625
50 Ga0068861_100090626 3300005719 Bacteria 2412
51 Ga0068861_100936991 3300005719 Bacteria 823
52 Ga0068863_100658687 3300005841 Bacteria 1039
53 Ga0068863_100761486 3300005841 Bacteria 964
54 Ga0068858_102217483 3300005842 Bacteria 543
55 Ga0068860_101241597 3300005843 Bacteria 766
56 Ga0081455_10002785 3300005937 Bacteria 20594
57 Ga0081455_10007307 3300005937 Bacteria 11653
58 Ga0081455_10023987 3300005937 Bacteria 5661
59 Ga0081455_10310090 3300005937 Bacteria 1128
60 Ga0081540_1060376 3300005983 Bacteria 1814
61 Ga0081540_1174300 3300005983 Bacteria 814
62 Ga0081539_10001607 3300005985 Bacteria 37194
63 Ga0070717_10066097 3300006028 Bacteria 3007
64 Ga0070717_10884662 3300006028 Bacteria 813
65 Ga0075365_10005221 3300006038 Bacteria 6984
66 Ga0075365_10067119 3300006038 Bacteria 2408
67 Ga0075365_10235085 3300006038 Bacteria 1287
68 Ga0070715_10213066 3300006163 Bacteria 988
69 Ga0075367_10118829 3300006178 Bacteria 1628
70 Ga0075367_10439418 3300006178 Bacteria 826
71 Ga0075367_10589759 3300006178 Bacteria 706
72 Ga0097621_100053491 3300006237 Bacteria 3291
73 Ga0075370_10073223 3300006353 Bacteria 1961
74 Ga0068871_100063957 3300006358 Bacteria 3010
75 Ga0068871_100124039 3300006358 Bacteria 2184
76 Ga0068871_100708501 3300006358 Bacteria 923
77 Ga0068865_101300237 3300006881 Bacteria 647
78 Ga0099824_1029471 3300006942 Bacteria 2335
79 Ga0099822_1003710 3300006943 Bacteria 19679
80 Ga0105251_10447251 3300009011 Bacteria 599
81 Ga0105240_10030110 3300009093 Bacteria 7059
82 Ga0105247_10102883 3300009101 Bacteria 1828
83 Ga0105247_10312791 3300009101 Bacteria 1093
84 Ga0105243_10665428 3300009148 Bacteria 1011
85 Ga0105241_11459521 3300009174 Bacteria 657
86 Ga0105242_10413784 3300009176 Bacteria 1261
87 Ga0105242_11877231 3300009176 Bacteria 639
88 Ga0105248_10680337 3300009177 Bacteria 1161
89 Ga0105237_10063193 3300009545 Bacteria 3700
90 Ga0105237_10099477 3300009545 Bacteria 2900
91 Ga0105237_10128176 3300009545 Bacteria 2532
92 Ga0105238_10773849 3300009551 Bacteria 974
93 Ga0105239_10146839 3300010375 Bacteria 2631
94 Ga0105239_10177496 3300010375 Bacteria 2383
95 Ga0105239_11529892 3300010375 Bacteria 771
96 Ga0105246_10004377 3300011119 Bacteria 8594
97 Ga0105246_10056500 3300011119 Bacteria 2713
98 Ga0157371_11078257 3300013102 Bacteria 615
99 Ga0157370_10093087 3300013104 Bacteria 2828
100 Ga0157369_10026947 3300013105 Bacteria 6374
101 Ga0163162_10155737 3300013306 Bacteria 2405
102 Ga0157372_10047361 3300013307 Bacteria 4777
103 Ga0157375_10435709 3300013308 Bacteria 1477
104 Ga0163163_10011648 3300014325 Bacteria 7988
105 Ga0163163_10022927 3300014325 Bacteria 5919
106 Ga0163163_10183089 3300014325 Bacteria 2142
107 Ga0157380_10198972 3300014326 Bacteria 1776
108 Ga0182008_10150749 3300014497 Bacteria 1166
109 Ga0157379_10078048 3300014968 Bacteria 2966
110 Ga0157379_10562999 3300014968 Bacteria 1061
111 Ga0157376_10555969 3300014969 Bacteria 1136
112 Ga0157376_11454269 3300014969 Bacteria 718
113 Ga0163161_10176807 3300017792 Bacteria 1634
114 Ga0163161_10258928 3300017792 Bacteria 1358
115 Ga0209233_1064778 3300025261 Bacteria 694
116 Ga0209564_1006350 3300025295 Bacteria 6413
117 Ga0209564_1027715 3300025295 Bacteria 1832
118 Ga0209758_1000117 3300025297 Bacteria 198325
119 Ga0209758_1001957 3300025297 Bacteria 22263
120 Ga0209758_1005617 3300025297 Bacteria 9525
121 Ga0209256_1002709 3300025299 Bacteria 13817
122 Ga0207426_1000213 3300025302 Bacteria 137311
123 Ga0207426_1007812 3300025302 Bacteria 4423
124 Ga0207426_1013299 3300025302 Bacteria 3054
125 Ga0209051_1075834 3300025303 Bacteria 991
126 Ga0209257_1001342 3300025304 Bacteria 29838
127 Ga0209257_1065304 3300025304 Bacteria 976
128 Ga0207697_10475593 3300025315 Bacteria 553
129 Ga0207692_10008854 3300025898 Bacteria 4183
130 Ga0207642_10733121 3300025899 Bacteria 625
131 Ga0207710_10035924 3300025900 Bacteria 2182
132 Ga0207688_10272021 3300025901 Bacteria 1031
133 Ga0207680_10131665 3300025903 Bacteria 1649
134 Ga0207647_10158310 3300025904 Bacteria 1322
135 Ga0207647_10171374 3300025904 Bacteria 1263
136 Ga0207699_10126485 3300025906 Bacteria 1660
137 Ga0207695_10022857 3300025913 Bacteria 7083
138 Ga0207671_10043998 3300025914 Bacteria 3301
139 Ga0207671_10626257 3300025914 Bacteria 857
140 Ga0207663_10024152 3300025916 Bacteria 3498
141 Ga0207662_10269363 3300025918 Bacteria 1123
142 Ga0207646_10651313 3300025922 Bacteria 944
143 Ga0207650_11328492 3300025925 Bacteria 612
144 Ga0207700_10002857 3300025928 Bacteria 9942
145 Ga0207700_10467424 3300025928 Bacteria 1113
146 Ga0207664_10095673 3300025929 Bacteria 2444
147 Ga0207706_10464853 3300025933 Bacteria 1094
148 Ga0207661_10036379 3300025944 Bacteria 3842
149 Ga0207679_10186710 3300025945 Bacteria 1720
150 Ga0207679_10562390 3300025945 Bacteria 1024
151 Ga0207712_10028198 3300025961 Bacteria 3753
152 Ga0207668_10064334 3300025972 Bacteria 2591
153 Ga0207677_10377250 3300026023 Bacteria 1196
154 Ga0207703_10043625 3300026035 Bacteria 3600
155 Ga0207678_10016379 3300026067 Bacteria 6508
156 Ga0207676_10118105 3300026095 Bacteria 2232
157 Ga0207676_10266966 3300026095 Bacteria 1548
158 Ga0207676_10537931 3300026095 Bacteria 1114
159 Ga0207675_100252114 3300026118 Bacteria 1708
160 Ga0207683_10442149 3300026121 Bacteria 1198
161 Ga0207698_10209459 3300026142 Bacteria 1753
162 Ga0207698_11347909 3300026142 Bacteria 728
163 Ga0209589_1000003 3300027357 Bacteria 629130
164 Ga0209489_100003 3300027361 Bacteria 663105
165 Ga0209700_100003 3300027363 Bacteria 663105
166 Ga0268266_10418038 3300028379 Bacteria 1270
167 Ga0268264_10170719 3300028381 Bacteria 1967
168 Ga0268264_10797834 3300028381 Bacteria 943
169 Ga0373955_0679487 3300035172 Bacteria 632
170 Ga0373927_0225554 3300035695 Bacteria 1231
171 Ga0373927_0295244 3300035695 Bacteria 1066
172 Ga0395900_0195654 3300037418 Bacteria 2049
173 Ga0395900_0348021 3300037418 Bacteria 1456
174 Ga0395898_0243518 3300037466 Bacteria 1715
175 Ga0395905_0258642 3300037471 Bacteria 1625
176 Ga0395905_0892684 3300037471 Bacteria 792
177 Ga0436364_1559429 3300037853 Bacteria 849
178 Ga0395901_0050301 3300038443 Bacteria 4331
179 Ga0395901_0111347 3300038443 Bacteria 2875
180 Ga0451791_1821125 3300041451 Bacteria 1293
181 Ga0451807_1817701 3300041486 Bacteria 1227
182 Ga0451853_0343720 3300041512 Bacteria 1405
183 Ga0466963_0104864 3300044694 Bacteria 1937
184 Ga0466971_0207611 3300044719 Bacteria 926
185 Ga0466967_0755404 3300045976 Bacteria 964
186 Ga0495617_059859 3300046452 Bacteria 1261
187 Ga0495629_0007804 3300046459 Bacteria 7876
188 Ga0495605_0029094 3300046474 Bacteria 2847
189 Ga0495584_0174127 3300046491 Bacteria 1094
190 Ga0495585_0158207 3300046492 Bacteria 1177
191 Ga0495596_0020716 3300046500 Bacteria 2690
192 Ga0495606_0296511 3300046507 Bacteria 878
193 Ga0495631_0168810 3300046518 Bacteria 938
194 Ga0495643_0152606 3300046522 Bacteria 1143
195 Ga0495652_0205263 3300046529 Bacteria 1492
196 Ga0495640_0806276 3300046533 Bacteria 559
197 Ga0495622_0009257 3300046557 Bacteria 4559
198 Ga0495661_0244329 3300046665 Bacteria 919
199 Ga0495657_0051707 3300046675 Bacteria 2758
200 Ga0495658_0353492 3300046683 Bacteria 934
201 Ga0495589_0369541 3300046794 Bacteria 660
202 Ga0495636_0579876 3300047318 Bacteria 547
203 Ga0495676_0133456 3300047321 Bacteria 1789
204 Ga0495673_0082212 3300047469 Bacteria 1332
205 Ga0495673_0086187 3300047469 Bacteria 1291
206 Ga0495684_0275163 3300047471 Bacteria 1217
207 Ga0495686_0136128 3300047472 Bacteria 1453
208 Ga0495686_0576922 3300047472 Bacteria 585
209 Ga0495593_0185577 3300047673 Bacteria 1047
210 Ga0495614_0167520 3300048089 Bacteria 985
211 Ga0496100_0069238 3300048903 Bacteria 2349
212 Ga0496101_0146490 3300048904 Bacteria 1803
213 Ga0496101_0438338 3300048904 Bacteria 1030
214 Ga0496102_0069974 3300048905 Bacteria 3221
215 Ga0496102_0123720 3300048905 Bacteria 2417
216 Ga0496102_0305867 3300048905 Bacteria 1498
217 Ga0496102_0344157 3300048905 Bacteria 1404
218 Ga0496103_0081921 3300048906 Bacteria 2030
219 Ga0496103_0127093 3300048906 Bacteria 1626
220 Ga0496104_0021222 3300048907 Bacteria 5959
221 Ga0496104_0040287 3300048907 Bacteria 4378
222 Ga0496104_0172091 3300048907 Bacteria 2076
223 Ga0496105_0026563 3300048908 Bacteria 4725
224 Ga0496105_0036549 3300048908 Bacteria 4046
225 Ga0496105_0100551 3300048908 Bacteria 2388
226 Ga0496105_0829511 3300048908 Bacteria 701
227 Ga0496105_0839704 3300048908 Bacteria 696
228 Ga0496106_0084762 3300048909 Bacteria 2438
229 Ga0496106_0090164 3300048909 Bacteria 2366
230 Ga0496106_0229640 3300048909 Bacteria 1481
231 Ga0496106_0885879 3300048909 Bacteria 705
232 Ga0496107_0103643 3300048910 Bacteria 2087
233 Ga0496107_0263379 3300048910 Bacteria 1283
234 Ga0496107_0306100 3300048910 Bacteria 1183
235 Ga0496108_0012497 3300048911 Bacteria 6913
236 Ga0496108_0143491 3300048911 Bacteria 2057
237 Ga0496108_0443732 3300048911 Bacteria 1134
238 Ga0496108_0444089 3300048911 Bacteria 1133
239 Ga0496109_0014187 3300048912 Bacteria 6929
240 Ga0496109_0068495 3300048912 Bacteria 3253
241 Ga0496109_0262672 3300048912 Bacteria 1626
242 Ga0496110_0319776 3300048913 Bacteria 1413
243 Ga0496111_0087836 3300048914 Bacteria 2276
244 Ga0496111_0138765 3300048914 Bacteria 1801
245 Ga0496111_0299462 3300048914 Bacteria 1192
246 Ga0496112_0021296 3300048915 Bacteria 6163
247 Ga0496112_0109379 3300048915 Bacteria 2734
248 Ga0496113_0165180 3300048916 Bacteria 1751
249 Ga0496114_0118526 3300048917 Bacteria 2274
250 Ga0496114_0209226 3300048917 Bacteria 1710
251 Ga0496114_0737559 3300048917 Bacteria 862
252 Ga0496115_0034820 3300048918 Bacteria 3980
253 Ga0496115_0118228 3300048918 Bacteria 2180
254 Ga0496115_0154545 3300048918 Bacteria 1895
255 Ga0496115_0348099 3300048918 Bacteria 1209
256 Ga0496115_0884619 3300048918 Bacteria 690
257 Ga0496116_0026015 3300048919 Bacteria 4289
258 Ga0496117_0139886 3300048920 Bacteria 1452
259 Ga0496119_0021318 3300048922 Bacteria 4687
260 Ga0496119_0148203 3300048922 Bacteria 1260
261 Ga0496120_0038254 3300048923 Bacteria 2840
262 Ga0496121_0006909 3300048924 Bacteria 13842
263 Ga0496121_0435212 3300048924 Bacteria 849
264 Ga0496125_0018653 3300048928 Bacteria 6583
265 Ga0496125_0068102 3300048928 Bacteria 2802
266 Ga0496126_0038471 3300048929 Bacteria 4451
267 Ga0496126_0109693 3300048929 Bacteria 2405
268 Ga0495682_0106562 3300049460 Bacteria 1005
269 Ga0501046_0156631 3300049580 Bacteria 1715
270 Ga0501047_0577412 3300049581 Bacteria 947
271 Ga0501070_0052420 3300049586 Bacteria 3386
272 Ga0501079_0900266 3300049741 Bacteria 697
273 Ga0501044_1355162 3300049823 Bacteria 577
274 nmdc:mga03683_248840_c1 3300050489 Bacteria 825
275 nmdc:mga03683_512078_c1 3300050489 Bacteria 582
276 nmdc:mga0yw44_10605_c1 3300050492 Bacteria 4716
277 nmdc:mga0yw44_143602_c1 3300050492 Bacteria 1552
278 nmdc:mga0yw44_89951_c1 3300050492 Bacteria 1938
279 nmdc:mga0k408_197587_c1 3300050493 Bacteria 1200
280 nmdc:mga0sz30_34825_c1 3300050516 Bacteria 2099
281 Ga0500569_001126 3300053109 Bacteria 4915
282 Ga0500655_124895 3300053133 Bacteria 547
283 Ga0500616_0124056 3300053153 Bacteria 1229
284 Ga0500636_0300464 3300053177 Bacteria 791
285 Ga0500649_100182 3300053722 Bacteria 1145
286 Ga0500609_003170 3300053731 Bacteria 2327

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0156631 Ga0501046_0156631_46_432 128
2 3300049741 Ga0501079_0900266 Ga0501079_0900266_271_657 128
3 3300049823 Ga0501044_1355162 Ga0501044_1355162_62_448 128
4 3300048929 Ga0496126_0109693 Ga0496126_0109693_37_489 132
5 iso_pu_bacteria 2791355199 2793078849 145
6 3300035172 Ga0373955_0679487 Ga0373955_0679487_121_564 146
7 iso_pu_bacteria 2513237141 2513891546 146
8 iso_pu_bacteria 2528768022 2528849230 146
9 iso_pu_bacteria 2824600985 2824607677 146
10 iso_pu_bacteria 2824609381 2824616831 146
11 iso_pu_bacteria 2824653114 2824658918 146
12 iso_pu_bacteria 2857509624 2857512618 146
13 iso_pu_bacteria 2881364244 2881366084 146
14 iso_pu_bacteria 2885374607 2885375219 146
15 iso_pu_bacteria 2885383462 2885392991 146
16 iso_pu_bacteria 2885409591 2885410588 146
17 iso_pu_bacteria 2888419890 2888421484 146
18 iso_pu_bacteria 2929615660 2929619331 146
19 iso_pu_bacteria 2929624759 2929628199 146
20 iso_pu_bacteria 2932794094 2932800776 146
21 iso_pu_bacteria 2932801729 2932803394 146
22 iso_pu_bacteria 2933577622 2933581252 146
23 iso_pu_bacteria 2935883170 2935886466 146
24 iso_pu_bacteria 2935883170 2935888608 146
25 iso_pu_bacteria 2935959822 2935964511 146
26 iso_pu_bacteria 8055742211 8055749411 146
27 3300005842 Ga0068858_102217483 Ga0068858_1022174831 147
28 3300014969 Ga0157376_11454269 Ga0157376_114542691 147
29 3300046533 Ga0495640_0806276 Ga0495640_0806276_11_454 147
30 3300005937 Ga0081455_10002785 Ga0081455_1000278513 149
31 iso_pu_bacteria 2528768022 2528855874 149
32 iso_pu_bacteria 2824661429 2824665900 149
33 iso_pu_bacteria 2879099564 2879106281 149
34 iso_pu_bacteria 2929624759 2929631751 149
35 iso_pu_bacteria 2932784394 2932790258 149
36 iso_pu_bacteria 2932809354 2932815837 149
37 iso_pu_bacteria 2932818245 2932824725 149
38 iso_pu_bacteria 2932828146 2932833284 149
39 iso_pu_bacteria 2933577622 2933583540 149
40 iso_pu_bacteria 2935616580 2935621442 149
41 iso_pu_bacteria 2935638405 2935644791 149
42 iso_pu_bacteria 2935665750 2935672395 149
43 iso_pu_bacteria 2935675223 2935682837 149
44 iso_pu_bacteria 2935684952 2935693258 149
45 iso_pu_bacteria 2935694250 2935702145 149
46 iso_pu_bacteria 2935703347 2935710934 149
47 iso_pu_bacteria 2935713505 2935720953 149
48 iso_pu_bacteria 2935722832 2935730560 149
49 iso_pu_bacteria 2935732158 2935740675 149
50 iso_pu_bacteria 2935741537 2935749851 149
51 iso_pu_bacteria 2935750917 2935759329 149
52 iso_pu_bacteria 2935760218 2935767222 149
53 iso_pu_bacteria 2935801545 2935808884 149
54 iso_pu_bacteria 2935810662 2935817681 149
55 iso_pu_bacteria 2935827899 2935834041 149
56 iso_pu_bacteria 2935837841 2935845468 149
57 iso_pu_bacteria 2935855204 2935859365 149
58 iso_pu_bacteria 2935864058 2935869992 149
59 iso_pu_bacteria 2935873716 2935880954 149
60 iso_pu_bacteria 2935992306 2935998272 149
61 iso_pu_bacteria 2936002035 2936009173 149
62 iso_pu_bacteria 2936037263 2936044418 149
63 iso_pu_bacteria 2940556831 2940565145 149
64 iso_pu_bacteria 2941538514 2941542928 149
65 iso_pu_bacteria 3005506211 3005507712 149
66 iso_pu_bacteria 3005710791 3005715923 149
67 iso_pu_bacteria 8006984368 8006992781 149
68 iso_pu_bacteria 8016511872 8016519821 149
69 iso_pu_bacteria 8017057580 8017065719 149
70 iso_pu_bacteria 8019576017 8019585149 149
71 iso_pu_bacteria 8019586578 8019593119 149
72 iso_pu_bacteria 8019608314 8019610033 149
73 iso_pu_bacteria 8055742211 8055744362 149
74 3300003203 JGI25406J46586_10076416 JGI25406J46586_100764162 150
75 3300005329 Ga0070683_100996311 Ga0070683_1009963111 150
76 3300005434 Ga0070709_10035355 Ga0070709_100353552 150
77 3300005436 Ga0070713_100004209 Ga0070713_1000042094 150
78 3300005436 Ga0070713_100531723 Ga0070713_1005317232 150
79 3300005437 Ga0070710_10005820 Ga0070710_100058207 150
80 3300005439 Ga0070711_100003431 Ga0070711_1000034314 150
81 3300005440 Ga0070705_100142035 Ga0070705_1001420352 150
82 3300005458 Ga0070681_10818090 Ga0070681_108180901 150
83 3300005466 Ga0070685_10185725 Ga0070685_101857252 150
84 3300005530 Ga0070679_100371960 Ga0070679_1003719601 150
85 3300005535 Ga0070684_100013030 Ga0070684_1000130305 150
86 3300005535 Ga0070684_100186065 Ga0070684_1001860653 150
87 3300005539 Ga0068853_100958217 Ga0068853_1009582171 150
88 3300005548 Ga0070665_100069717 Ga0070665_1000697172 150
89 3300005614 Ga0068856_100272323 Ga0068856_1002723233 150
90 3300005614 Ga0068856_100568412 Ga0068856_1005684122 150
91 3300005616 Ga0068852_100141978 Ga0068852_1001419783 150
92 3300005616 Ga0068852_100245230 Ga0068852_1002452303 150
93 3300005937 Ga0081455_10007307 Ga0081455_100073071 150
94 3300005937 Ga0081455_10023987 Ga0081455_100239872 150
95 3300005937 Ga0081455_10310090 Ga0081455_103100903 150
96 3300005983 Ga0081540_1060376 Ga0081540_10603764 150
97 3300005985 Ga0081539_10001607 Ga0081539_1000160714 150
98 3300006028 Ga0070717_10066097 Ga0070717_100660972 150
99 3300006028 Ga0070717_10884662 Ga0070717_108846622 150
100 3300006038 Ga0075365_10005221 Ga0075365_100052216 150
101 3300006038 Ga0075365_10235085 Ga0075365_102350851 150
102 3300006163 Ga0070715_10213066 Ga0070715_102130662 150
103 3300006178 Ga0075367_10589759 Ga0075367_105897592 150
104 3300006237 Ga0097621_100053491 Ga0097621_1000534915 150
105 3300006358 Ga0068871_100063957 Ga0068871_1000639575 150
106 3300006942 Ga0099824_1029471 Ga0099824_10294716 150
107 3300006943 Ga0099822_1003710 Ga0099822_100371028 150
108 3300009174 Ga0105241_11459521 Ga0105241_114595211 150
109 3300009176 Ga0105242_11877231 Ga0105242_118772312 150
110 3300009545 Ga0105237_10063193 Ga0105237_100631934 150
111 3300009545 Ga0105237_10099477 Ga0105237_100994771 150
112 3300011119 Ga0105246_10004377 Ga0105246_100043774 150
113 3300013102 Ga0157371_11078257 Ga0157371_110782571 150
114 3300013104 Ga0157370_10093087 Ga0157370_100930873 150
115 3300013105 Ga0157369_10026947 Ga0157369_100269474 150
116 3300013307 Ga0157372_10047361 Ga0157372_100473614 150
117 3300014325 Ga0163163_10011648 Ga0163163_100116487 150
118 3300014325 Ga0163163_10022927 Ga0163163_100229276 150
119 3300014968 Ga0157379_10078048 Ga0157379_100780484 150
120 3300017792 Ga0163161_10258928 Ga0163161_102589282 150
121 3300025261 Ga0209233_1064778 Ga0209233_10647781 150
122 3300025302 Ga0207426_1013299 Ga0207426_10132992 150
123 3300025315 Ga0207697_10475593 Ga0207697_104755931 150
124 3300025898 Ga0207692_10008854 Ga0207692_100088543 150
125 3300025904 Ga0207647_10158310 Ga0207647_101583102 150
126 3300025906 Ga0207699_10126485 Ga0207699_101264852 150
127 3300025913 Ga0207695_10022857 Ga0207695_100228578 150
128 3300025914 Ga0207671_10043998 Ga0207671_100439985 150
129 3300025914 Ga0207671_10626257 Ga0207671_106262571 150
130 3300025916 Ga0207663_10024152 Ga0207663_100241524 150
131 3300025922 Ga0207646_10651313 Ga0207646_106513132 150
132 3300025925 Ga0207650_11328492 Ga0207650_113284921 150
133 3300025928 Ga0207700_10002857 Ga0207700_100028574 150
134 3300025928 Ga0207700_10467424 Ga0207700_104674242 150
135 3300025929 Ga0207664_10095673 Ga0207664_100956732 150
136 3300025944 Ga0207661_10036379 Ga0207661_100363792 150
137 3300026095 Ga0207676_10266966 Ga0207676_102669662 150
138 3300026142 Ga0207698_10209459 Ga0207698_102094594 150
139 3300026142 Ga0207698_11347909 Ga0207698_113479091 150
140 3300027357 Ga0209589_1000003 Ga0209589_1000003229 150
141 3300027361 Ga0209489_100003 Ga0209489_100003280 150
142 3300027363 Ga0209700_100003 Ga0209700_100003280 150
143 3300028379 Ga0268266_10418038 Ga0268266_104180382 150
144 3300035695 Ga0373927_0225554 Ga0373927_0225554_142_594 150
145 3300037418 Ga0395900_0195654 Ga0395900_0195654_208_660 150
146 3300037418 Ga0395900_0348021 Ga0395900_0348021_639_1091 150
147 3300037466 Ga0395898_0243518 Ga0395898_0243518_232_684 150
148 3300037471 Ga0395905_0258642 Ga0395905_0258642_219_671 150
149 3300037471 Ga0395905_0892684 Ga0395905_0892684_24_476 150
150 3300037853 Ga0436364_1559429 Ga0436364_1559429_85_537 150
151 3300038443 Ga0395901_0050301 Ga0395901_0050301_3241_3693 150
152 3300038443 Ga0395901_0111347 Ga0395901_0111347_1936_2388 150
153 3300041451 Ga0451791_1821125 Ga0451791_1821125_430_882 150
154 3300041486 Ga0451807_1817701 Ga0451807_1817701_551_1003 150
155 3300041512 Ga0451853_0343720 Ga0451853_0343720_749_1201 150
156 3300044694 Ga0466963_0104864 Ga0466963_0104864_593_1045 150
157 3300044719 Ga0466971_0207611 Ga0466971_0207611_315_767 150
158 3300045976 Ga0466967_0755404 Ga0466967_0755404_21_473 150
159 3300046507 Ga0495606_0296511 Ga0495606_0296511_293_745 150
160 3300046518 Ga0495631_0168810 Ga0495631_0168810_367_819 150
161 3300046683 Ga0495658_0353492 Ga0495658_0353492_78_530 150
162 3300048905 Ga0496102_0123720 Ga0496102_0123720_1316_1768 150
163 3300048905 Ga0496102_0344157 Ga0496102_0344157_477_929 150
164 3300048908 Ga0496105_0100551 Ga0496105_0100551_12_464 150
165 3300048908 Ga0496105_0839704 Ga0496105_0839704_44_499 150
166 3300048909 Ga0496106_0090164 Ga0496106_0090164_299_751 150
167 3300048909 Ga0496106_0885879 Ga0496106_0885879_77_529 150
168 3300048910 Ga0496107_0306100 Ga0496107_0306100_32_484 150
169 3300048911 Ga0496108_0443732 Ga0496108_0443732_476_928 150
170 3300048911 Ga0496108_0444089 Ga0496108_0444089_633_1085 150
171 3300048912 Ga0496109_0068495 Ga0496109_0068495_674_1126 150
172 3300048914 Ga0496111_0299462 Ga0496111_0299462_211_663 150
173 3300048917 Ga0496114_0737559 Ga0496114_0737559_340_792 150
174 3300048918 Ga0496115_0154545 Ga0496115_0154545_1344_1796 150
175 3300048918 Ga0496115_0348099 Ga0496115_0348099_213_665 150
176 3300048918 Ga0496115_0884619 Ga0496115_0884619_77_529 150
177 3300049581 Ga0501047_0577412 Ga0501047_0577412_252_704 150
178 3300049586 Ga0501070_0052420 Ga0501070_0052420_986_1438 150
179 3300050492 nmdc:mga0yw44_10605_c1 nmdc:mga0yw44_10605_c1_4048_4500 150
180 3300050492 nmdc:mga0yw44_143602_c1 nmdc:mga0yw44_143602_c1_739_1191 150
181 3300048908 Ga0496105_0829511 Ga0496105_0829511_147_608 151
182 3300005457 Ga0070662_100046446 Ga0070662_1000464464 152
183 3300025918 Ga0207662_10269363 Ga0207662_102693633 152
184 3300047318 Ga0495636_0579876 Ga0495636_0579876_63_521 152
185 3300003215 JGI25153J46596_10000525 JGI25153J46596_1000052524 153
186 3300003215 JGI25153J46596_10000709 JGI25153J46596_1000070913 153
187 3300003316 rootH1_10150693 rootH1_101506932 153
188 3300003320 rootH2_10119237 rootH2_101192374 153
189 3300003322 rootL2_10053366 rootL2_100533662 153
190 3300003354 JGI25160J50197_1000671 JGI25160J50197_100067117 153
191 3300003771 Ga0055526_1070432 Ga0055526_10704321 153
192 3300003794 Ga0055531_10008243 Ga0055531_100082436 153
193 3300005262 Ga0065165_1015087 Ga0065165_10150872 153
194 3300005330 Ga0070690_100710608 Ga0070690_1007106081 153
195 3300005334 Ga0068869_100068186 Ga0068869_1000681864 153
196 3300005338 Ga0068868_100925569 Ga0068868_1009255691 153
197 3300005347 Ga0070668_100157374 Ga0070668_1001573743 153
198 3300005356 Ga0070674_100080828 Ga0070674_1000808283 153
199 3300005364 Ga0070673_100524722 Ga0070673_1005247222 153
200 3300005367 Ga0070667_100438891 Ga0070667_1004388911 153
201 3300005441 Ga0070700_100158990 Ga0070700_1001589903 153
202 3300005455 Ga0070663_100036182 Ga0070663_1000361823 153
203 3300005456 Ga0070678_100309885 Ga0070678_1003098853 153
204 3300005457 Ga0070662_100436783 Ga0070662_1004367833 153
205 3300005535 Ga0070684_100400887 Ga0070684_1004008872 153
206 3300005563 Ga0068855_100267817 Ga0068855_1002678172 153
207 3300005563 Ga0068855_100655734 Ga0068855_1006557343 153
208 3300005615 Ga0070702_100642081 Ga0070702_1006420811 153
209 3300005616 Ga0068852_100338101 Ga0068852_1003381012 153
210 3300005618 Ga0068864_100238058 Ga0068864_1002380583 153
211 3300005718 Ga0068866_10891858 Ga0068866_108918581 153
212 3300005719 Ga0068861_100090626 Ga0068861_1000906265 153
213 3300005719 Ga0068861_100936991 Ga0068861_1009369912 153
214 3300005841 Ga0068863_100658687 Ga0068863_1006586872 153
215 3300005843 Ga0068860_101241597 Ga0068860_1012415971 153
216 3300006038 Ga0075365_10067119 Ga0075365_100671193 153
217 3300006178 Ga0075367_10118829 Ga0075367_101188292 153
218 3300006178 Ga0075367_10439418 Ga0075367_104394182 153
219 3300006353 Ga0075370_10073223 Ga0075370_100732232 153
220 3300006358 Ga0068871_100124039 Ga0068871_1001240393 153
221 3300006881 Ga0068865_101300237 Ga0068865_1013002372 153
222 3300009011 Ga0105251_10447251 Ga0105251_104472511 153
223 3300009101 Ga0105247_10102883 Ga0105247_101028833 153
224 3300009101 Ga0105247_10312791 Ga0105247_103127912 153
225 3300009148 Ga0105243_10665428 Ga0105243_106654281 153
226 3300009176 Ga0105242_10413784 Ga0105242_104137842 153
227 3300009177 Ga0105248_10680337 Ga0105248_106803371 153
228 3300009545 Ga0105237_10128176 Ga0105237_101281763 153
229 3300009551 Ga0105238_10773849 Ga0105238_107738491 153
230 3300010375 Ga0105239_10146839 Ga0105239_101468393 153
231 3300010375 Ga0105239_10177496 Ga0105239_101774963 153
232 3300010375 Ga0105239_11529892 Ga0105239_115298921 153
233 3300011119 Ga0105246_10056500 Ga0105246_100565003 153
234 3300013306 Ga0163162_10155737 Ga0163162_101557373 153
235 3300013308 Ga0157375_10435709 Ga0157375_104357092 153
236 3300014325 Ga0163163_10183089 Ga0163163_101830893 153
237 3300014326 Ga0157380_10198972 Ga0157380_101989722 153
238 3300014497 Ga0182008_10150749 Ga0182008_101507491 153
239 3300014968 Ga0157379_10562999 Ga0157379_105629992 153
240 3300014969 Ga0157376_10555969 Ga0157376_105559691 153
241 3300017792 Ga0163161_10176807 Ga0163161_101768072 153
242 3300025295 Ga0209564_1006350 Ga0209564_10063507 153
243 3300025295 Ga0209564_1027715 Ga0209564_10277152 153
244 3300025297 Ga0209758_1000117 Ga0209758_1000117113 153
245 3300025297 Ga0209758_1001957 Ga0209758_10019574 153
246 3300025297 Ga0209758_1005617 Ga0209758_10056178 153
247 3300025299 Ga0209256_1002709 Ga0209256_100270914 153
248 3300025302 Ga0207426_1000213 Ga0207426_100021335 153
249 3300025302 Ga0207426_1007812 Ga0207426_10078128 153
250 3300025303 Ga0209051_1075834 Ga0209051_10758342 153
251 3300025304 Ga0209257_1001342 Ga0209257_10013427 153
252 3300025304 Ga0209257_1065304 Ga0209257_10653042 153
253 3300025899 Ga0207642_10733121 Ga0207642_107331211 153
254 3300025903 Ga0207680_10131665 Ga0207680_101316653 153
255 3300025904 Ga0207647_10171374 Ga0207647_101713743 153
256 3300025933 Ga0207706_10464853 Ga0207706_104648531 153
257 3300025945 Ga0207679_10186710 Ga0207679_101867101 153
258 3300025961 Ga0207712_10028198 Ga0207712_100281983 153
259 3300025972 Ga0207668_10064334 Ga0207668_100643341 153
260 3300026023 Ga0207677_10377250 Ga0207677_103772502 153
261 3300026035 Ga0207703_10043625 Ga0207703_100436255 153
262 3300026067 Ga0207678_10016379 Ga0207678_100163793 153
263 3300026095 Ga0207676_10118105 Ga0207676_101181053 153
264 3300026118 Ga0207675_100252114 Ga0207675_1002521142 153
265 3300026121 Ga0207683_10442149 Ga0207683_104421493 153
266 3300028381 Ga0268264_10170719 Ga0268264_101707194 153
267 3300028381 Ga0268264_10797834 Ga0268264_107978342 153
268 3300035695 Ga0373927_0295244 Ga0373927_0295244_214_675 153
269 3300046452 Ga0495617_059859 Ga0495617_059859_71_532 153
270 3300046459 Ga0495629_0007804 Ga0495629_0007804_3692_4153 153
271 3300046474 Ga0495605_0029094 Ga0495605_0029094_1856_2317 153
272 3300046491 Ga0495584_0174127 Ga0495584_0174127_56_517 153
273 3300046492 Ga0495585_0158207 Ga0495585_0158207_359_820 153
274 3300046500 Ga0495596_0020716 Ga0495596_0020716_1122_1583 153
275 3300046522 Ga0495643_0152606 Ga0495643_0152606_602_1063 153
276 3300046529 Ga0495652_0205263 Ga0495652_0205263_563_1024 153
277 3300046557 Ga0495622_0009257 Ga0495622_0009257_1137_1598 153
278 3300046665 Ga0495661_0244329 Ga0495661_0244329_293_754 153
279 3300046675 Ga0495657_0051707 Ga0495657_0051707_1081_1542 153
280 3300046794 Ga0495589_0369541 Ga0495589_0369541_157_618 153
281 3300047321 Ga0495676_0133456 Ga0495676_0133456_437_898 153
282 3300047469 Ga0495673_0082212 Ga0495673_0082212_530_991 153
283 3300047469 Ga0495673_0086187 Ga0495673_0086187_52_513 153
284 3300047471 Ga0495684_0275163 Ga0495684_0275163_627_1088 153
285 3300047472 Ga0495686_0136128 Ga0495686_0136128_868_1329 153
286 3300047472 Ga0495686_0576922 Ga0495686_0576922_53_514 153
287 3300047673 Ga0495593_0185577 Ga0495593_0185577_112_573 153
288 3300048089 Ga0495614_0167520 Ga0495614_0167520_255_716 153
289 3300048903 Ga0496100_0069238 Ga0496100_0069238_570_1031 153
290 3300048904 Ga0496101_0146490 Ga0496101_0146490_650_1111 153
291 3300048904 Ga0496101_0438338 Ga0496101_0438338_87_548 153
292 3300048905 Ga0496102_0069974 Ga0496102_0069974_712_1173 153
293 3300048905 Ga0496102_0305867 Ga0496102_0305867_540_1001 153
294 3300048906 Ga0496103_0081921 Ga0496103_0081921_870_1331 153
295 3300048906 Ga0496103_0127093 Ga0496103_0127093_158_619 153
296 3300048907 Ga0496104_0021222 Ga0496104_0021222_2182_2643 153
297 3300048907 Ga0496104_0040287 Ga0496104_0040287_2939_3400 153
298 3300048907 Ga0496104_0172091 Ga0496104_0172091_500_961 153
299 3300048908 Ga0496105_0026563 Ga0496105_0026563_3279_3740 153
300 3300048908 Ga0496105_0036549 Ga0496105_0036549_2543_3004 153
301 3300048909 Ga0496106_0084762 Ga0496106_0084762_678_1139 153
302 3300048909 Ga0496106_0229640 Ga0496106_0229640_278_739 153
303 3300048910 Ga0496107_0103643 Ga0496107_0103643_434_895 153
304 3300048910 Ga0496107_0263379 Ga0496107_0263379_651_1112 153
305 3300048911 Ga0496108_0012497 Ga0496108_0012497_5347_5808 153
306 3300048911 Ga0496108_0143491 Ga0496108_0143491_1199_1660 153
307 3300048912 Ga0496109_0014187 Ga0496109_0014187_5546_6007 153
308 3300048912 Ga0496109_0262672 Ga0496109_0262672_652_1113 153
309 3300048913 Ga0496110_0319776 Ga0496110_0319776_257_718 153
310 3300048914 Ga0496111_0087836 Ga0496111_0087836_1327_1788 153
311 3300048914 Ga0496111_0138765 Ga0496111_0138765_636_1097 153
312 3300048915 Ga0496112_0021296 Ga0496112_0021296_696_1157 153
313 3300048915 Ga0496112_0109379 Ga0496112_0109379_1764_2225 153
314 3300048916 Ga0496113_0165180 Ga0496113_0165180_368_829 153
315 3300048917 Ga0496114_0118526 Ga0496114_0118526_1276_1737 153
316 3300048917 Ga0496114_0209226 Ga0496114_0209226_863_1324 153
317 3300048918 Ga0496115_0034820 Ga0496115_0034820_2255_2716 153
318 3300048918 Ga0496115_0118228 Ga0496115_0118228_692_1153 153
319 3300048919 Ga0496116_0026015 Ga0496116_0026015_809_1270 153
320 3300048920 Ga0496117_0139886 Ga0496117_0139886_308_769 153
321 3300048922 Ga0496119_0021318 Ga0496119_0021318_3079_3540 153
322 3300048922 Ga0496119_0148203 Ga0496119_0148203_327_788 153
323 3300048923 Ga0496120_0038254 Ga0496120_0038254_841_1302 153
324 3300048924 Ga0496121_0006909 Ga0496121_0006909_9635_10096 153
325 3300048924 Ga0496121_0435212 Ga0496121_0435212_139_600 153
326 3300048928 Ga0496125_0018653 Ga0496125_0018653_5231_5695 153
327 3300048928 Ga0496125_0068102 Ga0496125_0068102_1236_1697 153
328 3300048929 Ga0496126_0038471 Ga0496126_0038471_532_993 153
329 3300049460 Ga0495682_0106562 Ga0495682_0106562_406_867 153
330 3300050489 nmdc:mga03683_248840_c1 nmdc:mga03683_248840_c1_157_618 153
331 3300050492 nmdc:mga0yw44_89951_c1 nmdc:mga0yw44_89951_c1_243_707 153
332 3300050516 nmdc:mga0sz30_34825_c1 nmdc:mga0sz30_34825_c1_35_499 153
333 3300053109 Ga0500569_001126 Ga0500569_001126_2111_2578 153
334 3300053133 Ga0500655_124895 Ga0500655_124895_23_490 153
335 3300053153 Ga0500616_0124056 Ga0500616_0124056_396_857 153
336 3300053177 Ga0500636_0300464 Ga0500636_0300464_16_477 153
337 3300053722 Ga0500649_100182 Ga0500649_100182_168_629 153
338 3300053731 Ga0500609_003170 Ga0500609_003170_1318_1785 153
339 3300025900 Ga0207710_10035924 Ga0207710_100359244 156
340 3300005983 Ga0081540_1174300 Ga0081540_11743001 159
341 3300009093 Ga0105240_10030110 Ga0105240_100301104 159
342 3300050489 nmdc:mga03683_512078_c1 nmdc:mga03683_512078_c1_32_526 159
343 3300050493 nmdc:mga0k408_197587_c1 nmdc:mga0k408_197587_c1_118_612 159
344 3300002244 JGI24742J22300_10040927 JGI24742J22300_100409272 162
345 3300005548 Ga0070665_101151968 Ga0070665_1011519682 162
346 3300005841 Ga0068863_100761486 Ga0068863_1007614861 162
347 3300006358 Ga0068871_100708501 Ga0068871_1007085012 162
348 3300025901 Ga0207688_10272021 Ga0207688_102720211 162
349 3300025945 Ga0207679_10562390 Ga0207679_105623902 162
350 3300026095 Ga0207676_10537931 Ga0207676_105379312 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

27

174

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.907 10 159
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8928 12 161
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.8747 10 159
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8534 11 161
5ahw-assembly3.cif.gz_E crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8469 11 161
ID Description Score Start End Superfamily
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.907 10 159 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8864 10 162 3.40.50.620
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8747 10 159 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8694 10 162 3.40.50.620
af_Q8GZ84_25_155_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.832 12 127 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A503WAM9-F1-model_v4 Universal stress protein 0.9061 10 158
AF-A0A0R3LSF3-F1-model_v4 Universal stress protein 0.8954 10 157 GO:0005737
AF-A0A503WAM9-F1-model_v4 Universal stress protein 0.8947 10 158
AF-A0A1I3PA70-F1-model_v4 Nucleotide-binding universal stress protein, UspA family 0.8932 35 158
AF-A0A3P3G160-F1-model_v4 Universal stress protein 0.8903 10 133

Feature Viewer

pLDDT pTM Quality
85.63 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map